Citrus Sinensis ID: 019010

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------
MSSDEIALNGLNTQLVFQDDPLRSFNCQQHRVGDPGPKTRELTGFIDDKMFSVDRDRYFRPQPTMFTEHHPERRDPPQAREWSGNATSPSTDESDGEDDDVDDDEDDDDVDEAEKNNNHNSNSNVTNCNNNNNSTNCGILTAGVEKMGNGKAKNQLNFGKIGNAGQNVNNGAIVTVAEADSDVYYSQYLQQGTEGSSGSGQKECVAVDNGCGISGSGDSLRAILSDPVTGNLMDDAMILPCGHSFGAAGVQHVIRMKACYTCSRPVLEDSIAPNLSLRAAVQAFRREEELQFYRTCKRKREKFDQDKGSYGDSTVMDPPRGRGVQFPFAVTDRVIIKVCLAKSRAFG
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccEEEcccccccccccccccEEccccccccccHHHHHHHHcccccHHHcccccccccccccccHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccEEEEEEEEHHccccc
cccHHccccccccccEcccccccccccccccccccccccHEHHHHHccccEEEcccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccEEEccccccccccccccccEEccccccccccccccEEEEEccccccEEEEEEcccccccccccccccEEEcccccccccHHHHHHHHcccccHHHHHccEEEcccccccHHHHHHHHHHHHcccccccccHHcccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccccccccccccccccccEEccEEEccEEEEEEEEEcHcccc
mssdeialnglntqlvfqddplrsfncqqhrvgdpgpktreltgfiddkmfsvdrdryfrpqptmftehhperrdppqarewsgnatspstdesdgedddvdddeddddvdeaeknnnhnsnsnvtncnnnnnstncgiLTAGvekmgngkaknqlnfgkignagqnvnnGAIVTVAEADSDVYYSQYlqqgtegssgsgqkecvavdngcgisgsgdSLRAIlsdpvtgnlmddamilpcghsfgaaGVQHVIRMKACytcsrpvledsiapnLSLRAAVQAFRREEELQFYRTCKRKRekfdqdkgsygdstvmdpprgrgvqfpfaVTDRVIIKVCLAKSRAFG
MSSDEIALNGLNTQLVFQDDPLRSFNcqqhrvgdpgpktreltgfiddkmfsvdrdRYFRPqptmftehhperrdppqarewsgnatspstdesdgedddVDDDEDDDDVDEaeknnnhnsnsnvtncnnnnnSTNCGILTAGVEKMGNGKAKNQLNFGKIGNAGQNVNNGAIVTVAEADSDVYYSQYLQQGtegssgsgQKECVAVDNGCGISGSGDSLRAILSDPVTGNLMDDAMILPCGHSFGAAGVQHVIRMKACYTCSRPVLEDSIAPNLSLRAAVQAFRREEELqfyrtckrkrekfdqdkgsygdstvmdpprgrgvqfpfavtdrVIIKVCLAKSRAFG
MSSDEIALNGLNTQLVFQDDPLRSFNCQQHRVGDPGPKTRELTGFIDDKMFSVDRDRYFRPQPTMFTEHHPERRDPPQAREWSGNATSPSTdesdgedddvdddeddddvdeAEKnnnhnsnsnvtncnnnnnstncGILTAGVEKMGNGKAKNQLNFGKIGNAGQNVNNGAIVTVAEADSDVYYSQYLQQGTEgssgsgQKECVAVDNGCGISGSGDSLRAILSDPVTGNLMDDAMILPCGHSFGAAGVQHVIRMKACYTCSRPVLEDSIAPNLSLRAAVQAFRREEELQFYRTCKRKREKFDQDKGSYGDSTVMDPPRGRGVQFPFAVTDRVIIKVCLAKSRAFG
*********GLNTQLVFQDDPLRSFNC***************TGFIDDKMFSVD************************************************************************************ILTA************QLNFGKIGNAGQNVNNGAIVTVAEADSDVYYSQYLQ*************CVAVDNGCGISGSGDSLRAILSDPVTGNLMDDAMILPCGHSFGAAGVQHVIRMKACYTCSRPVLEDSIAPNLSLRAAVQAFRREEELQFYRTC**************************GVQFPFAVTDRVIIKVCLA******
**********LNTQLVFQDDPLRSFNC***********TRELTGFIDDKMFSVDRDRYFRPQPTMFTE*H************************************D**********************************AGVEKMGNGKAKNQL********************AEADSDVYYS********************************SLRAILSDPVTGNLMDDAMILPCGHSFGAAGVQHVIRMKACYTCSRPVLEDSIAPNLSLRAAVQ*******************************************FPFAVTDRVIIKVCLAKS*A**
MSSDEIALNGLNTQLVFQDDPLRSFNCQQHRVGDPGPKTRELTGFIDDKMFSVDRDRYFRPQPTMFT***********************************************KNNNHNSNSNVTNCNNNNNSTNCGILTAGVEKMGNGKAKNQLNFGKIGNAGQNVNNGAIVTVAEADSDVYYSQYLQ***********KECVAVDNGCGISGSGDSLRAILSDPVTGNLMDDAMILPCGHSFGAAGVQHVIRMKACYTCSRPVLEDSIAPNLSLRAAVQAFRREEELQFYRTCKRKREKFDQDKGSYGDSTVMDPPRGRGVQFPFAVTDRVIIKVCLAKSRAFG
*****IALNGLNTQLVFQDDPLRSFNCQQHRVGDPGPKTRELTGFIDDKMFSVDRDRYFRPQPTMFTEHHPERRDPPQA*******************************DEAE********SN*TNC*****STNCGILTAGVEKMGNGKAKNQLNFGKIGNAGQNVNNGAIVTVAEADSDVYYSQYLQQGTEGSSGSGQKECVAVDNGCGISGSGDSLRAILSDPVTGNLMDDAMILPCGHSFGAAGVQHVIRMKACYTCSRPVLEDSIAPNLSLRAAVQAFRREEELQFYRT**RK*********************GRGVQFPFAVTDRVIIKVCLAKSR***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSDEIALNGLNTQLVFQDDPLRSFNCQQHRVGDPGPKTRELTGFIDDKMFSVDRDRYFRPQPTMFTEHHPERRDPPQAREWSGNATSPSTDESDGEDDDVDDDEDDDDVDEAEKNNNHNSNSNVTNCNNNNNSTNCGILTAGVEKMGNGKAKNQLNFGKIGNAGQNVNNGAIVTVAEADSDVYYSQYLQQGTEGSSGSGQKECVAVDNGCGISGSGDSLRAILSDPVTGNLMDDAMILPCGHSFGAAGVQHVIRMKACYTCSRPVLEDSIAPNLSLRAAVQAFRREEELQFYRTCKRKREKFDQDKGSYGDSTVMDPPRGRGVQFPFAVTDRVIIKVCLAKSRAFG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query347 2.2.26 [Sep-21-2011]
Q6DBN5363 U-box domain-containing p yes no 0.824 0.787 0.36 3e-42
Q58FY4383 U-box domain-containing p no no 0.351 0.318 0.549 1e-33
>sp|Q6DBN5|PUB62_ARATH U-box domain-containing protein 62 OS=Arabidopsis thaliana GN=PUB62 PE=2 SV=1 Back     alignment and function desciption
 Score =  172 bits (436), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 126/350 (36%), Positives = 168/350 (48%), Gaps = 64/350 (18%)

Query: 1   MSSDEIALNGLNTQLVF-QD-DPLRSFNCQQHRVGDPGPKTRELTGFIDDKMFSVDRDRY 58
           MS   ++    N Q +  QD DPLR       RVG+  PKTRE   FI D        RY
Sbjct: 1   MSGKGLSPAPFNAQPMIVQDADPLR------FRVGEQDPKTREFAAFIGDH-------RY 47

Query: 59  FRPQPTMFTEHHPERRDPPQAREWSGNATSPSTDESDGEDDDVDDDEDDDDVDEAEKNNN 118
           F          +P                 P  +                      + N 
Sbjct: 48  FAAAAAAAAAANPH----------------PHLE---------------------FRQNF 70

Query: 119 HNSNSNVTNCNNNNNSTNCGILTAGVEKMGNGKAKNQLNFGKIGNAGQ-NVNNGAIVTVA 177
           ++    + N N++  S     +    E   +    N+ + G   +AG+ +V+ GA++ V 
Sbjct: 71  YSEKPIIGNPNDSGGSDGEDDVDVEEEDEDDDLDGNEGDIGMNKDAGEDSVSAGAVIVVG 130

Query: 178 EADSDVYYSQYLQQGTEGSSGSGQKECVAVDNGCGISGSGD----------SLRAILSDP 227
           + D+  YYSQ+ +          ++  +A DNGC  SG  D          SLR ILSDP
Sbjct: 131 Q-DNAAYYSQHFKTVEASFVSRNEESSIAADNGCDFSGRRDLSSSSSNSIESLRTILSDP 189

Query: 228 VTGNLMDDAMILPCGHSFGAAGVQHVIRMKACYTCSRPVLEDSIAPNLSLRAAVQAFRRE 287
            TG+LM DAMILPCGH+FGA G++ V +MKAC TCS+PV EDSI PNL+LR AVQAF RE
Sbjct: 190 TTGSLMADAMILPCGHTFGAGGIEQVKQMKACCTCSQPVSEDSITPNLTLRVAVQAFCRE 249

Query: 288 EELQFYRTCKRKREKFDQDKGSYGDSTVMDPPRGRGVQFPFAVTDRVIIK 337
           E  Q     KRKRE FDQ++ ++G +      R +   FPFAV DRVIIK
Sbjct: 250 ENSQSNHPSKRKREGFDQERRAFGVTNHSGRSRNKSNHFPFAVADRVIIK 299
Functions as an E3 ubiquitin ligase.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q58FY4|PUB63_ARATH U-box domain-containing protein 63 OS=Arabidopsis thaliana GN=PUB63 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query347
147839974 452 hypothetical protein VITISV_024206 [Viti 0.959 0.736 0.534 6e-93
225448699441 PREDICTED: U-box domain-containing prote 0.951 0.748 0.536 2e-92
356507514426 PREDICTED: U-box domain-containing prote 0.939 0.765 0.498 6e-75
449460185429 PREDICTED: U-box domain-containing prote 0.922 0.745 0.502 4e-74
297736483384 unnamed protein product [Vitis vinifera] 0.812 0.734 0.524 6e-74
356518698428 PREDICTED: U-box domain-containing prote 0.919 0.745 0.5 1e-73
449457472379 PREDICTED: U-box domain-containing prote 0.818 0.749 0.513 8e-65
449524615380 PREDICTED: U-box domain-containing prote 0.818 0.747 0.524 2e-64
388522335432 unknown [Medicago truncatula] 0.916 0.736 0.480 3e-64
255559723394 conserved hypothetical protein [Ricinus 0.452 0.398 0.723 3e-63
>gi|147839974|emb|CAN61689.1| hypothetical protein VITISV_024206 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  347 bits (889), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 207/387 (53%), Positives = 258/387 (66%), Gaps = 54/387 (13%)

Query: 1   MSSDEIAL-------NGLNTQLVFQDDPLRSFNC--QQHRVGDPGPKTRELTGFIDDKMF 51
           M+S+E+         NGLN+QLVFQD+ LR FNC   Q RVGDPGPKTREL+ FID+KMF
Sbjct: 1   MASEEVGFVPPQRLENGLNSQLVFQDEALR-FNCGAPQRRVGDPGPKTRELSSFIDEKMF 59

Query: 52  SVDRDRYFRPQ-----PTMFTEHHPERRDPPQAREWSGNATSPSTDESDGEDDDVDDDED 106
            V+RDRYF PQ      +++ +  PER   P  R W+GN  +P+      E ++ DD+E+
Sbjct: 60  CVERDRYFHPQGGEFRRSIYGDAPPER---PDGRNWNGNGNTPTPSGEGSEGEEDDDEEE 116

Query: 107 DDDVDEAEKNNNHNSNSNVTNCNNNNNSTNCGILTAGVEKMGNGKAKNQLNFGK------ 160
           +DD DE ++ +         +  N +N+ + G L +  +K+GNGKAK+  +FG       
Sbjct: 117 EDDDDEVDEGDGEVEGLVAVDDANKSNNHSSGSLHSSADKIGNGKAKDHSSFGSNRDVLM 176

Query: 161 ------------IGNAGQNVNNGAI------VTVAEADSDVYYSQYLQQGTEGSSGSGQK 202
                         +  +N   G I      VT+AE D D+YYSQ+LQ G EGS+  GQK
Sbjct: 177 KDGAIVLSTNSARASPSENHRQGRISHYQNAVTIAEPDGDMYYSQFLQ-GPEGSA-PGQK 234

Query: 203 ECVAVDNGCGISG---------SGDSLRAILSDPVTGNLMDDAMILPCGHSFGAAGVQHV 253
           E +AV+NGCG SG         SG+SL+AILSDP+TG LMDDAMILPCGHSFG  G+QHV
Sbjct: 235 E-LAVENGCGFSGRKDVSLSTESGESLKAILSDPLTGALMDDAMILPCGHSFGGGGMQHV 293

Query: 254 IRMKACYTCSRPVLEDSIAPNLSLRAAVQAFRREEELQFYRTCKRKREKFDQDKGSYGDS 313
           I+MKAC TCS+P  EDS+ PNLSLRAAVQAFRREEELQ YRT KR+RE+ DQDK SYGDS
Sbjct: 294 IKMKACSTCSQPFSEDSVQPNLSLRAAVQAFRREEELQVYRTSKRRRERSDQDKCSYGDS 353

Query: 314 TVMDPPRGRGVQFPFAVTDRVIIKVCL 340
           T+MD PRGRGVQFPFAVTDRVIIK+ L
Sbjct: 354 TLMDTPRGRGVQFPFAVTDRVIIKLQL 380

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225448699|ref|XP_002275253.1| PREDICTED: U-box domain-containing protein 62-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356507514|ref|XP_003522509.1| PREDICTED: U-box domain-containing protein 62-like [Glycine max] Back     alignment and taxonomy information
>gi|449460185|ref|XP_004147826.1| PREDICTED: U-box domain-containing protein 62-like [Cucumis sativus] gi|449476988|ref|XP_004154895.1| PREDICTED: U-box domain-containing protein 62-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297736483|emb|CBI25354.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356518698|ref|XP_003528015.1| PREDICTED: U-box domain-containing protein 62-like [Glycine max] Back     alignment and taxonomy information
>gi|449457472|ref|XP_004146472.1| PREDICTED: U-box domain-containing protein 62-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449524615|ref|XP_004169317.1| PREDICTED: U-box domain-containing protein 62-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|388522335|gb|AFK49229.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|255559723|ref|XP_002520881.1| conserved hypothetical protein [Ricinus communis] gi|223540012|gb|EEF41590.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query347
TAIR|locus:2153484363 AT5G05230 [Arabidopsis thalian 0.518 0.495 0.497 1.1e-46
TAIR|locus:2061823383 AT2G40640 "AT2G40640" [Arabido 0.455 0.412 0.472 1.2e-35
TAIR|locus:504955744554 AT3G19895 "AT3G19895" [Arabido 0.340 0.212 0.368 6.1e-20
TAIR|locus:2153484 AT5G05230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 436 (158.5 bits), Expect = 1.1e-46, Sum P(2) = 1.1e-46
 Identities = 97/195 (49%), Positives = 123/195 (63%)

Query:   157 NFGKIG---NAGQN-VNNGAIVTVAEADSDVYYSQYLQQGTEXXXXXXQKECVAVDNGCG 212
             N G IG   +AG++ V+ GA++ V + D+  YYSQ+ +          ++  +A DNGC 
Sbjct:   106 NEGDIGMNKDAGEDSVSAGAVIVVGQ-DNAAYYSQHFKTVEASFVSRNEESSIAADNGCD 164

Query:   213 ISGSGD----------SLRAILSDPVTGNLMDDAMILPCGHSFGAAGVQHVIRMKACYTC 262
              SG  D          SLR ILSDP TG+LM DAMILPCGH+FGA G++ V +MKAC TC
Sbjct:   165 FSGRRDLSSSSSNSIESLRTILSDPTTGSLMADAMILPCGHTFGAGGIEQVKQMKACCTC 224

Query:   263 SRPVLEDSIAPNLSLRAAVQAFRREEELQFYRTCKRKREKFDQDKGSYGDSTVMDPPRGR 322
             S+PV EDSI PNL+LR AVQAF REE  Q     KRKRE FDQ++ ++G +      R +
Sbjct:   225 SQPVSEDSITPNLTLRVAVQAFCREENSQSNHPSKRKREGFDQERRAFGVTNHSGRSRNK 284

Query:   323 GVQFPFAVTDRVIIK 337
                FPFAV DRVIIK
Sbjct:   285 SNHFPFAVADRVIIK 299
GO:0000151 "ubiquitin ligase complex" evidence=IEA
GO:0004842 "ubiquitin-protein ligase activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0016567 "protein ubiquitination" evidence=IEA
TAIR|locus:2061823 AT2G40640 "AT2G40640" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955744 AT3G19895 "AT3G19895" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query347
pfam0456473 pfam04564, U-box, U-box domain 5e-04
>gnl|CDD|203049 pfam04564, U-box, U-box domain Back     alignment and domain information 
 Score = 37.7 bits (88), Expect = 5e-04
 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 2/66 (3%)

Query: 226 DPVTGNLMDDAMILPCGHSFG-AAGVQHVIRMKACYTCSRPVL-EDSIAPNLSLRAAVQA 283
           DP+T  LM D +ILP G ++  +   +H++ +      +R  L  D + PNL L+  + A
Sbjct: 7   DPITLELMKDPVILPSGITYDRSTIERHLLSVDPTDPFTREPLTHDQLIPNLELKEKIDA 66

Query: 284 FRREEE 289
           +  E  
Sbjct: 67  WLEENR 72

This domain is related to the Ring finger pfam00097 but lacks the zinc binding residues. Length = 73

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 347
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.27
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 99.22
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.16
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 99.15
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 99.04
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 99.0
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.97
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.93
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.84
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.75
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.71
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.69
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.66
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.61
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.58
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.55
PHA02929238 N1R/p28-like protein; Provisional 98.54
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.49
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.44
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.44
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 98.38
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.26
PF1463444 zf-RING_5: zinc-RING finger domain 98.25
KOG2660 331 consensus Locus-specific chromosome binding protei 98.25
PHA02926242 zinc finger-like protein; Provisional 98.21
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.17
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 98.13
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 98.09
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.08
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 97.82
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.69
COG5222427 Uncharacterized conserved protein, contains RING Z 97.66
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 97.65
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.49
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 97.48
COG5152259 Uncharacterized conserved protein, contains RING a 97.44
KOG0297 391 consensus TNF receptor-associated factor [Signal t 97.43
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 97.41
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.3
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 97.27
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 97.25
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 97.04
KOG1002 791 consensus Nucleotide excision repair protein RAD16 96.75
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 96.72
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 96.49
KOG4367 699 consensus Predicted Zn-finger protein [Function un 96.35
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 96.28
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 96.22
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 96.13
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 96.05
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 95.93
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 95.61
KOG0825 1134 consensus PHD Zn-finger protein [General function 95.56
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 95.53
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 95.51
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 95.42
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 95.3
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 95.16
PF04641260 Rtf2: Rtf2 RING-finger 95.08
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 94.8
KOG1001674 consensus Helicase-like transcription factor HLTF/ 94.42
KOG3039303 consensus Uncharacterized conserved protein [Funct 94.3
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 94.04
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 94.01
COG5175 480 MOT2 Transcriptional repressor [Transcription] 93.32
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 93.25
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 92.7
KOG3002 299 consensus Zn finger protein [General function pred 92.58
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 92.47
COG52191525 Uncharacterized conserved protein, contains RING Z 92.46
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 91.87
KOG4739 233 consensus Uncharacterized protein involved in syna 91.78
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 91.65
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 91.49
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 90.79
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 90.67
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 90.23
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 90.1
KOG1941518 consensus Acetylcholine receptor-associated protei 89.47
KOG149384 consensus Anaphase-promoting complex (APC), subuni 88.94
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 88.78
KOG3039 303 consensus Uncharacterized conserved protein [Funct 87.5
PHA03096284 p28-like protein; Provisional 87.07
COG5236 493 Uncharacterized conserved protein, contains RING Z 87.02
KOG0298 1394 consensus DEAD box-containing helicase-like transc 86.95
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 86.92
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 86.23
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 86.04
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 85.86
PF06524314 NOA36: NOA36 protein; InterPro: IPR010531 This fam 85.07
KOG1812 384 consensus Predicted E3 ubiquitin ligase [Posttrans 84.96
COG5109396 Uncharacterized conserved protein, contains RING Z 83.3
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 82.37
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 80.23
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information 
Probab=99.27  E-value=4.3e-12  Score=94.70  Aligned_cols=61  Identities=23%  Similarity=0.478  Sum_probs=55.6

Q ss_pred             ccccccccCCcCCCeecCCCCccccccHHhhhc-cCCCCCCCCCCcCCCCcccHHHHHHHHH
Q 019010          223 ILSDPVTGNLMDDAMILPCGHSFGAAGVQHVIR-MKACYTCSRPVLEDSIAPNLSLRAAVQA  283 (347)
Q Consensus       223 ~L~CPIClell~dPVtl~CGHsFC~~CL~~~le-~~~CP~Cr~~v~~~~l~pN~~L~~LVe~  283 (347)
                      .+.||||+++|.+||+++|||+||+.||..|++ ...||.|+.++...++.++..|+..++.
T Consensus         1 ~~~Cpi~~~~~~~Pv~~~~G~v~~~~~i~~~~~~~~~cP~~~~~~~~~~l~~~~~l~~~i~~   62 (63)
T smart00504        1 EFLCPISLEVMKDPVILPSGQTYERRAIEKWLLSHGTDPVTGQPLTHEDLIPNLALKSAIQE   62 (63)
T ss_pred             CcCCcCCCCcCCCCEECCCCCEEeHHHHHHHHHHCCCCCCCcCCCChhhceeCHHHHHHHHh
Confidence            367999999999999999999999999999996 5689999999998999999999888753

Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query347
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 3e-10
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 3e-07
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 6e-07
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 3e-06
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 2e-05
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 5e-05
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 6e-05
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 1e-04
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 3e-04
2f42_A179 STIP1 homology and U-box containing protein 1; cha 5e-04
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 8e-04
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
 Score = 55.2 bits (133), Expect = 3e-10
 Identities = 23/95 (24%), Positives = 42/95 (44%), Gaps = 10/95 (10%)

Query: 213 ISGSGDSLRAILSDPVTGNLMDDAMILP-CGHSFGAAGVQHVIRMKACYTC----SRPVL 267
           +    D +   L   +  ++M DA+++P CG+S+    ++  +     +TC       V 
Sbjct: 3   LGSEDDPIPDELLCLICKDIMTDAVVIPCCGNSYCDECIRTALLESDEHTCPTCHQNDVS 62

Query: 268 EDSIAPNLSLRAAVQAFRREEELQFYRTCKRKREK 302
            D++  N  LR AV  F+ E         KR R++
Sbjct: 63  PDALIANKFLRQAVNNFKNETGYT-----KRLRKQ 92
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Length = 100 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Length = 968 Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Length = 98 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Length = 78 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Length = 179 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query347
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.56
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.53
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.53
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.53
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.52
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.47
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.44
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.43
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.43
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.42
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.42
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.42
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.39
2f42_A179 STIP1 homology and U-box containing protein 1; cha 99.37
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.37
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.36
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.35
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.34
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.34
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.34
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.33
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.32
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.32
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.3
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.27
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.27
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.27
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 99.17
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.17
2ect_A78 Ring finger protein 126; metal binding protein, st 99.15
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.15
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.15
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.15
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.14
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.13
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 99.12
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.11
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.11
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.11
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.05
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.02
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.02
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.99
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.96
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.95
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.94
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.93
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.9
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.89
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.87
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.87
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.86
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.79
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.77
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.75
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.69
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.63
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.62
2ea5_A68 Cell growth regulator with ring finger domain prot 98.62
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.55
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.53
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.5
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.47
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.45
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.36
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.14
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.03
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 97.61
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.6
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.08
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 96.82
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 96.72
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 95.81
3nw0_A238 Non-structural maintenance of chromosomes element 93.16
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 92.12
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 91.04
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 81.59
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
Probab=99.56  E-value=3e-15  Score=118.39  Aligned_cols=70  Identities=21%  Similarity=0.296  Sum_probs=64.2

Q ss_pred             ccccccccccccCCcCCCeecCCCCccccccHHhhhc-cCCCCCCCCCCcCCCCcccHHHHHHHHHHHHHH
Q 019010          219 SLRAILSDPVTGNLMDDAMILPCGHSFGAAGVQHVIR-MKACYTCSRPVLEDSIAPNLSLRAAVQAFRREE  288 (347)
Q Consensus       219 ~L~e~L~CPIClell~dPVtl~CGHsFC~~CL~~~le-~~~CP~Cr~~v~~~~l~pN~~L~~LVe~~k~~~  288 (347)
                      .+.+.+.||||+++|.+||+++|||+||+.||..|+. ...||.|+.++....+.+|..|+.+++.+....
T Consensus        10 ~~p~~~~CpI~~~~m~dPV~~~cGhtf~r~~I~~~l~~~~~cP~~~~~l~~~~l~pn~~L~~~i~~~~~~~   80 (85)
T 2kr4_A           10 DAPDEFRDPLMDTLMTDPVRLPSGTVMDRSIILRHLLNSPTDPFNRQMLTESMLEPVPELKEQIQAWMREK   80 (85)
T ss_dssp             TCCTTTBCTTTCSBCSSEEECTTSCEEEHHHHHHHHHHCSBCTTTCCBCCGGGCEECHHHHHHHHHHHHHH
T ss_pred             cCchheECcccCchhcCCeECCCCCEECHHHHHHHHhcCCCCCCCcCCCChHhcchHHHHHHHHHHHHHHh
Confidence            4577899999999999999999999999999999996 678999999999899999999999998887654
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 347
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 6e-08
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 1e-05
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 2e-05
d2c2la280 g.44.1.2 (A:225-304) STIP1 homology and U box-cont 4e-04
d1wgma_98 g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Hu 0.003
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 0.004
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: brca1 RING domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 48.1 bits (114), Expect = 6e-08
 Identities = 12/73 (16%), Positives = 29/73 (39%), Gaps = 4/73 (5%)

Query: 218 DSLRAILSDPVTGNLMDDAMILPCGHSFGAAGVQHVIRMK----ACYTCSRPVLEDSIAP 273
           ++++ IL  P+   L+ + +   C H F    +  ++  K     C  C   + + S+  
Sbjct: 16  NAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQE 75

Query: 274 NLSLRAAVQAFRR 286
           +      V+   +
Sbjct: 76  STRFSQLVEELLK 88
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query347
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.58
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.57
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.5
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.49
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.44
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.39
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.22
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.14
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.1
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.0
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.93
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.82
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.8
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.51
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.37
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.2
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.8
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: U-box
domain: STIP1 homology and U box-containing protein 1, STUB1
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.58  E-value=6.5e-16  Score=118.93  Aligned_cols=67  Identities=18%  Similarity=0.397  Sum_probs=61.1

Q ss_pred             cccccccccccCCcCCCeecCCCCccccccHHhhhc--cCCCCCCCCCCcCCCCcccHHHHHHHHHHHH
Q 019010          220 LRAILSDPVTGNLMDDAMILPCGHSFGAAGVQHVIR--MKACYTCSRPVLEDSIAPNLSLRAAVQAFRR  286 (347)
Q Consensus       220 L~e~L~CPIClell~dPVtl~CGHsFC~~CL~~~le--~~~CP~Cr~~v~~~~l~pN~~L~~LVe~~k~  286 (347)
                      +.+.|.||||+++|.+||+++|||+||+.||.+|+.  ...||.|+.++....+.+|..|+.+|+.+..
T Consensus         4 iP~~l~CpIc~~l~~dPv~~~cGhtfc~~ci~~~l~~~~~~cP~c~~~l~~~~l~pN~~L~~~I~~~l~   72 (80)
T d2c2la2           4 IPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFNPVTRSPLTQEQLIPNLAMKEVIDAFIS   72 (80)
T ss_dssp             CCSTTBCTTTCSBCSSEEECSSCCEEETTHHHHHHHHTCSSCTTTCCCCCGGGCEECHHHHHHHHHHHT
T ss_pred             CCccccCcCcCchhhhhcccCCcCeecHHHHHHHHhcCCccCCCccccccccccccHHHHHHHHHHHHH
Confidence            467899999999999999999999999999999985  4579999999998899999999999987654
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure