Citrus Sinensis ID: 019041

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------
MTETEVKMYRARREITVEGHDVPRPIRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWPMALKGRDLIGIAETGSGKTLSYLLPAFVHVSAQPRLVQGEGPIVLVLAPTRELAVQIQEEALKFGSRAGIRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLEAQHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVTQIRPDRQTLYWSATWPREVETLARQFLRNPYKVIIGSLELKANQSINQVVEVVTEAEKYNSMFICRLIKLLKEVMDGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGDKNQSERDWVLAEFRSGRSPIMTATDVAARGLGRITVC
ccHHHHHHHHHHcccEEEcccccccccccccccccHHHHHHHHHccccccccHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHHHcccccccccccEEEEEcccHHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHccccEEEEcccHHHHHHHccccccccccEEEEcccccccccccHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHcccEEEEEccccccccccEEEEEEEcccHHHHcHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHccccEEEccccccccHHHHHHHHHHcccccEEEEEccccccccccccc
ccHHHHHHHHHHccEEEEccccccccccHHHccccHHHHHHHHHcccccccHHHcccccHEcccccEEEEEEccccHHHHHHHHHHHHHHcccccccccccEEEEEccHHHHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHccEEEEcHHHHHHHHcccccccccccEEEEccHHHHHccccHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHccccEEEEccccccccccccEEEEEEccHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHcccccEEEEEcHHHccccccccc
MTETEVKMYRARREItveghdvprpirifqeanfpdYCLEVIAKlgfveptpiqaqgwpmalkgrdligiaetgsgktlsyllpafvhvsaqprlvqgegpivlvlaPTRELAVQIQEEALKFgsragirstciyggapkgpqirdlrRGVEIVIATPGRLIDMLEAQHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVTqirpdrqtlywsatwpREVETLARQFLRNPYKVIIGSLELKANQSINQVVEVVTEAEKYNSMFICRLIKLLKEVMDGSRILIFTETKKGCDQVTRQLrmdgwpalsihgdknqseRDWVLAEfrsgrspimtaTDVAARglgritvc
mtetevkmyrarreitveghdvprpiRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWPMALKGRDLIGIAETGSGKTLSYLLPAFVHVSAQPRLVQGEGPIVLVLAPTRELAVQIQEEAlkfgsragirSTCIyggapkgpqirdlrrGVEIVIATPGRLIDMLEAQHTNLRRVTYLVLDEADRMLDMGFepqirkivtqirpdrqtlywsatwpREVETLARQFLRNPYKVIIGSlelkanqsINQVVEVVTEAEKYNSMFICRLIKLLKEVMDGSRILIFtetkkgcdqVTRQLRMDGWPAlsihgdknqserDWVLAEfrsgrspimtatdvaarglgritvc
MTETEVKMYRARREITVEGHDVPRPIRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWPMALKGRDLIGIAETGSGKTLSYLLPAFVHVSAQPRLVQGEGPIVLVLAPTRELAVQIQEEALKFGSRAGIRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLEAQHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVTQIRPDRQTLYWSATWPREVETLARQFLRNPYKVIIGSLELKANQSINQVVEVVTEAEKYNSMFICRLIKLLKEVMDGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGDKNQSERDWVLAEFRSGRSPIMTATDVAARGLGRITVC
*************EITVEGHDVPRPIRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWPMALKGRDLIGIAETGSGKTLSYLLPAFVHVSAQPRLVQGEGPIVLVLAPTRELAVQIQEEALKFGSRAGIRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLEAQHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVTQIRPDRQTLYWSATWPREVETLARQFLRNPYKVIIGSLELKANQSINQVVEVVTEAEKYNSMFICRLIKLLKEVMDGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGD*****RDWVLAEFRS****IMTATDVAA*********
*TETEVKMYRARREITVEGHDVPRPIRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWPMALKGRDLIGIAETGSGKTLSYLLPAFVHVSAQPRLVQGEGPIVLVLAPTRELAVQIQEEALKFGSRAGIRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLEAQHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVTQIRPDRQTLYWSATWPREVETLARQFLRNPYKVIIGSLELKANQSINQVVEVVTEAEKYNSMFICRLIKLLKEVMDGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGDKNQSERDWVLAEFRSGRSPIMTATDVAARGLGRITVC
MTETEVKMYRARREITVEGHDVPRPIRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWPMALKGRDLIGIAETGSGKTLSYLLPAFVHVSAQPRLVQGEGPIVLVLAPTRELAVQIQEEALKFGSRAGIRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLEAQHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVTQIRPDRQTLYWSATWPREVETLARQFLRNPYKVIIGSLELKANQSINQVVEVVTEAEKYNSMFICRLIKLLKEVMDGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGDKNQSERDWVLAEFRSGRSPIMTATDVAARGLGRITVC
*TETEVKMYRARREITVEGHDVPRPIRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWPMALKGRDLIGIAETGSGKTLSYLLPAFVHVSAQPRLVQGEGPIVLVLAPTRELAVQIQEEALKFGSRAGIRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLEAQHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVTQIRPDRQTLYWSATWPREVETLARQFLRNPYKVIIGSLELKANQSINQVVEVVTEAEKYNSMFICRLIKLLKEVMDGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGDKNQSERDWVLAEFRSGRSPIMTATDVAARGLGR****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTETEVKMYRARREITVEGHDVPRPIRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWPMALKGRDLIGIAETGSGKTLSYLLPAFVHVSAQPRLVQGEGPIVLVLAPTRELAVQIQEEALKFGSRAGIRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLEAQHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVTQIRPDRQTLYWSATWPREVETLARQFLRNPYKVIIGSLELKANQSINQVVEVVTEAEKYNSMFICRLIKLLKEVMDGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGDKNQSERDWVLAEFRSGRSPIMTATDVAARGLGRITVC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query347 2.2.26 [Sep-21-2011]
Q8W4R3 591 DEAD-box ATP-dependent RN no no 0.968 0.568 0.832 1e-168
Q5N7W4666 DEAD-box ATP-dependent RN no no 0.968 0.504 0.806 1e-165
Q9C718501 DEAD-box ATP-dependent RN no no 0.968 0.670 0.759 1e-160
Q5QMN3494 DEAD-box ATP-dependent RN no no 0.968 0.680 0.774 1e-159
Q59LU0 562 ATP-dependent RNA helicas N/A no 0.965 0.596 0.657 1e-132
Q5B0J9 563 ATP-dependent RNA helicas yes no 0.965 0.595 0.660 1e-131
Q6CIV2 554 ATP-dependent RNA helicas yes no 0.968 0.606 0.667 1e-131
A5DL80 554 ATP-dependent RNA helicas N/A no 0.965 0.604 0.660 1e-131
A7TTT5441 ATP-dependent RNA helicas N/A no 0.976 0.768 0.656 1e-131
A6RGE3542 ATP-dependent RNA helicas N/A no 0.965 0.618 0.661 1e-131
>sp|Q8W4R3|RH30_ARATH DEAD-box ATP-dependent RNA helicase 30 OS=Arabidopsis thaliana GN=RH30 PE=2 SV=2 Back     alignment and function desciption
 Score =  591 bits (1523), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 284/341 (83%), Positives = 311/341 (91%), Gaps = 5/341 (1%)

Query: 1   MTETEVKMYRARREITVEGHDVPRPIRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWPM 60
           MTE +V MYR  R+I+VEG DVP+P+++FQ+ANFPD  LE IAKLGF EPTPIQAQGWPM
Sbjct: 139 MTEQDVAMYRTERDISVEGRDVPKPMKMFQDANFPDNILEAIAKLGFTEPTPIQAQGWPM 198

Query: 61  ALKGRDLIGIAETGSGKTLSYLLPAFVHVSAQPRLVQGEGPIVLVLAPTRELAVQIQEEA 120
           ALKGRDLIGIAETGSGKTL+YLLPA VHVSAQPRL Q +GPIVL+LAPTRELAVQIQEE+
Sbjct: 199 ALKGRDLIGIAETGSGKTLAYLLPALVHVSAQPRLGQDDGPIVLILAPTRELAVQIQEES 258

Query: 121 LKFGSRAGIRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLEAQHTNLRRVTYLVL 180
            KFG R+G+RSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLE QHTNL+RVTYLVL
Sbjct: 259 RKFGLRSGVRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLECQHTNLKRVTYLVL 318

Query: 181 DEADRMLDMGFEPQIRKIVTQIRPDRQTLYWSATWPREVETLARQFLRNPYKVIIGSLEL 240
           DEADRMLDMGFEPQIRKIV+QIRPDRQTL WSATWPREVETLARQFLR+PYK IIGS +L
Sbjct: 319 DEADRMLDMGFEPQIRKIVSQIRPDRQTLLWSATWPREVETLARQFLRDPYKAIIGSTDL 378

Query: 241 KANQSINQVVEVVTEAEKYNSMFICRLIKLLKEVMDGSRILIFTETKKGCDQVTRQLRMD 300
           KANQSINQV+E+V   EKYN     RL+ LLK++MDGS+ILIF ETK+GCDQVTRQLRMD
Sbjct: 379 KANQSINQVIEIVPTPEKYN-----RLLTLLKQLMDGSKILIFVETKRGCDQVTRQLRMD 433

Query: 301 GWPALSIHGDKNQSERDWVLAEFRSGRSPIMTATDVAARGL 341
           GWPAL+IHGDK QSERD VLAEF+SGRSPIMTATDVAARGL
Sbjct: 434 GWPALAIHGDKTQSERDRVLAEFKSGRSPIMTATDVAARGL 474
ATP-dependent RNA helicase involved nonsense-mediated mRNA decay and ribosome biogenesis through rRNA processing.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q5N7W4|RH30_ORYSJ DEAD-box ATP-dependent RNA helicase 30 OS=Oryza sativa subsp. japonica GN=Os01g0911100 PE=2 SV=2 Back     alignment and function description
>sp|Q9C718|RH20_ARATH DEAD-box ATP-dependent RNA helicase 20 OS=Arabidopsis thaliana GN=RH20 PE=1 SV=1 Back     alignment and function description
>sp|Q5QMN3|RH20_ORYSJ DEAD-box ATP-dependent RNA helicase 20 OS=Oryza sativa subsp. japonica GN=Os01g0197200 PE=3 SV=2 Back     alignment and function description
>sp|Q59LU0|DBP2_CANAL ATP-dependent RNA helicase DBP2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP2 PE=3 SV=2 Back     alignment and function description
>sp|Q5B0J9|DBP2_EMENI ATP-dependent RNA helicase dbp2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp2 PE=3 SV=1 Back     alignment and function description
>sp|Q6CIV2|DBP2_KLULA ATP-dependent RNA helicase DBP2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP2 PE=3 SV=1 Back     alignment and function description
>sp|A5DL80|DBP2_PICGU ATP-dependent RNA helicase DBP2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP2 PE=3 SV=3 Back     alignment and function description
>sp|A7TTT5|DBP2_VANPO ATP-dependent RNA helicase DBP2 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP2 PE=3 SV=1 Back     alignment and function description
>sp|A6RGE3|DBP2_AJECN ATP-dependent RNA helicase DBP2 OS=Ajellomyces capsulata (strain NAm1 / WU24) GN=DBP2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query347
255543421 540 dead box ATP-dependent RNA helicase, put 0.985 0.633 0.899 0.0
297733718 611 unnamed protein product [Vitis vinifera] 0.985 0.559 0.902 0.0
225456912 611 PREDICTED: DEAD-box ATP-dependent RNA he 0.968 0.549 0.900 1e-177
224121758 541 predicted protein [Populus trichocarpa] 0.968 0.621 0.891 1e-177
224135925 450 predicted protein [Populus trichocarpa] 0.968 0.746 0.891 1e-176
356513635 599 PREDICTED: DEAD-box ATP-dependent RNA he 0.968 0.560 0.879 1e-175
356562686 602 PREDICTED: DEAD-box ATP-dependent RNA he 0.968 0.558 0.868 1e-172
449440640 622 PREDICTED: DEAD-box ATP-dependent RNA he 0.968 0.540 0.859 1e-169
18424667 484 DEAD-box ATP-dependent RNA helicase 30 [ 0.968 0.694 0.832 1e-167
42573778 591 DEAD-box ATP-dependent RNA helicase 30 [ 0.968 0.568 0.832 1e-166
>gi|255543421|ref|XP_002512773.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] gi|223547784|gb|EEF49276.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/347 (89%), Positives = 331/347 (95%), Gaps = 5/347 (1%)

Query: 1   MTETEVKMYRARREITVEGHDVPRPIRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWPM 60
           M+E EV MYRARR+ITVEGHDVP+PIRIFQEANFP YCLEVIAKLGFVEPTPIQAQGWPM
Sbjct: 199 MSEHEVIMYRARRDITVEGHDVPKPIRIFQEANFPGYCLEVIAKLGFVEPTPIQAQGWPM 258

Query: 61  ALKGRDLIGIAETGSGKTLSYLLPAFVHVSAQPRLVQGEGPIVLVLAPTRELAVQIQEEA 120
           ALKGRD+IGIAETGSGKTL+Y+LPA VHVSAQPRLVQGEGP+VL+LAPTRELAVQIQEEA
Sbjct: 259 ALKGRDVIGIAETGSGKTLAYVLPALVHVSAQPRLVQGEGPVVLILAPTRELAVQIQEEA 318

Query: 121 LKFGSRAGIRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLEAQHTNLRRVTYLVL 180
           LKFGSRA IR+TCIYGGAPKGPQIRDL RGVEIVIATPGRLIDMLEAQHTNLRRVTYLVL
Sbjct: 319 LKFGSRANIRTTCIYGGAPKGPQIRDLHRGVEIVIATPGRLIDMLEAQHTNLRRVTYLVL 378

Query: 181 DEADRMLDMGFEPQIRKIVTQIRPDRQTLYWSATWPREVETLARQFLRNPYKVIIGSLEL 240
           DEADRMLDMGFEPQIRK+V+QIRPDRQTLYWSATWPREVETLARQFLRNPYKV+IGS +L
Sbjct: 379 DEADRMLDMGFEPQIRKLVSQIRPDRQTLYWSATWPREVETLARQFLRNPYKVVIGSTDL 438

Query: 241 KANQSINQVVEVVTEAEKYNSMFICRLIKLLKEVMDGSRILIFTETKKGCDQVTRQLRMD 300
           KANQSINQVVE+V+E EKYN     RLIKLLKEVMDGSRILIF ETKKGCDQVTRQLRMD
Sbjct: 439 KANQSINQVVEIVSEMEKYN-----RLIKLLKEVMDGSRILIFMETKKGCDQVTRQLRMD 493

Query: 301 GWPALSIHGDKNQSERDWVLAEFRSGRSPIMTATDVAARGLGRITVC 347
           GWP LSIHGDKNQ+ERDWVL+EF+SGRSPIMTATDVAARGLGRI +C
Sbjct: 494 GWPVLSIHGDKNQTERDWVLSEFKSGRSPIMTATDVAARGLGRIIMC 540

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297733718|emb|CBI14965.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225456912|ref|XP_002277894.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224121758|ref|XP_002318665.1| predicted protein [Populus trichocarpa] gi|222859338|gb|EEE96885.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224135925|ref|XP_002322195.1| predicted protein [Populus trichocarpa] gi|222869191|gb|EEF06322.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356513635|ref|XP_003525517.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Glycine max] Back     alignment and taxonomy information
>gi|356562686|ref|XP_003549600.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Glycine max] Back     alignment and taxonomy information
>gi|449440640|ref|XP_004138092.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Cucumis sativus] gi|449522189|ref|XP_004168110.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|18424667|ref|NP_568964.1| DEAD-box ATP-dependent RNA helicase 30 [Arabidopsis thaliana] gi|16974623|gb|AAL31214.1| AT5g63120/MDC12_8 [Arabidopsis thaliana] gi|23308415|gb|AAN18177.1| At5g63120/MDC12_8 [Arabidopsis thaliana] gi|332010324|gb|AED97707.1| DEAD-box ATP-dependent RNA helicase 30 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|42573778|ref|NP_974985.1| DEAD-box ATP-dependent RNA helicase 30 [Arabidopsis thaliana] gi|108861888|sp|Q8W4R3.2|RH30_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 30 gi|110741550|dbj|BAE98724.1| ATP-dependent RNA helicase-like protein [Arabidopsis thaliana] gi|332010323|gb|AED97706.1| DEAD-box ATP-dependent RNA helicase 30 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query347
TAIR|locus:2162022 591 AT5G63120 [Arabidopsis thalian 0.968 0.568 0.832 9.8e-151
TAIR|locus:2035741501 RH20 "RNA helicase 20" [Arabid 0.968 0.670 0.759 2e-143
CGD|CAL0003204 562 DBP2 [Candida albicans (taxid: 0.965 0.596 0.657 4.1e-120
ASPGD|ASPL0000006660 563 AN5931 [Emericella nidulans (t 0.965 0.595 0.660 1.1e-119
UNIPROTKB|A4QSS5 548 DBP2 "ATP-dependent RNA helica 0.965 0.611 0.642 3.8e-117
ZFIN|ZDB-GENE-030131-925 617 ddx5 "DEAD (Asp-Glu-Ala-Asp) b 0.956 0.538 0.646 1.6e-116
SGD|S000005056 546 DBP2 "ATP-dependent RNA helica 0.965 0.613 0.649 2.1e-116
POMBASE|SPBP8B7.16c 550 dbp2 "ATP-dependent RNA helica 0.965 0.609 0.640 5e-115
ZFIN|ZDB-GENE-030131-18 671 si:dkey-156n14.5 "si:dkey-156n 0.968 0.500 0.632 5e-115
UNIPROTKB|F1NM08 595 DDX5 "Uncharacterized protein" 0.965 0.563 0.628 5.8e-114
TAIR|locus:2162022 AT5G63120 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1471 (522.9 bits), Expect = 9.8e-151, P = 9.8e-151
 Identities = 284/341 (83%), Positives = 311/341 (91%)

Query:     1 MTETEVKMYRARREITVEGHDVPRPIRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWPM 60
             MTE +V MYR  R+I+VEG DVP+P+++FQ+ANFPD  LE IAKLGF EPTPIQAQGWPM
Sbjct:   139 MTEQDVAMYRTERDISVEGRDVPKPMKMFQDANFPDNILEAIAKLGFTEPTPIQAQGWPM 198

Query:    61 ALKGRDLIGIAETGSGKTLSYLLPAFVHVSAQPRLVQGEGPIVLVLAPTRELAVQIQEEA 120
             ALKGRDLIGIAETGSGKTL+YLLPA VHVSAQPRL Q +GPIVL+LAPTRELAVQIQEE+
Sbjct:   199 ALKGRDLIGIAETGSGKTLAYLLPALVHVSAQPRLGQDDGPIVLILAPTRELAVQIQEES 258

Query:   121 LKFGSRAGIRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLEAQHTNLRRVTYLVL 180
              KFG R+G+RSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLE QHTNL+RVTYLVL
Sbjct:   259 RKFGLRSGVRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLECQHTNLKRVTYLVL 318

Query:   181 DEADRMLDMGFEPQIRKIVTQIRPDRQTLYWSATWPREVETLARQFLRNPYKVIIGSLEL 240
             DEADRMLDMGFEPQIRKIV+QIRPDRQTL WSATWPREVETLARQFLR+PYK IIGS +L
Sbjct:   319 DEADRMLDMGFEPQIRKIVSQIRPDRQTLLWSATWPREVETLARQFLRDPYKAIIGSTDL 378

Query:   241 KANQSINQVVEVVTEAEKYNSMFICRLIKLLKEVMDGSRILIFTETKKGCDQVTRQLRMD 300
             KANQSINQV+E+V   EKYN     RL+ LLK++MDGS+ILIF ETK+GCDQVTRQLRMD
Sbjct:   379 KANQSINQVIEIVPTPEKYN-----RLLTLLKQLMDGSKILIFVETKRGCDQVTRQLRMD 433

Query:   301 GWPALSIHGDKNQSERDWVLAEFRSGRSPIMTATDVAARGL 341
             GWPAL+IHGDK QSERD VLAEF+SGRSPIMTATDVAARGL
Sbjct:   434 GWPALAIHGDKTQSERDRVLAEFKSGRSPIMTATDVAARGL 474
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008026 "ATP-dependent helicase activity" evidence=IEA;ISS
TAIR|locus:2035741 RH20 "RNA helicase 20" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
CGD|CAL0003204 DBP2 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
ASPGD|ASPL0000006660 AN5931 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|A4QSS5 DBP2 "ATP-dependent RNA helicase DBP2" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-925 ddx5 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
SGD|S000005056 DBP2 "ATP-dependent RNA helicase of the DEAD-box protein family" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
POMBASE|SPBP8B7.16c dbp2 "ATP-dependent RNA helicase Dbp2" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-18 si:dkey-156n14.5 "si:dkey-156n14.5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NM08 DDX5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6CIV2DBP2_KLULA3, ., 6, ., 4, ., 1, 30.66760.96820.6064yesno
P0CQ76DBP2_CRYNJ3, ., 6, ., 4, ., 1, 30.650.96820.6222yesno
Q8SRB2DBP2_ENCCU3, ., 6, ., 4, ., 1, 30.52490.96540.6767yesno
Q6BY27DBP2_DEBHA3, ., 6, ., 4, ., 1, 30.66070.95670.6194yesno
A3LQW7DBP2_PICST3, ., 6, ., 4, ., 1, 30.66080.96540.6320yesno
Q6FLF3DBP2_CANGA3, ., 6, ., 4, ., 1, 30.66370.96540.6158yesno
Q4X195DBP2_ASPFU3, ., 6, ., 4, ., 1, 30.65780.96540.6124yesno
Q755N4DBP2_ASHGO3, ., 6, ., 4, ., 1, 30.65590.96820.6032yesno
Q2U070DBP2_ASPOR3, ., 6, ., 4, ., 1, 30.65200.96540.6046yesno
P24783DBP2_YEAST3, ., 6, ., 4, ., 1, 30.64910.96540.6135yesno
P24782DBP2_SCHPO3, ., 6, ., 4, ., 1, 30.64030.96540.6090yesno
Q6C4D4DBP2_YARLI3, ., 6, ., 4, ., 1, 30.65780.96540.6068yesno
Q4IF76DBP2_GIBZE3, ., 6, ., 4, ., 1, 30.64910.96540.6036yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.130.946
3rd Layer3.6.40.963

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query347
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 0.0
COG0513 513 COG0513, SrmB, Superfamily II DNA and RNA helicase 1e-118
cd00268203 cd00268, DEADc, DEAD-box helicases 1e-103
PRK11776 460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 1e-83
PRK10590 456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 2e-75
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 7e-66
PRK11192 434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 4e-63
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 9e-61
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 3e-59
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 1e-58
PRK04537 572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 3e-58
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 6e-58
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 2e-55
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 4e-55
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 1e-43
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 8e-17
COG0514 590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 6e-16
COG1205 851 COG1205, COG1205, Distinct helicase family with a 2e-14
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 1e-13
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily 1e-11
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 1e-10
smart0049082 smart00490, HELICc, helicase superfamily c-termina 1e-10
TIGR03817 742 TIGR03817, DECH_helic, helicase/secretion neighbor 2e-09
COG1204 766 COG1204, COG1204, Superfamily II helicase [General 5e-08
TIGR04121 803 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA 5e-08
COG1202 830 COG1202, COG1202, Superfamily II helicase, archaea 2e-07
TIGR00614 470 TIGR00614, recQ_fam, ATP-dependent DNA helicase, R 8e-06
TIGR01389 591 TIGR01389, recQ, ATP-dependent DNA helicase RecQ 0.002
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information 
 Score =  534 bits (1378), Expect = 0.0
 Identities = 219/344 (63%), Positives = 264/344 (76%), Gaps = 8/344 (2%)

Query: 1   MTETEVKMYRARREIT-VEGHDVPRPIRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWP 59
           ++  EV   R  +EIT + G +VP+P+  F+  +FPDY L+ +   GF EPTPIQ QGWP
Sbjct: 103 LSSKEVDEIRKEKEITIIAGENVPKPVVSFEYTSFPDYILKSLKNAGFTEPTPIQVQGWP 162

Query: 60  MALKGRDLIGIAETGSGKTLSYLLPAFVHVSAQPRLVQGEGPIVLVLAPTRELAVQIQEE 119
           +AL GRD+IGIAETGSGKTL++LLPA VH++AQP L  G+GPIVLVLAPTRELA QI+E+
Sbjct: 163 IALSGRDMIGIAETGSGKTLAFLLPAIVHINAQPLLRYGDGPIVLVLAPTRELAEQIREQ 222

Query: 120 ALKFGSRAGIRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLEAQHTNLRRVTYLV 179
             KFG+ + IR+T  YGG PK  QI  LRRGVEI+IA PGRLID LE+  TNLRRVTYLV
Sbjct: 223 CNKFGASSKIRNTVAYGGVPKRGQIYALRRGVEILIACPGRLIDFLESNVTNLRRVTYLV 282

Query: 180 LDEADRMLDMGFEPQIRKIVTQIRPDRQTLYWSATWPREVETLARQFLRN-PYKVIIGSL 238
           LDEADRMLDMGFEPQIRKIV+QIRPDRQTL WSATWP+EV++LAR   +  P  V +GSL
Sbjct: 283 LDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVQSLARDLCKEEPVHVNVGSL 342

Query: 239 ELKANQSINQVVEVVTEAEKYNSMFICRLIKLLKEVM-DGSRILIFTETKKGCDQVTRQL 297
           +L A  +I Q V VV E EK       +L  LL+ +M DG +ILIF ETKKG D +T++L
Sbjct: 343 DLTACHNIKQEVFVVEEHEK-----RGKLKMLLQRIMRDGDKILIFVETKKGADFLTKEL 397

Query: 298 RMDGWPALSIHGDKNQSERDWVLAEFRSGRSPIMTATDVAARGL 341
           R+DGWPAL IHGDK Q ER WVL EF++G+SPIM ATDVA+RGL
Sbjct: 398 RLDGWPALCIHGDKKQEERTWVLNEFKTGKSPIMIATDVASRGL 441

Length = 545
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|234365 TIGR03817, DECH_helic, helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|234478 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA ligase-associated Back     alignment and domain information
>gnl|CDD|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 347
PTZ00110545 helicase; Provisional 100.0
KOG0331 519 consensus ATP-dependent RNA helicase [RNA processi 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
KOG0330 476 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 100.0
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 100.0
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 100.0
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 100.0
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 100.0
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0339 731 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 100.0
PTZ00424401 helicase 45; Provisional 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0340 442 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0338 691 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0345 567 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0341 610 consensus DEAD-box protein abstrakt [RNA processin 100.0
KOG0343 758 consensus RNA Helicase [RNA processing and modific 100.0
KOG0342 543 consensus ATP-dependent RNA helicase pitchoune [RN 100.0
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0334 997 consensus RNA helicase [RNA processing and modific 100.0
KOG0346 569 consensus RNA helicase [RNA processing and modific 100.0
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0348 708 consensus ATP-dependent RNA helicase [RNA processi 100.0
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 100.0
KOG0347 731 consensus RNA helicase [RNA processing and modific 100.0
PRK02362 737 ski2-like helicase; Provisional 100.0
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
PRK00254 720 ski2-like helicase; Provisional 100.0
KOG0327397 consensus Translation initiation factor 4F, helica 100.0
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
PRK13767 876 ATP-dependent helicase; Provisional 100.0
KOG0337 529 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 100.0
PRK01172 674 ski2-like helicase; Provisional 100.0
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
COG1201 814 Lhr Lhr-like helicases [General function predictio 100.0
PHA02558501 uvsW UvsW helicase; Provisional 100.0
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 100.0
KOG4284 980 consensus DEAD box protein [Transcription] 100.0
PRK10689 1147 transcription-repair coupling factor; Provisional 100.0
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 100.0
KOG0344 593 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0350 620 consensus DEAD-box ATP-dependent RNA helicase [RNA 100.0
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 100.0
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 100.0
PRK09401 1176 reverse gyrase; Reviewed 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 100.0
COG1204 766 Superfamily II helicase [General function predicti 100.0
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 100.0
PRK14701 1638 reverse gyrase; Provisional 100.0
COG1202 830 Superfamily II helicase, archaea-specific [General 100.0
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 100.0
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 100.0
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 100.0
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 100.0
KOG0354 746 consensus DEAD-box like helicase [General function 100.0
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 100.0
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 100.0
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 100.0
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 100.0
COG1205 851 Distinct helicase family with a unique C-terminal 100.0
PHA02653 675 RNA helicase NPH-II; Provisional 99.98
PRK13766 773 Hef nuclease; Provisional 99.98
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 99.97
KOG0353 695 consensus ATP-dependent DNA helicase [General func 99.97
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 99.97
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 99.97
KOG0351 941 consensus ATP-dependent DNA helicase [Replication, 99.97
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 99.97
KOG0352 641 consensus ATP-dependent DNA helicase [Replication, 99.96
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.96
PRK05580 679 primosome assembly protein PriA; Validated 99.96
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 99.96
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.96
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.96
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.95
PRK09694 878 helicase Cas3; Provisional 99.95
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.95
TIGR00595 505 priA primosomal protein N'. All proteins in this f 99.95
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.95
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.95
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.94
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.94
KOG0349 725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 99.93
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.93
PRK04914 956 ATP-dependent helicase HepA; Validated 99.93
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.93
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.92
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.92
COG4096 875 HsdR Type I site-specific restriction-modification 99.92
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.91
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.9
smart00487201 DEXDc DEAD-like helicases superfamily. 99.9
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 99.89
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.89
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 99.88
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 99.88
KOG0950 1008 consensus DNA polymerase theta/eta, DEAD-box super 99.87
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.87
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.87
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.86
COG1198 730 PriA Primosomal protein N' (replication factor Y) 99.85
KOG1123 776 consensus RNA polymerase II transcription initiati 99.85
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 99.84
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.82
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.82
KOG0922 674 consensus DEAH-box RNA helicase [RNA processing an 99.82
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 99.81
PRK12326 764 preprotein translocase subunit SecA; Reviewed 99.81
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.81
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.79
KOG0920 924 consensus ATP-dependent RNA helicase A [RNA proces 99.79
KOG0385 971 consensus Chromatin remodeling complex WSTF-ISWI, 99.79
KOG0387 923 consensus Transcription-coupled repair protein CSB 99.76
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.75
KOG0923 902 consensus mRNA splicing factor ATP-dependent RNA h 99.74
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 99.73
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 99.73
CHL00122 870 secA preprotein translocase subunit SecA; Validate 99.73
COG4889 1518 Predicted helicase [General function prediction on 99.72
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 99.71
KOG0390 776 consensus DNA repair protein, SNF2 family [Replica 99.68
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 99.68
KOG1000 689 consensus Chromatin remodeling protein HARP/SMARCA 99.67
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 99.67
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.66
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 99.66
KOG0389 941 consensus SNF2 family DNA-dependent ATPase [Chroma 99.65
KOG0392 1549 consensus SNF2 family DNA-dependent ATPase domain- 99.61
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 99.6
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 99.6
KOG0949 1330 consensus Predicted helicase, DEAD-box superfamily 99.6
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 99.59
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 99.58
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 99.57
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 99.55
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 99.55
PRK05298 652 excinuclease ABC subunit B; Provisional 99.53
KOG0925 699 consensus mRNA splicing factor ATP-dependent RNA h 99.53
KOG0953 700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 99.52
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.46
COG0610 962 Type I site-specific restriction-modification syst 99.46
KOG1002 791 consensus Nucleotide excision repair protein RAD16 99.38
smart00488289 DEXDc2 DEAD-like helicases superfamily. 99.38
smart00489289 DEXDc3 DEAD-like helicases superfamily. 99.38
PRK14873 665 primosome assembly protein PriA; Provisional 99.37
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 99.35
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.35
KOG4439 901 consensus RNA polymerase II transcription terminat 99.34
KOG0386 1157 consensus Chromatin remodeling complex SWI/SNF, co 99.29
KOG4150 1034 consensus Predicted ATP-dependent RNA helicase [RN 99.28
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 99.25
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.19
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 99.12
KOG0388 1185 consensus SNF2 family DNA-dependent ATPase [Replic 99.12
KOG1015 1567 consensus Transcription regulator XNP/ATRX, DEAD-b 99.08
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.0
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 98.99
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 98.99
PRK15483 986 type III restriction-modification system StyLTI en 98.94
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 98.92
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 98.92
KOG2340698 consensus Uncharacterized conserved protein [Funct 98.86
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 98.84
KOG09521230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 98.82
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 98.78
smart0049082 HELICc helicase superfamily c-terminal domain. 98.77
COG0553 866 HepA Superfamily II DNA/RNA helicases, SNF2 family 98.72
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 98.58
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 98.56
KOG1802 935 consensus RNA helicase nonsense mRNA reducing fact 98.52
PRK10536262 hypothetical protein; Provisional 98.51
KOG1803 649 consensus DNA helicase [Replication, recombination 98.49
TIGR00376 637 DNA helicase, putative. The gene product may repre 98.49
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 98.48
PRK10875 615 recD exonuclease V subunit alpha; Provisional 98.48
TIGR01447 586 recD exodeoxyribonuclease V, alpha subunit. This f 98.47
KOG1132 945 consensus Helicase of the DEAD superfamily [Replic 98.46
TIGR01448 720 recD_rel helicase, putative, RecD/TraA family. Thi 98.44
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 98.43
PF1324576 AAA_19: Part of AAA domain 98.4
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 98.38
TIGR02768 744 TraA_Ti Ti-type conjugative transfer relaxase TraA 98.24
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 98.24
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 98.16
PRK13889 988 conjugal transfer relaxase TraA; Provisional 98.13
PRK04296190 thymidine kinase; Provisional 98.11
KOG1131 755 consensus RNA polymerase II transcription initiati 98.11
PRK13826 1102 Dtr system oriT relaxase; Provisional 98.07
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 98.06
KOG1016 1387 consensus Predicted DNA helicase, DEAD-box superfa 98.05
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 98.04
PRK06526254 transposase; Provisional 98.04
COG3587 985 Restriction endonuclease [Defense mechanisms] 98.04
KOG1805 1100 consensus DNA replication helicase [Replication, r 97.99
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.98
PRK08181269 transposase; Validated 97.88
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.86
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 97.81
KOG0298 1394 consensus DEAD box-containing helicase-like transc 97.79
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.78
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 97.77
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.75
PRK14974336 cell division protein FtsY; Provisional 97.7
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 97.67
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 97.63
smart00382148 AAA ATPases associated with a variety of cellular 97.63
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.62
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 97.59
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 97.56
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.54
PRK11054 684 helD DNA helicase IV; Provisional 97.53
PRK12377248 putative replication protein; Provisional 97.53
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 97.45
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.43
PRK07952244 DNA replication protein DnaC; Validated 97.42
PHA02533 534 17 large terminase protein; Provisional 97.4
PRK06921266 hypothetical protein; Provisional 97.39
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 97.38
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 97.36
PRK08727233 hypothetical protein; Validated 97.35
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 97.33
PRK05642234 DNA replication initiation factor; Validated 97.33
PTZ00293211 thymidine kinase; Provisional 97.29
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 97.29
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 97.28
COG2256 436 MGS1 ATPase related to the helicase subunit of the 97.26
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.26
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 97.26
KOG1513 1300 consensus Nuclear helicase MOP-3/SNO (DEAD-box sup 97.22
PF00004132 AAA: ATPase family associated with various cellula 97.21
PRK06835329 DNA replication protein DnaC; Validated 97.2
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 97.2
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 97.18
cd01124187 KaiC KaiC is a circadian clock protein primarily f 97.18
PRK09183259 transposase/IS protein; Provisional 97.15
PRK08116268 hypothetical protein; Validated 97.13
PRK06893229 DNA replication initiation factor; Validated 97.13
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 97.12
PTZ00112 1164 origin recognition complex 1 protein; Provisional 97.11
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 97.1
PRK00149450 dnaA chromosomal replication initiation protein; R 97.09
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 97.09
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 97.08
PHA02544316 44 clamp loader, small subunit; Provisional 97.08
COG3973 747 Superfamily I DNA and RNA helicases [General funct 97.07
TIGR01547 396 phage_term_2 phage terminase, large subunit, PBSX 97.06
PRK00771437 signal recognition particle protein Srp54; Provisi 97.05
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 97.03
PRK08084235 DNA replication initiation factor; Provisional 97.02
PRK05707328 DNA polymerase III subunit delta'; Validated 97.0
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 97.0
PF03354 477 Terminase_1: Phage Terminase ; InterPro: IPR005021 97.0
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 96.97
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 96.96
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 96.94
TIGR00362405 DnaA chromosomal replication initiator protein Dna 96.93
PRK08903227 DnaA regulatory inactivator Hda; Validated 96.93
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 96.93
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 96.93
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 96.89
PRK14087450 dnaA chromosomal replication initiation protein; P 96.89
PRK14088440 dnaA chromosomal replication initiation protein; P 96.87
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 96.85
COG1444 758 Predicted P-loop ATPase fused to an acetyltransfer 96.84
PHA03333 752 putative ATPase subunit of terminase; Provisional 96.84
PRK08533230 flagellar accessory protein FlaH; Reviewed 96.83
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 96.82
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 96.81
PRK09376416 rho transcription termination factor Rho; Provisio 96.81
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 96.81
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 96.81
KOG0383696 consensus Predicted helicase [General function pre 96.8
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 96.79
PRK13833323 conjugal transfer protein TrbB; Provisional 96.79
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 96.78
PLN03025319 replication factor C subunit; Provisional 96.78
PRK14086617 dnaA chromosomal replication initiation protein; P 96.78
PRK12402337 replication factor C small subunit 2; Reviewed 96.77
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.76
PF13173128 AAA_14: AAA domain 96.76
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 96.74
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 96.74
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 96.73
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 96.72
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 96.72
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 96.72
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 96.71
TIGR00064272 ftsY signal recognition particle-docking protein F 96.69
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 96.69
PRK13341 725 recombination factor protein RarA/unknown domain f 96.68
PRK12422445 chromosomal replication initiation protein; Provis 96.67
PRK00411394 cdc6 cell division control protein 6; Reviewed 96.65
PRK11331459 5-methylcytosine-specific restriction enzyme subun 96.65
KOG1133 821 consensus Helicase of the DEAD superfamily [Replic 96.64
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 96.63
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 96.61
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 96.6
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 96.6
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 96.6
PRK13342413 recombination factor protein RarA; Reviewed 96.59
PRK04195 482 replication factor C large subunit; Provisional 96.57
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 96.56
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 96.55
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 96.54
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 96.54
PRK13894319 conjugal transfer ATPase TrbB; Provisional 96.51
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 96.5
COG0470325 HolB ATPase involved in DNA replication [DNA repli 96.5
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 96.49
PRK08939306 primosomal protein DnaI; Reviewed 96.47
PRK11823 446 DNA repair protein RadA; Provisional 96.47
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 96.45
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 96.44
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 96.44
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 96.42
PRK13851344 type IV secretion system protein VirB11; Provision 96.42
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 96.41
PHA03368 738 DNA packaging terminase subunit 1; Provisional 96.39
PHA00012 361 I assembly protein 96.38
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 96.37
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 96.36
PRK08769319 DNA polymerase III subunit delta'; Validated 96.34
COG1618179 Predicted nucleotide kinase [Nucleotide transport 96.34
CHL00181287 cbbX CbbX; Provisional 96.33
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.33
PF05876 557 Terminase_GpA: Phage terminase large subunit (GpA) 96.31
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 96.3
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 96.28
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 96.28
PRK06067234 flagellar accessory protein FlaH; Validated 96.27
COG4626 546 Phage terminase-like protein, large subunit [Gener 96.26
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 96.26
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 96.22
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 96.22
TIGR00959428 ffh signal recognition particle protein. This mode 96.21
COG2109198 BtuR ATP:corrinoid adenosyltransferase [Coenzyme m 96.21
PRK10867433 signal recognition particle protein; Provisional 96.21
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 96.21
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 96.2
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 96.2
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 96.19
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 96.19
COG3972 660 Superfamily I DNA and RNA helicases [General funct 96.19
PHA00729226 NTP-binding motif containing protein 96.18
TIGR02928365 orc1/cdc6 family replication initiation protein. M 96.16
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 96.15
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 96.13
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 96.12
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 96.09
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 96.08
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 96.07
PRK07471365 DNA polymerase III subunit delta'; Validated 96.06
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 96.04
COG0593408 DnaA ATPase involved in DNA replication initiation 96.02
PRK10416318 signal recognition particle-docking protein FtsY; 96.01
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 96.01
PRK08506472 replicative DNA helicase; Provisional 96.0
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 96.0
PRK06904472 replicative DNA helicase; Validated 95.99
PF03237 384 Terminase_6: Terminase-like family; InterPro: IPR0 95.98
PRK09112351 DNA polymerase III subunit delta'; Validated 95.97
PF00265176 TK: Thymidine kinase; InterPro: IPR001267 Thymidin 95.97
KOG2028 554 consensus ATPase related to the helicase subunit o 95.96
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 95.95
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 95.94
PRK05973237 replicative DNA helicase; Provisional 95.93
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 95.93
PF02572172 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase 95.91
cd03115173 SRP The signal recognition particle (SRP) mediates 95.9
PRK04841 903 transcriptional regulator MalT; Provisional 95.88
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 95.85
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 95.83
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 95.82
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 95.81
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 95.81
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 95.81
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 95.8
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 95.8
COG0552340 FtsY Signal recognition particle GTPase [Intracell 95.78
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 95.78
PHA00350 399 putative assembly protein 95.76
PRK10436462 hypothetical protein; Provisional 95.75
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 95.75
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 95.75
PRK06620214 hypothetical protein; Validated 95.75
PRK13764602 ATPase; Provisional 95.73
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 95.73
COG2255332 RuvB Holliday junction resolvasome, helicase subun 95.72
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 95.72
TIGR00767415 rho transcription termination factor Rho. Members 95.67
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 95.64
PRK14873 665 primosome assembly protein PriA; Provisional 95.63
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 95.63
PRK06964342 DNA polymerase III subunit delta'; Validated 95.61
PRK06871325 DNA polymerase III subunit delta'; Validated 95.61
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 95.59
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 95.59
PRK07940 394 DNA polymerase III subunit delta'; Validated 95.58
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 95.57
PRK07993334 DNA polymerase III subunit delta'; Validated 95.55
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 95.55
PRK00440319 rfc replication factor C small subunit; Reviewed 95.53
PRK07414178 cob(I)yrinic acid a,c-diamide adenosyltransferase; 95.52
COG5008375 PilU Tfp pilus assembly protein, ATPase PilU [Cell 95.52
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 95.52
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 95.51
PRK08840464 replicative DNA helicase; Provisional 95.5
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 95.47
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 95.45
PRK05580 679 primosome assembly protein PriA; Validated 95.44
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 95.4
PRK03992389 proteasome-activating nucleotidase; Provisional 95.4
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 95.38
TIGR00595 505 priA primosomal protein N'. All proteins in this f 95.33
TIGR02012321 tigrfam_recA protein RecA. This model describes or 95.33
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 95.32
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 95.31
PF05729166 NACHT: NACHT domain 95.3
PRK08699325 DNA polymerase III subunit delta'; Validated 95.3
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 95.29
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 95.29
PRK07004460 replicative DNA helicase; Provisional 95.27
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 95.27
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 95.25
PRK10865 857 protein disaggregation chaperone; Provisional 95.24
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 95.24
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 95.23
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 95.22
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 95.2
PRK08006471 replicative DNA helicase; Provisional 95.18
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 95.16
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 95.15
smart00492141 HELICc3 helicase superfamily c-terminal domain. 95.15
TIGR00665434 DnaB replicative DNA helicase. This model describe 95.12
PRK04328249 hypothetical protein; Provisional 95.1
CHL00095 821 clpC Clp protease ATP binding subunit 95.1
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 95.09
cd01128249 rho_factor Transcription termination factor rho is 95.09
PRK09354349 recA recombinase A; Provisional 95.06
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 95.05
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 95.02
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 94.95
PRK05748448 replicative DNA helicase; Provisional 94.95
COG1198 730 PriA Primosomal protein N' (replication factor Y) 94.94
PRK08760476 replicative DNA helicase; Provisional 94.91
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 94.87
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 94.83
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 94.83
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 94.82
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 94.8
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 94.8
TIGR02533486 type_II_gspE general secretory pathway protein E. 94.78
PF12846304 AAA_10: AAA-like domain 94.73
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 94.64
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 94.64
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 94.63
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 94.61
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 94.59
PRK06090319 DNA polymerase III subunit delta'; Validated 94.58
KOG2228408 consensus Origin recognition complex, subunit 4 [R 94.57
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 94.54
PRK05636505 replicative DNA helicase; Provisional 94.47
smart00491142 HELICc2 helicase superfamily c-terminal domain. 94.45
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 94.41
cd03239178 ABC_SMC_head The structural maintenance of chromos 94.37
COG0210 655 UvrD Superfamily I DNA and RNA helicases [DNA repl 94.36
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 94.36
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 94.35
PHA03372 668 DNA packaging terminase subunit 1; Provisional 94.34
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 94.31
cd01126 384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 94.24
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 94.16
KOG1806 1320 consensus DEAD box containing helicases [Replicati 94.16
CHL00176 638 ftsH cell division protein; Validated 94.14
PRK13897 606 type IV secretion system component VirD4; Provisio 94.13
PF02534 469 T4SS-DNA_transf: Type IV secretory system Conjugat 94.12
PRK06321472 replicative DNA helicase; Provisional 94.06
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 94.02
PRK09165497 replicative DNA helicase; Provisional 94.02
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 93.99
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 93.95
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 93.92
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 93.9
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 93.89
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 93.88
PRK12608380 transcription termination factor Rho; Provisional 93.85
PHA02535 581 P terminase ATPase subunit; Provisional 93.84
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 93.73
PRK05595444 replicative DNA helicase; Provisional 93.71
COG4987573 CydC ABC-type transport system involved in cytochr 93.7
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 93.65
PRK07399314 DNA polymerase III subunit delta'; Validated 93.62
>PTZ00110 helicase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.8e-55  Score=398.84  Aligned_cols=342  Identities=64%  Similarity=1.047  Sum_probs=297.8

Q ss_pred             CChHHHHHhhhccceee-ccCCCCCCccccccCCCCHHHHHHHHHCCCCCCcHHHHhhHhhhhcCCcEEEEcCCCCchhH
Q 019041            1 MTETEVKMYRARREITV-EGHDVPRPIRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWPMALKGRDLIGIAETGSGKTL   79 (347)
Q Consensus         1 ~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~~~~~~Q~~~i~~~~~~~~~lv~~~tGsGKT~   79 (347)
                      |++++++.++++..+.+ ++.+.|.|...|+++++++++.+.|+..||..|+++|.++|+.++.|+++++++|||||||+
T Consensus       103 ~~~~~~~~~~~~~~i~~~~g~~~p~p~~~f~~~~l~~~l~~~l~~~g~~~pt~iQ~~aip~~l~G~dvI~~ApTGSGKTl  182 (545)
T PTZ00110        103 LSSKEVDEIRKEKEITIIAGENVPKPVVSFEYTSFPDYILKSLKNAGFTEPTPIQVQGWPIALSGRDMIGIAETGSGKTL  182 (545)
T ss_pred             CCHHHHHHHHHhcCcEEecCCCCCcccCCHhhcCCCHHHHHHHHHCCCCCCCHHHHHHHHHHhcCCCEEEEeCCCChHHH
Confidence            67899999999998886 78889999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhHHHHHHhhhcCCCccCCCCCEEEEEcCcHHHHHHHHHHHHHhccCCCceEEEEECCCCCchhhHhhcCCCcEEEeChH
Q 019041           80 SYLLPAFVHVSAQPRLVQGEGPIVLVLAPTRELAVQIQEEALKFGSRAGIRSTCIYGGAPKGPQIRDLRRGVEIVIATPG  159 (347)
Q Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~~lil~p~~~l~~q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iiv~T~~  159 (347)
                      +|++|++.++...+....+.++.+|||+|+++|+.|+.+.+.+++...++++..++++.........+..+++|+|+||+
T Consensus       183 aylLP~l~~i~~~~~~~~~~gp~~LIL~PTreLa~Qi~~~~~~~~~~~~i~~~~~~gg~~~~~q~~~l~~~~~IlVaTPg  262 (545)
T PTZ00110        183 AFLLPAIVHINAQPLLRYGDGPIVLVLAPTRELAEQIREQCNKFGASSKIRNTVAYGGVPKRGQIYALRRGVEILIACPG  262 (545)
T ss_pred             HHHHHHHHHHHhcccccCCCCcEEEEECChHHHHHHHHHHHHHHhcccCccEEEEeCCCCHHHHHHHHHcCCCEEEECHH
Confidence            99999998876654333344789999999999999999999999988899999999999887777778888999999999


Q ss_pred             HHHHHHhcCCCCCCcccEEEEecchhhhccCChHHHHHHHhhcCCCccEEEEEeecchhHHHHHHHhcC-CCeEEEeccc
Q 019041          160 RLIDMLEAQHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVTQIRPDRQTLYWSATWPREVETLARQFLR-NPYKVIIGSL  238 (347)
Q Consensus       160 ~l~~~~~~~~~~~~~~~~iIvDE~h~~~~~~~~~~~~~~~~~~~~~~~~i~lsaT~~~~~~~~~~~~~~-~~~~~~~~~~  238 (347)
                      +|.+.+......+.++++||+||||++.+.+|...+..++..+++.+|++++|||++..+..+.+.++. .+..+.+...
T Consensus       263 rL~d~l~~~~~~l~~v~~lViDEAd~mld~gf~~~i~~il~~~~~~~q~l~~SAT~p~~v~~l~~~l~~~~~v~i~vg~~  342 (545)
T PTZ00110        263 RLIDFLESNVTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVQSLARDLCKEEPVHVNVGSL  342 (545)
T ss_pred             HHHHHHHcCCCChhhCcEEEeehHHhhhhcchHHHHHHHHHhCCCCCeEEEEEeCCCHHHHHHHHHHhccCCEEEEECCC
Confidence            999999888888899999999999999999999999999999999999999999999998888888775 4555555443


Q ss_pred             ccccccccceeEEEecchhccccHHHHHHHHHHHhhc-CCCeEEEEecCcccHHHHHHHHhhCCCCceeecCCCCHHHHH
Q 019041          239 ELKANQSINQVVEVVTEAEKYNSMFICRLIKLLKEVM-DGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGDKNQSERD  317 (347)
Q Consensus       239 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~-~~~~~lvf~~~~~~~~~~~~~L~~~~~~~~~~~~~~~~~~r~  317 (347)
                      ...........+.......+..     .+..++.... .++++||||++++.++.+++.|...|+.+..+||++++++|.
T Consensus       343 ~l~~~~~i~q~~~~~~~~~k~~-----~L~~ll~~~~~~~~k~LIF~~t~~~a~~l~~~L~~~g~~~~~ihg~~~~~eR~  417 (545)
T PTZ00110        343 DLTACHNIKQEVFVVEEHEKRG-----KLKMLLQRIMRDGDKILIFVETKKGADFLTKELRLDGWPALCIHGDKKQEERT  417 (545)
T ss_pred             ccccCCCeeEEEEEEechhHHH-----HHHHHHHHhcccCCeEEEEecChHHHHHHHHHHHHcCCcEEEEECCCcHHHHH
Confidence            3333334444444444333332     4555555544 577999999999999999999999999999999999999999


Q ss_pred             HHHHHHhcCCCCEEEEecccccCCCCCcCC
Q 019041          318 WVLAEFRSGRSPIMTATDVAARGLGRITVC  347 (347)
Q Consensus       318 ~~~~~f~~g~~~vlv~T~~~~~Gidip~v~  347 (347)
                      .+++.|++|+.+|||||+++++|||+|+|+
T Consensus       418 ~il~~F~~G~~~ILVaTdv~~rGIDi~~v~  447 (545)
T PTZ00110        418 WVLNEFKTGKSPIMIATDVASRGLDVKDVK  447 (545)
T ss_pred             HHHHHHhcCCCcEEEEcchhhcCCCcccCC
Confidence            999999999999999999999999999985

>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>KOG2340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>KOG1131 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PHA00012 I assembly protein Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>COG4626 Phage terminase-like protein, large subunit [General function prediction only] Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>COG2109 BtuR ATP:corrinoid adenosyltransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG3972 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2 Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PF02572 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2 Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA00350 putative assembly protein Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK07414 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated Back     alignment and domain information
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK08840 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK08006 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05636 replicative DNA helicase; Provisional Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PHA03372 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1806 consensus DEAD box containing helicases [Replication, recombination and repair] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK13897 type IV secretion system component VirD4; Provisional Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>PRK06321 replicative DNA helicase; Provisional Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PHA02535 P terminase ATPase subunit; Provisional Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query347
3fe2_A242 Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D 5e-93
4a4d_A253 Crystal Structure Of The N-Terminal Domain Of The H 2e-91
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 2e-68
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 6e-64
3iuy_A228 Crystal Structure Of Ddx53 Dead-Box Domain Length = 3e-60
1hv8_A367 Crystal Structure Of A Dead Box Protein From The Hy 2e-46
1wrb_A253 Crystal Structure Of The N-Terminal Reca-Like Domai 5e-46
2j0u_B374 The Crystal Structure Of Eif4aiii-Barentsz Complex 6e-46
2hyi_C413 Structure Of The Human Exon Junction Complex With A 1e-45
2xb2_A411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 1e-45
2j0q_A410 The Crystal Structure Of The Exon Junction Complex 1e-45
2hxy_A391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 1e-45
2j0u_A374 The Crystal Structure Of Eif4aiii-Barentsz Complex 3e-45
3ber_A249 Human Dead-Box Rna-Helicase Ddx47, Conserved Domain 6e-43
2zu6_A388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 2e-42
3eiq_A414 Crystal Structure Of Pdcd4-eif4a Length = 414 3e-42
2vso_A395 Crystal Structure Of A Translation Initiation Compl 1e-40
1fuu_A394 Yeast Initiation Factor 4a Length = 394 2e-38
2gxq_A207 Hera N-Terminal Domain In Complex With Amp, Crystal 1e-37
3mwj_A207 Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap 3e-37
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 4e-36
3ly5_A262 Ddx18 Dead-Domain Length = 262 1e-31
3pew_A395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 1e-29
3pey_A395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 1e-29
3sqw_A 579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 3e-29
2z0m_A337 Crystal Structure Of Hypothetical Atp-Dependent Rna 3e-29
3i5x_A 563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 3e-29
3sqx_A 512 Structure Of Mss116p (Nte And C-Tail Double Deletio 4e-29
1xtk_A390 Structure Of Decd To Dead Mutation Of Human Uap56 L 4e-29
3fho_B508 Structure Of S. Pombe Dbp5 Length = 508 7e-29
1xti_A391 Structure Of Wildtype Human Uap56 Length = 391 9e-29
1vec_A206 Crystal Structure Of The N-Terminal Domain Of RckP5 9e-29
1xtj_A386 Structure Of Human Uap56 In Complex With Adp Length 9e-29
3bor_A237 Crystal Structure Of The Deadc Domain Of Human Tran 3e-27
2pl3_A236 Human Dead-Box Rna Helicase Ddx10, Dead Domain In C 4e-27
1q0u_A219 Crystal Structure Of The Bstdead N-Terminal Domain 4e-27
1qde_A224 Crystal Structure Of The Atpase Domain Of Translati 7e-27
1qva_A223 Yeast Initiation Factor 4a N-Terminal Domain Length 2e-26
3dkp_A245 Human Dead-Box Rna-Helicase Ddx52, Conserved Domain 2e-26
2g9n_A221 Structure Of The Dead Domain Of Human Eukaryotic In 1e-24
1t6n_A220 Crystal Structure Of The N-Terminal Domain Of Human 2e-21
2oxc_A230 Human Dead-Box Rna Helicase Ddx20, Dead Domain In C 5e-21
3fht_A412 Crystal Structure Of Human Dbp5 In Complex With Amp 7e-19
3ews_A445 Human Dead-Box Rna-Helicase Ddx19 In Complex With A 8e-19
3g0h_A424 Human Dead-box Rna Helicase Ddx19, In Complex With 8e-19
3fmp_B479 Crystal Structure Of The Nucleoporin Nup214 In Comp 1e-18
2kbe_A226 Solution Structure Of Amino-Terminal Domain Of Dbp5 4e-16
2jgn_A185 Ddx3 Helicase Domain Length = 185 2e-14
3fhc_B235 Crystal Structure Of Human Dbp5 In Complex With Nup 1e-11
3fmo_B300 Crystal Structure Of The Nucleoporin Nup214 In Comp 1e-11
3eaq_A 212 Novel Dimerization Motif In The Dead Box Rna Helica 7e-10
3i32_A 300 Dimeric Structure Of A Hera Helicase Fragment Inclu 9e-10
2p6n_A191 Human Dead-box Rna Helicase Ddx41, Helicase Domain 3e-09
1fuk_A165 Crystal Structure Of The Carboxy Terminal Domain Of 9e-09
2hjv_A163 Structure Of The Second Domain (Residues 207-368) O 2e-07
2kbf_A187 Solution Structure Of Carboxyl-Terminal Domain Of D 1e-06
3peu_A188 S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To 1e-06
3gfp_A189 Structure Of The C-Terminal Domain Of The Dead-Box 2e-06
4ay2_A 687 Capturing 5' Tri-Phosphorylated Rna Duplex By Rig-I 4e-05
2ykg_A 696 Structural Insights Into Rna Recognition By Rig-I L 4e-05
3tmi_A 695 Structural Basis For Rna Recognition And Activation 5e-05
2v1x_A 591 Crystal Structure Of Human Recq-Like Dna Helicase L 8e-05
4db4_A 256 Mss116p Dead-Box Helicase Domain 2 Bound To A Chima 2e-04
4db2_C 257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 2e-04
4db2_A 257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 2e-04
>pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 Back     alignment and structure 
Iteration: 1

 Score =  337 bits (864), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 162/239 (67%), Positives = 190/239 (79%)
Query: 2   TETEVKMYRARREITVEGHDVPRPIRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWPMA 61
           T  EV+ YR  +EITV GH+ P+P+  F EANFP   ++VIA+  F EPT IQAQGWP+A
Sbjct: 4   TAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVA 63
Query: 62  LKGRDLIGIAETGSGKTLSYLLPAFVHVSAQPRLVQGEGPIVLVLAPTRELAVQIQEEAL 121
           L G D++G+A+TGSGKTLSYLLPA VH++ QP L +G+GPI LVLAPTRELA Q+Q+ A 
Sbjct: 64  LSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAA 123
Query: 122 KFGSRAGIRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLEAQHTNLRRVTYLVLD 181
           ++     ++STCIYGGAPKGPQIRDL RGVEI IATPGRLID LE   TNLRR TYLVLD
Sbjct: 124 EYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLD 183
Query: 182 EADRMLDMGFEPQIRKIVTQIRPDRQTLYWSATWPREVETLARQFLRNPYKVIIGSLEL 240
           EADRMLDMGFEPQIRKIV QIRPDRQTL WSATWP+EV  LA  FL++   + IG+LEL
Sbjct: 184 EADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALEL 242
>pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 Back     alignment and structure
>pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|3BOR|A Chain A, Crystal Structure Of The Deadc Domain Of Human Translation Initiation Factor 4a-2 Length = 237 Back     alignment and structure
>pdb|2PL3|A Chain A, Human Dead-Box Rna Helicase Ddx10, Dead Domain In Complex With Adp Length = 236 Back     alignment and structure
>pdb|1Q0U|A Chain A, Crystal Structure Of The Bstdead N-Terminal Domain Length = 219 Back     alignment and structure
>pdb|1QDE|A Chain A, Crystal Structure Of The Atpase Domain Of Translation Initiation Factor 4a From Saccharomyces Cerevisiae-The Prototype Of The Dead Box Protein Family Length = 224 Back     alignment and structure
>pdb|1QVA|A Chain A, Yeast Initiation Factor 4a N-Terminal Domain Length = 223 Back     alignment and structure
>pdb|3DKP|A Chain A, Human Dead-Box Rna-Helicase Ddx52, Conserved Domain I In Complex With Adp Length = 245 Back     alignment and structure
>pdb|2G9N|A Chain A, Structure Of The Dead Domain Of Human Eukaryotic Initiation Factor 4a, Eif4a Length = 221 Back     alignment and structure
>pdb|1T6N|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Uap56 Length = 220 Back     alignment and structure
>pdb|2OXC|A Chain A, Human Dead-Box Rna Helicase Ddx20, Dead Domain In Complex With Adp Length = 230 Back     alignment and structure
>pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 Back     alignment and structure
>pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 Back     alignment and structure
>pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 Back     alignment and structure
>pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 Back     alignment and structure
>pdb|2KBE|A Chain A, Solution Structure Of Amino-Terminal Domain Of Dbp5p Length = 226 Back     alignment and structure
>pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 Back     alignment and structure
>pdb|3FHC|B Chain B, Crystal Structure Of Human Dbp5 In Complex With Nup214 Length = 235 Back     alignment and structure
>pdb|3FMO|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 300 Back     alignment and structure
>pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 Back     alignment and structure
>pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 Back     alignment and structure
>pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 Back     alignment and structure
>pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 Back     alignment and structure
>pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 Back     alignment and structure
>pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 Back     alignment and structure
>pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 Back     alignment and structure
>pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 Back     alignment and structure
>pdb|4AY2|A Chain A, Capturing 5' Tri-Phosphorylated Rna Duplex By Rig-I Length = 687 Back     alignment and structure
>pdb|2YKG|A Chain A, Structural Insights Into Rna Recognition By Rig-I Length = 696 Back     alignment and structure
>pdb|3TMI|A Chain A, Structural Basis For Rna Recognition And Activation Of Rig-I Length = 695 Back     alignment and structure
>pdb|2V1X|A Chain A, Crystal Structure Of Human Recq-Like Dna Helicase Length = 591 Back     alignment and structure
>pdb|4DB4|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To A Chimaeric Rna-Dna Duplex Length = 256 Back     alignment and structure
>pdb|4DB2|C Chain C, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|4DB2|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query347
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 0.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 0.0
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 1e-169
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 1e-147
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 1e-139
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 1e-129
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 1e-106
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 1e-106
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 1e-105
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 1e-104
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 1e-103
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 1e-103
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 1e-102
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 1e-102
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 1e-100
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 2e-96
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 7e-96
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 7e-92
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 8e-90
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 1e-89
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 1e-88
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 1e-84
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 3e-81
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 8e-80
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 4e-78
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 6e-78
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 2e-74
3bor_A237 Human initiation factor 4A-II; translation initiat 7e-74
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 9e-71
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 3e-70
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 8e-63
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 7e-50
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 6e-49
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 1e-24
3eaq_A 212 Heat resistant RNA dependent ATPase; DEAD box RNA 1e-22
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 1e-21
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 2e-21
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 1e-20
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 1e-08
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 8e-20
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 2e-19
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 2e-18
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 5e-13
1yks_A 440 Genome polyprotein [contains: flavivirin protease 1e-11
3b6e_A216 Interferon-induced helicase C domain-containing P; 1e-10
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 4e-10
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 1e-09
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 2e-09
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 3e-09
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 4e-09
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 4e-09
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 5e-09
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 6e-09
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 3e-08
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 5e-08
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 2e-07
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 7e-07
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 2e-06
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 4e-06
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 7e-06
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 1e-05
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 2e-05
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 8e-05
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-04
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
 Score =  576 bits (1487), Expect = 0.0
 Identities = 129/330 (39%), Positives = 195/330 (59%), Gaps = 10/330 (3%)

Query: 14  EITVEGHDVPRPIRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWPMALKGRDLIGIAET 73
            + V G DVP+PI+ F  A+  D  ++ + K G+  PTPIQ    P+   GRDL+  A+T
Sbjct: 43  PVKVTGSDVPQPIQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQT 102

Query: 74  GSGKTLSYLLPAFVHVSAQPRLVQGEGPIVLVLAPTRELAVQIQEEALKFGSRAGIRSTC 133
           GSGKT ++LLP    +   P  ++   P V++++PTRELA+QI  EA KF   + ++   
Sbjct: 103 GSGKTAAFLLPILSKLLEDPHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGI 162

Query: 134 IYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLEAQHTNLRRVTYLVLDEADRMLDMGFEP 193
           +YGG     Q   + RG  +VIATPGRL+D ++          ++VLDEADRMLDMGF  
Sbjct: 163 VYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSE 222

Query: 194 QIRKIVTQI--RPDRQTLYWSATWPREVETLARQFLRNPYKVIIGSLELKANQSINQVVE 251
            +R+I+T +  RP+ QTL +SAT+P E++ +A +FL+N   V IG +   A   + Q + 
Sbjct: 223 DMRRIMTHVTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVG-GACSDVKQTIY 281

Query: 252 VVTEAEKYNSMFICRLIKLLKEVMDGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGDK 311
            V +  K +     +LI++L E       ++F ETK+G D +   L    +P  SIHGD+
Sbjct: 282 EVNKYAKRS-----KLIEILSE--QADGTIVFVETKRGADFLASFLSEKEFPTTSIHGDR 334

Query: 312 NQSERDWVLAEFRSGRSPIMTATDVAARGL 341
            QS+R+  L +F++G   ++ AT VA+RGL
Sbjct: 335 LQSQREQALRDFKNGSMKVLIATSVASRGL 364
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Length = 510 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Length = 1054 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Length = 591 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Length = 523 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query347
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 100.0
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 100.0
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 100.0
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 100.0
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 100.0
3bor_A237 Human initiation factor 4A-II; translation initiat 100.0
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 100.0
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 100.0
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 100.0
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 100.0
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 100.0
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 100.0
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 100.0
4gl2_A 699 Interferon-induced helicase C domain-containing P; 100.0
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 100.0
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 100.0
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 100.0
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 100.0
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 100.0
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 100.0
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 100.0
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 100.0
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 100.0
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 100.0
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 100.0
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 100.0
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 100.0
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 100.0
3h1t_A590 Type I site-specific restriction-modification syst 100.0
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 100.0
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 100.0
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.98
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 99.97
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 99.97
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 99.97
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.97
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 99.97
1yks_A 440 Genome polyprotein [contains: flavivirin protease 99.97
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.97
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.96
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.96
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.96
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.96
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.95
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 99.95
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.93
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.93
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.93
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.92
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.87
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.87
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.87
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.87
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.84
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.79
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.79
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.58
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.57
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.56
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.56
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.55
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.53
3eaq_A 212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.49
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 99.46
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.09
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 99.02
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.01
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 98.94
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 98.8
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 98.74
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 98.72
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 98.7
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 98.64
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 98.6
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 98.4
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 98.32
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 97.93
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 97.88
3cpe_A 592 Terminase, DNA packaging protein GP17; large termi 97.87
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 97.78
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 97.75
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 97.73
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 97.64
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.5
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 97.44
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 97.4
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.33
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enz 97.26
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 97.22
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 97.19
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 97.15
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 97.07
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 97.02
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 96.97
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 96.97
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 96.96
2v1u_A387 Cell division control protein 6 homolog; DNA repli 96.88
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 96.86
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 96.86
2chg_A226 Replication factor C small subunit; DNA-binding pr 96.84
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 96.83
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 96.83
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 96.82
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.81
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 96.79
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.65
3co5_A143 Putative two-component system transcriptional RES 96.62
3bos_A242 Putative DNA replication factor; P-loop containing 96.6
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 96.55
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 96.54
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 96.51
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 96.48
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 96.41
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 96.39
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 96.26
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 96.21
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 96.12
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 96.11
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 96.07
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 96.05
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 96.02
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 96.02
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 95.96
3pvs_A 447 Replication-associated recombination protein A; ma 95.91
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 95.85
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 95.76
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 95.71
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 95.66
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 95.64
2gno_A305 DNA polymerase III, gamma subunit-related protein; 95.63
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 95.63
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 95.58
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 95.52
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 95.37
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 95.35
3hjh_A483 Transcription-repair-coupling factor; MFD, mutatio 95.18
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 95.14
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 95.12
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 95.07
2r6a_A454 DNAB helicase, replicative helicase; replication, 95.04
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 95.03
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 94.98
2fna_A357 Conserved hypothetical protein; structural genomic 94.85
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 94.58
2chq_A319 Replication factor C small subunit; DNA-binding pr 94.56
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 94.44
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 94.38
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 94.28
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 94.14
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 93.93
3io5_A333 Recombination and repair protein; storage dimer, i 93.81
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 93.64
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 93.39
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 93.33
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 93.23
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 93.19
2qgz_A308 Helicase loader, putative primosome component; str 93.19
2oap_1511 GSPE-2, type II secretion system protein; hexameri 93.14
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 92.89
1p9r_A418 General secretion pathway protein E; bacterial typ 92.89
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 92.85
3u4q_B 1166 ATP-dependent helicase/deoxyribonuclease subunit; 92.6
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 92.59
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 92.27
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 92.12
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 91.93
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 91.83
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 91.67
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 91.54
3hgt_A 328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 91.35
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 91.32
1e9r_A 437 Conjugal transfer protein TRWB; coupling protein, 91.14
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 91.1
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 90.91
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 90.77
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 90.69
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 90.55
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 90.53
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 90.5
2l8b_A189 Protein TRAI, DNA helicase I; RECD, hydrolase; NMR 90.35
3vaa_A199 Shikimate kinase, SK; structural genomics, center 90.3
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 90.23
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 90.19
2l82_A162 Designed protein OR32; structural genomics, northe 90.11
3cmw_A1706 Protein RECA, recombinase A; homologous recombinat 90.11
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 90.04
2eyu_A261 Twitching motility protein PILT; pilus retraction 89.93
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 89.88
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 89.85
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 89.82
1w36_B 1180 RECB, exodeoxyribonuclease V beta chain; recombina 89.78
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 89.71
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 89.61
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 89.51
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 89.4
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 89.36
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 89.21
1tue_A212 Replication protein E1; helicase, replication, E1E 89.18
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 89.15
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 89.15
1kag_A173 SKI, shikimate kinase I; transferase, structural g 89.15
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 89.09
2r44_A331 Uncharacterized protein; putative ATPase, structur 89.07
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 89.04
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 89.04
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 89.03
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 89.03
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 89.01
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 88.89
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 88.89
2cvh_A220 DNA repair and recombination protein RADB; filamen 88.82
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 88.75
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 88.71
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 88.68
1u94_A356 RECA protein, recombinase A; homologous recombinat 88.67
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 88.62
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 88.61
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 88.57
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 88.54
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 88.53
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 88.52
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 88.33
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 88.29
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 88.27
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 88.23
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 88.22
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 88.19
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 88.15
2r62_A268 Cell division protease FTSH homolog; ATPase domain 88.15
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 88.13
3nwn_A359 Kinesin-like protein KIF9; motor domain, ADP, stru 88.03
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 88.01
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 87.97
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 87.95
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 87.9
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 87.85
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 87.65
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 87.45
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 87.31
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 87.19
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 87.18
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 87.13
1bg2_A325 Kinesin; motor protein, ATPase, microtubule associ 87.12
2ewv_A372 Twitching motility protein PILT; pilus retraction 87.03
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 87.02
1xp8_A366 RECA protein, recombinase A; recombination, radior 86.84
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 86.76
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 86.63
1goj_A355 Kinesin, kinesin heavy chain; motor protein, ATPas 86.62
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 86.51
2vvg_A350 Kinesin-2; motor protein, nucleotide-binding, micr 86.49
1f9v_A347 Kinesin-like protein KAR3; kinesin-related protein 86.41
3dc4_A344 Kinesin-like protein NOD; catalytic domain, ATPase 86.4
2h58_A330 Kinesin-like protein KIFC3 variant; motor domain, 86.25
2zfi_A366 Kinesin-like protein KIF1A, kinesin heavy chain is 86.23
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 86.19
3t0q_A349 AGR253WP; kinesin, alpha and beta proteins, P-loop 86.16
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 86.12
3bfn_A388 Kinesin-like protein KIF22; limited proteolysis, s 86.09
3b6u_A372 Kinesin-like protein KIF3B; structural genomics co 86.08
1vma_A306 Cell division protein FTSY; TM0570, structural gen 86.07
3lre_A355 Kinesin-like protein KIF18A; motor protein, nucleo 86.05
1v8k_A410 Kinesin-like protein KIF2C; microtubule destabiliz 86.05
1ojl_A304 Transcriptional regulatory protein ZRAR; response 86.05
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 86.03
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 85.98
1t5c_A349 CENP-E protein, centromeric protein E; kinesin mot 85.95
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 85.94
2y65_A365 Kinesin, kinesin heavy chain; motor protein; HET: 85.84
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 85.83
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 85.76
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 85.75
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 85.69
3gbj_A354 KIF13B protein; kinesin, motor domain, ADP, struct 85.67
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 85.65
4a14_A344 Kinesin, kinesin-like protein KIF7; motor protein, 85.62
4etp_A403 Kinesin-like protein KAR3; kinesin motor protein, 85.6
2nr8_A358 Kinesin-like protein KIF9; motor domain, ADP, stru 85.53
1x88_A359 Kinesin-like protein KIF11; switch II, motor domai 85.49
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 85.47
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 85.41
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 85.39
1xjc_A169 MOBB protein homolog; structural genomics, midwest 85.29
2wbe_C373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 85.28
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 85.26
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 85.21
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 85.18
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 85.06
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 85.02
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 84.98
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 84.88
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 84.87
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 84.85
2owm_A443 Nckin3-434, related to kinesin-like protein KIF1C; 84.8
2heh_A387 KIF2C protein; kinesin, motor domain, ADP, structu 84.78
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 84.73
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 84.69
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 84.34
3cob_A369 Kinesin heavy chain-like protein; motor, switch II 84.31
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 84.19
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 84.15
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 84.1
1via_A175 Shikimate kinase; structural genomics, transferase 84.09
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 84.08
2rep_A376 Kinesin-like protein KIFC1; structural genomics co 84.08
3u06_A412 Protein claret segregational; motor domain, stalk 83.93
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 83.89
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 83.71
2z43_A324 DNA repair and recombination protein RADA; archaea 83.49
3tlx_A243 Adenylate kinase 2; structural genomics, structura 83.37
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 83.36
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 83.35
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 83.33
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 83.32
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 83.31
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 83.28
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 83.28
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 83.24
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 83.23
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 83.2
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 83.15
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 83.14
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 83.12
3bor_A237 Human initiation factor 4A-II; translation initiat 83.08
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 82.96
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 82.86
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 82.85
1yks_A440 Genome polyprotein [contains: flavivirin protease 82.84
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 82.82
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 82.82
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 82.75
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 82.69
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 82.66
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 82.61
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 82.6
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 82.45
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 82.36
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 82.32
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 82.25
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 82.23
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 82.01
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 81.9
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 81.8
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 81.73
2vli_A183 Antibiotic resistance protein; transferase, tunica 81.72
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 81.62
3bs4_A260 Uncharacterized protein PH0321; structural genomic 81.6
1ry6_A360 Internal kinesin; kinesin motor domain, nucleotide 81.56
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 81.48
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 81.47
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 81.45
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 81.29
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 81.24
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 81.19
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 81.11
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 81.1
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 81.05
3foj_A100 Uncharacterized protein; protein SSP1007, structur 80.92
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 80.92
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 80.85
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 80.83
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 80.8
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 80.79
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 80.61
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 80.58
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 80.43
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 80.37
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 80.08
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 80.03
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 80.01
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
Probab=100.00  E-value=4.3e-52  Score=372.24  Aligned_cols=326  Identities=40%  Similarity=0.660  Sum_probs=283.2

Q ss_pred             ceeeccCCCCCCccccccCCCCHHHHHHHHHCCCCCCcHHHHhhHhhhhcCCcEEEEcCCCCchhHHhHHHHHHhhhcCC
Q 019041           14 EITVEGHDVPRPIRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWPMALKGRDLIGIAETGSGKTLSYLLPAFVHVSAQP   93 (347)
Q Consensus        14 ~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~~~~~~Q~~~i~~~~~~~~~lv~~~tGsGKT~~~~~~~~~~~~~~~   93 (347)
                      ..++.+.+.|.|+..|+++++++.+.++++.+||..|+++|.++++.+++++++++++|||+|||++|+++++..+...+
T Consensus        43 ~~~~~~~~~p~~~~~f~~~~l~~~l~~~l~~~g~~~pt~iQ~~ai~~i~~g~d~i~~a~TGsGKT~a~~lpil~~l~~~~  122 (434)
T 2db3_A           43 PVKVTGSDVPQPIQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDP  122 (434)
T ss_dssp             CEEEESSSCCCCCCCGGGSCCCHHHHHHHHHTTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHHHHHSC
T ss_pred             eeEecCCCCCCCcCChhhcCCCHHHHHHHHHcCCCCCCHHHHHHHHHHhcCCCEEEECCCCCCchHHHHHHHHHHHHhcc
Confidence            56778888999999999999999999999999999999999999999999999999999999999999999999887654


Q ss_pred             CccCCCCCEEEEEcCcHHHHHHHHHHHHHhccCCCceEEEEECCCCCchhhHhhcCCCcEEEeChHHHHHHHhcCCCCCC
Q 019041           94 RLVQGEGPIVLVLAPTRELAVQIQEEALKFGSRAGIRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLEAQHTNLR  173 (347)
Q Consensus        94 ~~~~~~~~~~lil~p~~~l~~q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iiv~T~~~l~~~~~~~~~~~~  173 (347)
                      ......++++||++|+++|+.|+.+.+.+++...++++..++|+.........+..+++|+|+||+++.+.+......+.
T Consensus       123 ~~~~~~~~~~lil~PtreLa~Q~~~~~~~~~~~~~~~~~~~~gg~~~~~~~~~l~~~~~Ivv~Tp~~l~~~l~~~~~~l~  202 (434)
T 2db3_A          123 HELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTFITFE  202 (434)
T ss_dssp             CCCCTTCCSEEEECSSHHHHHHHHHHHHHHTTTSSCCCCEECTTSCHHHHHHHHTTCCSEEEECHHHHHHHHHTTSCCCT
T ss_pred             cccccCCccEEEEecCHHHHHHHHHHHHHHhccCCcEEEEEECCCCHHHHHHHhhcCCCEEEEChHHHHHHHHhCCcccc
Confidence            33333467899999999999999999999988888999999999887777777778899999999999999988888889


Q ss_pred             cccEEEEecchhhhccCChHHHHHHHhhc--CCCccEEEEEeecchhHHHHHHHhcCCCeEEEecccccccccccceeEE
Q 019041          174 RVTYLVLDEADRMLDMGFEPQIRKIVTQI--RPDRQTLYWSATWPREVETLARQFLRNPYKVIIGSLELKANQSINQVVE  251 (347)
Q Consensus       174 ~~~~iIvDE~h~~~~~~~~~~~~~~~~~~--~~~~~~i~lsaT~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  251 (347)
                      +++++|+||||++.+.+|...+..++...  .+.+|++++|||++..+..+...++.++..+....... ........+.
T Consensus       203 ~~~~lVlDEah~~~~~gf~~~~~~i~~~~~~~~~~q~l~~SAT~~~~~~~~~~~~l~~~~~i~~~~~~~-~~~~i~~~~~  281 (434)
T 2db3_A          203 DTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGG-ACSDVKQTIY  281 (434)
T ss_dssp             TCCEEEEETHHHHTSTTTHHHHHHHHHCTTSCSSCEEEEEESCCCHHHHHHHHTTCSSCEEEEESSTTC-CCTTEEEEEE
T ss_pred             cCCeEEEccHhhhhccCcHHHHHHHHHhcCCCCCceEEEEeccCCHHHHHHHHHhccCCEEEEeccccc-cccccceEEE
Confidence            99999999999999999999999998875  56789999999999999999999998887776654332 2223333344


Q ss_pred             EecchhccccHHHHHHHHHHHhhcCCCeEEEEecCcccHHHHHHHHhhCCCCceeecCCCCHHHHHHHHHHHhcCCCCEE
Q 019041          252 VVTEAEKYNSMFICRLIKLLKEVMDGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGDKNQSERDWVLAEFRSGRSPIM  331 (347)
Q Consensus       252 ~~~~~~~~~~~~~~~l~~~~~~~~~~~~~lvf~~~~~~~~~~~~~L~~~~~~~~~~~~~~~~~~r~~~~~~f~~g~~~vl  331 (347)
                      ......+.     ..+.+++...  ..++||||+++++++.+++.|.+.|+.+..+||++++.+|..+++.|++|+.+||
T Consensus       282 ~~~~~~k~-----~~l~~~l~~~--~~~~lVF~~t~~~a~~l~~~L~~~~~~~~~lhg~~~~~~R~~~l~~F~~g~~~vL  354 (434)
T 2db3_A          282 EVNKYAKR-----SKLIEILSEQ--ADGTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVL  354 (434)
T ss_dssp             ECCGGGHH-----HHHHHHHHHC--CTTEEEECSSHHHHHHHHHHHHHTTCCEEEESTTSCHHHHHHHHHHHHTSSCSEE
T ss_pred             EeCcHHHH-----HHHHHHHHhC--CCCEEEEEeCcHHHHHHHHHHHhCCCCEEEEeCCCCHHHHHHHHHHHHcCCCcEE
Confidence            44433333     2566666664  3459999999999999999999999999999999999999999999999999999


Q ss_pred             EEecccccCCCCCcCC
Q 019041          332 TATDVAARGLGRITVC  347 (347)
Q Consensus       332 v~T~~~~~Gidip~v~  347 (347)
                      |||+++++|+|+|+|+
T Consensus       355 vaT~v~~rGlDi~~v~  370 (434)
T 2db3_A          355 IATSVASRGLDIKNIK  370 (434)
T ss_dssp             EECGGGTSSCCCTTCC
T ss_pred             EEchhhhCCCCcccCC
Confidence            9999999999999975
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3u4q_B ATP-dependent helicase/deoxyribonuclease subunit; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_B* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2l8b_A Protein TRAI, DNA helicase I; RECD, hydrolase; NMR {Escherichia coli} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2l82_A Designed protein OR32; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, de novo protein; NMR {Artificial gene} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 347
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 2e-55
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 6e-52
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 2e-50
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 7e-50
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 4e-48
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 6e-44
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 4e-43
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 1e-40
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 6e-36
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 1e-35
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 1e-29
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 5e-27
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 1e-25
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 3e-17
d1a1va2 299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 4e-17
d1gkub2 248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 3e-13
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 5e-09
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 9e-09
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 2e-07
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 3e-07
d1oywa3200 c.37.1.19 (A:207-406) RecQ helicase domain {Escher 6e-07
d1t5la2181 c.37.1.19 (A:415-595) Nucleotide excision repair e 2e-06
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 1e-05
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 0.001
d1t5ia_168 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 0.001
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Putative DEAD box RNA helicase
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

 Score =  177 bits (451), Expect = 2e-55
 Identities = 75/206 (36%), Positives = 112/206 (54%), Gaps = 8/206 (3%)

Query: 29  FQEANFPDYCLEVIAKLGFVEPTPIQAQGWPMALKGR-DLIGIAETGSGKTLSYLLPAFV 87
           F E N  D  L  I   GF +PT IQ +  P+ L    +++  A TGSGKT S+ +P   
Sbjct: 6   FNELNLSDNILNAIRNKGFEKPTDIQMKVIPLFLNDEYNIVAQARTGSGKTASFAIPLIE 65

Query: 88  HVSAQPRLVQGEGPIVLVLAPTRELAVQIQEEALKFGSRAGIRSTCIYGGAPKGPQIRDL 147
            V+         G   ++L PTRELA+Q+ +E         ++   IYGG    PQI+ L
Sbjct: 66  LVNENN------GIEAIILTPTRELAIQVADEIESLKGNKNLKIAKIYGGKAIYPQIKAL 119

Query: 148 RRGVEIVIATPGRLIDMLEAQHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVTQIRPDRQ 207
           +    IV+ TPGR++D +     NL+ V Y +LDEAD ML+MGF   + KI+     D++
Sbjct: 120 K-NANIVVGTPGRILDHINRGTLNLKNVKYFILDEADEMLNMGFIKDVEKILNACNKDKR 178

Query: 208 TLYWSATWPREVETLARQFLRNPYKV 233
            L +SAT PRE+  LA++++ +   +
Sbjct: 179 ILLFSATMPREILNLAKKYMGDYSFI 204
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Length = 181 Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query347
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 100.0
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 100.0
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 100.0
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 100.0
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 100.0
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 100.0
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 100.0
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 100.0
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 100.0
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.96
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.96
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.95
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.94
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.94
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.91
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.88
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.85
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.85
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.82
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.78
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.72
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.67
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.63
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.63
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.62
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.61
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.6
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.59
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.58
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.58
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.53
d2eyqa5 211 Transcription-repair coupling factor, TRCF {Escher 99.43
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.24
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.19
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 99.19
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 99.19
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.18
d1gkub2 248 Helicase-like "domain" of reverse gyrase {Archaeon 99.16
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.14
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.09
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 98.78
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV) 98.75
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11 98.74
d1z3ix1 346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 98.49
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.46
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 98.4
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 98.23
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 98.03
d1nkta4 219 Translocation ATPase SecA, nucleotide-binding doma 98.01
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 97.77
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 97.76
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.49
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 97.46
d2qy9a2211 GTPase domain of the signal recognition particle r 97.45
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 97.42
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 97.38
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 97.36
d1okkd2207 GTPase domain of the signal recognition particle r 97.29
d1t5la1 413 Nucleotide excision repair enzyme UvrB {Bacillus c 97.27
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 97.22
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 97.2
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 97.18
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 97.17
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 97.13
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.09
d1vmaa2213 GTPase domain of the signal recognition particle r 97.09
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 97.0
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 96.74
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.43
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 96.41
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 96.36
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.29
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 96.23
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 96.11
d1c4oa1 408 Nucleotide excision repair enzyme UvrB {Thermus th 96.07
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 95.99
d1g5ta_157 ATP:corrinoid adenosyltransferase CobA {Salmonella 95.97
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 95.87
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 95.78
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 95.66
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 95.33
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 95.31
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 95.2
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 95.17
d1w36b1 485 Exodeoxyribonuclease V beta chain (RecB), N-termin 94.67
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 94.49
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 94.41
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 94.0
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 93.95
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 93.86
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 93.81
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 93.54
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 93.24
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 93.2
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 93.09
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 92.99
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 92.9
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 92.87
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 92.81
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 92.78
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 92.6
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 92.31
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 92.2
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 92.14
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 92.07
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 92.06
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 92.01
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 92.01
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 91.84
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 91.72
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 91.65
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 91.44
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 91.31
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 91.01
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 91.01
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 90.85
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 90.83
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 90.76
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 90.61
d2eyqa2117 Transcription-repair coupling factor, TRCF {Escher 90.34
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 90.31
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 90.28
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 90.16
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 90.08
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 89.99
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 89.92
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 89.67
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 89.66
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 89.65
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 89.51
d1svma_362 Papillomavirus large T antigen helicase domain {Si 89.47
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 89.35
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 89.35
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 89.31
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 89.28
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 88.92
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 88.68
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 88.59
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 88.52
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 88.39
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 88.36
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 88.29
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 88.24
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 88.23
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 88.22
d1bg2a_323 Kinesin {Human (Homo sapiens) [TaxId: 9606]} 87.96
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 87.86
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 87.62
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 87.42
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 87.36
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 86.78
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 86.74
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 86.45
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 86.33
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 86.0
d1goja_354 Kinesin {Neurospora crassa [TaxId: 5141]} 85.89
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 85.76
d1v8ka_362 Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 85.7
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 85.0
d2zfia1349 Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 84.86
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 84.62
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 84.6
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 84.56
d1gmxa_108 Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 84.45
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 84.45
d1x88a1345 Kinesin {Human (Homo sapiens), mitotic kinesin eg5 84.03
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 83.9
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 83.88
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 83.86
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 83.86
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 83.83
d1sdma_364 Kinesin heavy chain-like protein {Potato (Solanum 83.53
d2ncda_368 Kinesin motor Ncd (non-claret disjunctional) {Frui 82.83
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 82.82
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 82.54
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 82.28
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 82.18
d1f9va_342 Kinesin motor Ncd (non-claret disjunctional) {Bake 82.13
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 81.74
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 81.23
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 81.2
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 80.83
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 80.78
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 80.78
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 80.72
d1yt8a4130 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 80.65
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 80.54
d2hyda1255 Putative multidrug export ATP-binding/permease pro 80.5
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 80.35
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 80.12
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=6.4e-41  Score=267.83  Aligned_cols=216  Identities=33%  Similarity=0.566  Sum_probs=198.1

Q ss_pred             eeeccCCCCCCccccccCCCCHHHHHHHHHCCCCCCcHHHHhhHhhhhcCCcEEEEcCCCCchhHHhHHHHHHhhhcCCC
Q 019041           15 ITVEGHDVPRPIRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWPMALKGRDLIGIAETGSGKTLSYLLPAFVHVSAQPR   94 (347)
Q Consensus        15 ~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~~~~~~Q~~~i~~~~~~~~~lv~~~tGsGKT~~~~~~~~~~~~~~~~   94 (347)
                      .+.+..+.......|+++++++.+.++|++.||..|+++|..+++.+++|++++++||||||||++|++|+++.+.....
T Consensus         5 ~~~~~~~~~~~~~sF~~l~L~~~l~~~L~~~g~~~pt~IQ~~aIp~il~g~dvi~~a~TGSGKTlayllPil~~l~~~~~   84 (222)
T d2j0sa1           5 VEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVR   84 (222)
T ss_dssp             CCCCCCTTCCCCCSGGGGCCCHHHHHHHHHHTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHTCCTTSC
T ss_pred             cccccCCCCCCCCCHHHCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCeEEEcCcchhhhhhhccccccccccccc
Confidence            34455566777778999999999999999999999999999999999999999999999999999999999998866542


Q ss_pred             ccCCCCCEEEEEcCcHHHHHHHHHHHHHhccCCCceEEEEECCCCCchhhHhhcCCCcEEEeChHHHHHHHhcCCCCCCc
Q 019041           95 LVQGEGPIVLVLAPTRELAVQIQEEALKFGSRAGIRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLEAQHTNLRR  174 (347)
Q Consensus        95 ~~~~~~~~~lil~p~~~l~~q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iiv~T~~~l~~~~~~~~~~~~~  174 (347)
                           .++++|++|+++|+.|..+.+.+++...++++..+.|+.........+..+++|+|+||+++.+.+......+++
T Consensus        85 -----~~~~lil~PtreLa~Qi~~~~~~l~~~~~i~~~~~~g~~~~~~~~~~l~~~~~Ilv~TPgrl~~~~~~~~~~~~~  159 (222)
T d2j0sa1          85 -----ETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRA  159 (222)
T ss_dssp             -----SCCEEEECSSHHHHHHHHHHHHHHTTTTTCCEEEECTTSCHHHHHHHHHHCCSEEEECHHHHHHHHHTTSSCCTT
T ss_pred             -----CceeEEecchHHHHHHHHHHHHHHhCccceeEEEEeecccchhhHHHhccCCeEEeCCCCcHHhccccccccccc
Confidence                 678999999999999999999999999999999999999887777777778999999999999999999999999


Q ss_pred             ccEEEEecchhhhccCChHHHHHHHhhcCCCccEEEEEeecchhHHHHHHHhcCCCeEEEe
Q 019041          175 VTYLVLDEADRMLDMGFEPQIRKIVTQIRPDRQTLYWSATWPREVETLARQFLRNPYKVII  235 (347)
Q Consensus       175 ~~~iIvDE~h~~~~~~~~~~~~~~~~~~~~~~~~i~lsaT~~~~~~~~~~~~~~~~~~~~~  235 (347)
                      +.++|+||||.+.+.+|...+..+++.+++.+|.+++|||++..+..+++.++.+|..+.+
T Consensus       160 l~~lVlDEaD~ll~~~f~~~i~~I~~~l~~~~Q~ilfSAT~~~~v~~l~~~~l~~Pv~I~V  220 (222)
T d2j0sa1         160 IKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILV  220 (222)
T ss_dssp             CCEEEEETHHHHTSTTTHHHHHHHHTTSCTTCEEEEEESCCCHHHHTTGGGTCSSCEEECC
T ss_pred             ceeeeecchhHhhhcCcHHHHHHHHHhCCCCCEEEEEEEeCCHHHHHHHHHHCCCCEEEEE
Confidence            9999999999999999999999999999999999999999999999999999998876544
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa2 c.37.1.19 (A:349-465) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure