Citrus Sinensis ID: 019128
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 346 | ||||||
| 255540203 | 545 | conserved hypothetical protein [Ricinus | 0.965 | 0.612 | 0.836 | 1e-162 | |
| 118484915 | 541 | unknown [Populus trichocarpa] | 0.965 | 0.617 | 0.824 | 1e-160 | |
| 449440540 | 540 | PREDICTED: CBS domain-containing protein | 0.965 | 0.618 | 0.821 | 1e-158 | |
| 359491097 | 541 | PREDICTED: CBS domain-containing protein | 0.962 | 0.615 | 0.812 | 1e-155 | |
| 225456355 | 546 | PREDICTED: CBS domain-containing protein | 0.962 | 0.609 | 0.812 | 1e-155 | |
| 125528914 | 497 | hypothetical protein OsI_04983 [Oryza sa | 0.939 | 0.653 | 0.788 | 1e-152 | |
| 224122050 | 535 | predicted protein [Populus trichocarpa] | 0.962 | 0.622 | 0.775 | 1e-150 | |
| 357126564 | 550 | PREDICTED: CBS domain-containing protein | 0.939 | 0.590 | 0.773 | 1e-149 | |
| 147863576 | 569 | hypothetical protein VITISV_019408 [Viti | 0.956 | 0.581 | 0.740 | 1e-148 | |
| 356511510 | 542 | PREDICTED: CBS domain-containing protein | 0.939 | 0.599 | 0.783 | 1e-147 |
| >gi|255540203|ref|XP_002511166.1| conserved hypothetical protein [Ricinus communis] gi|223550281|gb|EEF51768.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 577 bits (1487), Expect = e-162, Method: Compositional matrix adjust.
Identities = 281/336 (83%), Positives = 301/336 (89%), Gaps = 2/336 (0%)
Query: 2 KDIATRVIARELNLEETPVSKVMTRNPTFVLSDTLAVEALQKMVQGKFRHLPVVENGEVI 61
KDIATRVIARELNLEETPVSKVMTRNP FVLSDTLAVEALQKMVQGKFRHLPVVENGEVI
Sbjct: 103 KDIATRVIARELNLEETPVSKVMTRNPVFVLSDTLAVEALQKMVQGKFRHLPVVENGEVI 162
Query: 62 ALLDIAKCLYDAIARMERAAEKGKAIAAAVEGVEKHWGTSISGPNTFIETLRERMFRPSL 121
ALLDIAKCLYDAIARMERAAEKGKAIAAAVEGVEK+WGT+ SGPNTFIETLRERMFRPSL
Sbjct: 163 ALLDIAKCLYDAIARMERAAEKGKAIAAAVEGVEKNWGTTFSGPNTFIETLRERMFRPSL 222
Query: 122 STIIPEKSKVVTISPTDTVLMATKKMLELRLSSAVVTVENKPRGILTSKDILMRVISQNL 181
STI+PE SKVVT+ PT+TVL TKKMLE R SSAVV V+ KPRGILTSKDILMRVI+QNL
Sbjct: 223 STILPENSKVVTVLPTETVLAVTKKMLESRSSSAVVIVDQKPRGILTSKDILMRVIAQNL 282
Query: 182 PADSTLVEKVMTPNPECATIDTPIVDALHIMHDGKFLHLPVVDRDGDVVDVVDVIHITHA 241
P+DSTL EKVMTPNPECATIDTPIVDALH MHDGKFLHLPV+DRDG+VV VVDVIHITHA
Sbjct: 283 PSDSTLAEKVMTPNPECATIDTPIVDALHTMHDGKFLHLPVLDRDGNVVAVVDVIHITHA 342
Query: 242 AVATVGNTAGSNNEAASTMMQKFWDSAMALSPNDDEEDNRSEGSLKFASEGADTARYLSY 301
AVATVG+TAG NNEAASTMMQKFWDSAMALSPN+D++D RSEGSLK SEGA+T R L Y
Sbjct: 343 AVATVGSTAGVNNEAASTMMQKFWDSAMALSPNEDDDDTRSEGSLKLPSEGAETGRSLPY 402
Query: 302 PSPSPGVPSAFAFKVQDNKGLMHRFTCGMLPFPNFI 337
PS G P++F FK++D KG MHRFT + I
Sbjct: 403 --PSAGFPNSFGFKIEDKKGRMHRFTSDTRSLTDLI 436
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|118484915|gb|ABK94323.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449440540|ref|XP_004138042.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Cucumis sativus] gi|449520507|ref|XP_004167275.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|359491097|ref|XP_003634219.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like isoform 2 [Vitis vinifera] gi|297734436|emb|CBI15683.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225456355|ref|XP_002283958.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like isoform 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|125528914|gb|EAY77028.1| hypothetical protein OsI_04983 [Oryza sativa Indica Group] gi|125573153|gb|EAZ14668.1| hypothetical protein OsJ_04591 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|224122050|ref|XP_002318739.1| predicted protein [Populus trichocarpa] gi|222859412|gb|EEE96959.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357126564|ref|XP_003564957.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|147863576|emb|CAN79772.1| hypothetical protein VITISV_019408 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356511510|ref|XP_003524468.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 346 | ||||||
| TAIR|locus:2167331 | 543 | AT5G63490 "AT5G63490" [Arabido | 0.916 | 0.583 | 0.658 | 5.7e-107 | |
| ASPGD|ASPL0000033419 | 666 | AN5716 [Emericella nidulans (t | 0.791 | 0.411 | 0.334 | 6.1e-33 | |
| CGD|CAL0003543 | 605 | orf19.5238 [Candida albicans ( | 0.904 | 0.517 | 0.284 | 7.7e-28 | |
| POMBASE|SPAC24C9.05c | 730 | mug70 "conserved protein Mug20 | 0.641 | 0.304 | 0.215 | 5.4e-20 | |
| UNIPROTKB|Q48IU0 | 146 | PSPPH_2494 "CBS domain protein | 0.210 | 0.5 | 0.36 | 1.7e-05 | |
| UNIPROTKB|Q5LRC8 | 144 | SPO2201 "CBS domain protein" [ | 0.291 | 0.701 | 0.288 | 0.00011 | |
| TIGR_CMR|SPO_2201 | 144 | SPO_2201 "CBS domain protein" | 0.291 | 0.701 | 0.288 | 0.00011 | |
| UNIPROTKB|Q3AFN9 | 210 | acuB "Acetoin utilization prot | 0.135 | 0.223 | 0.404 | 0.00024 | |
| TIGR_CMR|CHY_0173 | 210 | CHY_0173 "acetoin utilization | 0.135 | 0.223 | 0.404 | 0.00024 | |
| TAIR|locus:2183740 | 206 | CBSX3 "AT5G10860" [Arabidopsis | 0.242 | 0.407 | 0.303 | 0.0006 |
| TAIR|locus:2167331 AT5G63490 "AT5G63490" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1058 (377.5 bits), Expect = 5.7e-107, P = 5.7e-107
Identities = 214/325 (65%), Positives = 248/325 (76%)
Query: 2 KDIATRVIARELNLEETPVSKVMTRNPTFVLSDTLAVEALQKMVQGKFRHLPVVENGEVI 61
KDIATRVI++ELN+EETPVSKVMT+NP FVLS+TLAVEALQKMVQGKFRHLPVVENGEVI
Sbjct: 103 KDIATRVISQELNVEETPVSKVMTKNPMFVLSETLAVEALQKMVQGKFRHLPVVENGEVI 162
Query: 62 ALLDIAKCLYDAIARMERXXXXXXXXXXXXXXXXXHWGTSISGPNTFIETLRERMFRPSL 121
ALLDIAKCLYDAIARMER WGT+ S PNTFIETLR+RMFRPSL
Sbjct: 163 ALLDIAKCLYDAIARMERAAEKGKAIAAAVEGVEKSWGTNTSVPNTFIETLRDRMFRPSL 222
Query: 122 STIIPEKSKVVTISPTDTVLMATKKMLELRLSSAVVTVENKPRGILTSKDILMRVISQNL 181
STIIP+ +KV+ +SPTDTVL KKM+E + S AVV +E+K RGI TSKDILMRV+++NL
Sbjct: 223 STIIPDDTKVLKVSPTDTVLTVAKKMVEFQSSCAVVIIEDKLRGIFTSKDILMRVVAENL 282
Query: 182 PADSTLVEKVMTPNPECATIDTPIVDALHIMHDGKFLHLPXXXXXXXXXXXXXXIHITHA 241
P TLVE VMT NPE +DTPIV+ALHIMH+GKFLHLP IH+THA
Sbjct: 283 PPSETLVETVMTQNPESTIVDTPIVEALHIMHEGKFLHLPVTDKEGDVVAVVDVIHVTHA 342
Query: 242 AVATVGNTAGSNNEAASTMMQKFWDSAMALSPNDDEEDNRSEGSLKFASEGADTARYLSY 301
AVAT G TAG NEA +TMMQKFWDSAMALSPN+D+ED+RSE S+K ASE A+T + S+
Sbjct: 343 AVATAGTTAGIGNEATNTMMQKFWDSAMALSPNEDDEDSRSESSMKVASE-AETGK--SF 399
Query: 302 PSPSPGVPSAFAFKVQDNKGLMHRF 326
P + F+FK++D K HRF
Sbjct: 400 P-----FANTFSFKIEDKKHRKHRF 419
|
|
| ASPGD|ASPL0000033419 AN5716 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0003543 orf19.5238 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC24C9.05c mug70 "conserved protein Mug20" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q48IU0 PSPPH_2494 "CBS domain protein" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5LRC8 SPO2201 "CBS domain protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_2201 SPO_2201 "CBS domain protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3AFN9 acuB "Acetoin utilization protein AcuB" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_0173 CHY_0173 "acetoin utilization protein AcuB" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2183740 CBSX3 "AT5G10860" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00017958001 | SubName- Full=Chromosome chr17 scaffold_16, whole genome shotgun sequence; (541 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 346 | |||
| cd04587 | 113 | cd04587, CBS_pair_CAP-ED_DUF294_PBI_assoc, This cd | 3e-50 | |
| cd04587 | 113 | cd04587, CBS_pair_CAP-ED_DUF294_PBI_assoc, This cd | 4e-26 | |
| cd04800 | 111 | cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This c | 7e-23 | |
| cd04623 | 113 | cd04623, CBS_pair_10, The CBS domain, named after | 3e-22 | |
| cd04622 | 113 | cd04622, CBS_pair_9, The CBS domain, named after h | 1e-21 | |
| cd02205 | 113 | cd02205, CBS_pair, The CBS domain, named after hum | 4e-20 | |
| COG0517 | 117 | COG0517, COG0517, FOG: CBS domain [General functio | 6e-16 | |
| cd04623 | 113 | cd04623, CBS_pair_10, The CBS domain, named after | 1e-14 | |
| cd04611 | 111 | cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd co | 1e-14 | |
| cd04633 | 121 | cd04633, CBS_pair_20, The CBS domain, named after | 2e-14 | |
| cd04800 | 111 | cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This c | 3e-13 | |
| cd04624 | 112 | cd04624, CBS_pair_11, The CBS domain, named after | 2e-12 | |
| cd04585 | 122 | cd04585, CBS_pair_ACT_assoc2, This cd contains two | 4e-12 | |
| cd04636 | 132 | cd04636, CBS_pair_23, The CBS domain, named after | 4e-12 | |
| cd04607 | 113 | cd04607, CBS_pair_NTP_transferase_assoc, This cd c | 5e-12 | |
| cd04802 | 112 | cd04802, CBS_pair_3, The CBS domain, named after h | 5e-12 | |
| cd04803 | 122 | cd04803, CBS_pair_15, The CBS domain, named after | 8e-11 | |
| cd04604 | 114 | cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contain | 1e-10 | |
| cd04604 | 114 | cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contain | 1e-10 | |
| COG2905 | 610 | COG2905, COG2905, Predicted signal-transduction pr | 1e-10 | |
| cd04601 | 110 | cd04601, CBS_pair_IMPDH, This cd contains two tand | 7e-10 | |
| cd04637 | 122 | cd04637, CBS_pair_24, The CBS domain, named after | 1e-09 | |
| cd04589 | 111 | cd04589, CBS_pair_CAP-ED_DUF294_assoc_bac, This cd | 2e-09 | |
| cd04622 | 113 | cd04622, CBS_pair_9, The CBS domain, named after h | 3e-09 | |
| cd04600 | 124 | cd04600, CBS_pair_HPP_assoc, This cd contains two | 4e-09 | |
| cd04586 | 135 | cd04586, CBS_pair_BON_assoc, This cd contains two | 5e-09 | |
| pfam00571 | 57 | pfam00571, CBS, CBS domain | 6e-09 | |
| cd04584 | 121 | cd04584, CBS_pair_ACT_assoc, This cd contains two | 8e-09 | |
| cd04625 | 112 | cd04625, CBS_pair_12, The CBS domain, named after | 1e-08 | |
| cd04605 | 110 | cd04605, CBS_pair_MET2_assoc, This cd contains two | 1e-08 | |
| PTZ00314 | 495 | PTZ00314, PTZ00314, inosine-5'-monophosphate dehyd | 2e-08 | |
| COG2524 | 294 | COG2524, COG2524, Predicted transcriptional regula | 2e-08 | |
| cd04583 | 109 | cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contai | 3e-08 | |
| cd04620 | 115 | cd04620, CBS_pair_7, The CBS domain, named after h | 4e-08 | |
| cd04635 | 122 | cd04635, CBS_pair_22, The CBS domain, named after | 5e-08 | |
| cd04612 | 111 | cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd cont | 6e-08 | |
| cd04630 | 114 | cd04630, CBS_pair_17, The CBS domain, named after | 9e-08 | |
| TIGR01302 | 450 | TIGR01302, IMP_dehydrog, inosine-5'-monophosphate | 1e-07 | |
| cd04610 | 107 | cd04610, CBS_pair_ParBc_assoc, This cd contains tw | 1e-07 | |
| cd04607 | 113 | cd04607, CBS_pair_NTP_transferase_assoc, This cd c | 2e-07 | |
| COG2905 | 610 | COG2905, COG2905, Predicted signal-transduction pr | 2e-07 | |
| PRK05567 | 486 | PRK05567, PRK05567, inosine 5'-monophosphate dehyd | 2e-07 | |
| cd04624 | 112 | cd04624, CBS_pair_11, The CBS domain, named after | 3e-07 | |
| cd04631 | 125 | cd04631, CBS_pair_18, The CBS domain, named after | 3e-07 | |
| COG3448 | 382 | COG3448, COG3448, CBS-domain-containing membrane p | 4e-07 | |
| cd02205 | 113 | cd02205, CBS_pair, The CBS domain, named after hum | 8e-07 | |
| pfam00571 | 57 | pfam00571, CBS, CBS domain | 2e-06 | |
| cd04629 | 114 | cd04629, CBS_pair_16, The CBS domain, named after | 2e-06 | |
| cd04631 | 125 | cd04631, CBS_pair_18, The CBS domain, named after | 3e-06 | |
| cd04609 | 110 | cd04609, CBS_pair_PALP_assoc2, This cd contains tw | 3e-06 | |
| cd04641 | 120 | cd04641, CBS_pair_28, The CBS domain, named after | 3e-06 | |
| cd04606 | 109 | cd04606, CBS_pair_Mg_transporter, This cd contains | 3e-06 | |
| cd04596 | 108 | cd04596, CBS_pair_DRTGG_assoc, This cd contains tw | 7e-06 | |
| cd04630 | 114 | cd04630, CBS_pair_17, The CBS domain, named after | 8e-06 | |
| pfam00571 | 57 | pfam00571, CBS, CBS domain | 9e-06 | |
| pfam00478 | 467 | pfam00478, IMPDH, IMP dehydrogenase / GMP reductas | 9e-06 | |
| cd02205 | 113 | cd02205, CBS_pair, The CBS domain, named after hum | 1e-05 | |
| cd04637 | 122 | cd04637, CBS_pair_24, The CBS domain, named after | 1e-05 | |
| cd04602 | 114 | cd04602, CBS_pair_IMPDH_2, This cd contains two ta | 1e-05 | |
| TIGR00393 | 268 | TIGR00393, kpsF, KpsF/GutQ family protein | 1e-05 | |
| cd04638 | 106 | cd04638, CBS_pair_25, The CBS domain, named after | 2e-05 | |
| cd04588 | 110 | cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This c | 3e-05 | |
| cd04634 | 143 | cd04634, CBS_pair_21, The CBS domain, named after | 5e-05 | |
| PRK14869 | 546 | PRK14869, PRK14869, putative manganese-dependent i | 7e-05 | |
| cd04632 | 128 | cd04632, CBS_pair_19, The CBS domain, named after | 8e-05 | |
| cd04611 | 111 | cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd co | 2e-04 | |
| cd04633 | 121 | cd04633, CBS_pair_20, The CBS domain, named after | 2e-04 | |
| cd04629 | 114 | cd04629, CBS_pair_16, The CBS domain, named after | 2e-04 | |
| cd04615 | 113 | cd04615, CBS_pair_2, The CBS domain, named after h | 2e-04 | |
| cd04613 | 114 | cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd con | 2e-04 | |
| cd04633 | 121 | cd04633, CBS_pair_20, The CBS domain, named after | 3e-04 | |
| cd04585 | 122 | cd04585, CBS_pair_ACT_assoc2, This cd contains two | 3e-04 | |
| smart00116 | 49 | smart00116, CBS, Domain in cystathionine beta-synt | 3e-04 | |
| COG0517 | 117 | COG0517, COG0517, FOG: CBS domain [General functio | 4e-04 | |
| cd04605 | 110 | cd04605, CBS_pair_MET2_assoc, This cd contains two | 4e-04 | |
| cd04638 | 106 | cd04638, CBS_pair_25, The CBS domain, named after | 4e-04 | |
| cd02205 | 113 | cd02205, CBS_pair, The CBS domain, named after hum | 5e-04 | |
| cd04802 | 112 | cd04802, CBS_pair_3, The CBS domain, named after h | 5e-04 | |
| cd04584 | 121 | cd04584, CBS_pair_ACT_assoc, This cd contains two | 6e-04 | |
| smart00116 | 49 | smart00116, CBS, Domain in cystathionine beta-synt | 7e-04 | |
| cd04599 | 105 | cd04599, CBS_pair_GGDEF_assoc2, This cd contains t | 0.001 | |
| cd04599 | 105 | cd04599, CBS_pair_GGDEF_assoc2, This cd contains t | 0.001 | |
| cd04643 | 116 | cd04643, CBS_pair_30, The CBS domain, named after | 0.001 | |
| cd04595 | 110 | cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd con | 0.001 | |
| COG0517 | 117 | COG0517, COG0517, FOG: CBS domain [General functio | 0.002 | |
| COG0517 | 117 | COG0517, COG0517, FOG: CBS domain [General functio | 0.002 | |
| cd04612 | 111 | cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd cont | 0.002 | |
| cd04612 | 111 | cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd cont | 0.002 | |
| smart00116 | 49 | smart00116, CBS, Domain in cystathionine beta-synt | 0.002 | |
| COG2239 | 451 | COG2239, MgtE, Mg/Co/Ni transporter MgtE (contains | 0.002 | |
| COG2905 | 610 | COG2905, COG2905, Predicted signal-transduction pr | 0.003 | |
| cd04634 | 143 | cd04634, CBS_pair_21, The CBS domain, named after | 0.003 | |
| PRK07807 | 479 | PRK07807, PRK07807, inosine 5-monophosphate dehydr | 0.003 |
| >gnl|CDD|239960 cd04587, CBS_pair_CAP-ED_DUF294_PBI_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
Score = 163 bits (414), Expect = 3e-50
Identities = 65/113 (57%), Positives = 82/113 (72%)
Query: 129 SKVVTISPTDTVLMATKKMLELRLSSAVVTVENKPRGILTSKDILMRVISQNLPADSTLV 188
+K T+SPT TV A K M E R+S +V NK GI TSKDI +RV++Q L +STLV
Sbjct: 1 TKPATVSPTTTVQEAAKLMREKRVSCVLVMDGNKLVGIFTSKDIALRVVAQGLDPESTLV 60
Query: 189 EKVMTPNPECATIDTPIVDALHIMHDGKFLHLPVVDRDGDVVDVVDVIHITHA 241
E+VMTPNP CAT DTP+++ALH+M GKF HLPVVD+ G VV ++DV +THA
Sbjct: 61 ERVMTPNPVCATSDTPVLEALHLMVQGKFRHLPVVDKSGQVVGLLDVTKLTHA 113
|
Members of CAP_ED, include CAP which binds cAMP, FNR (fumarate and nitrate reductase) which uses an iron-sulfur cluster to sense oxygen, and CooA a heme containing CO sensor. In all cases binding of the effector leads to conformational changes and the ability to activate transcription. DUF294 is a putative nucleotidyltransferase with a conserved DxD motif. The PB1 domain adopts a beta-grasp fold, similar to that found in ubiquitin and Ras-binding domains. A motif, variously termed OPR, PC and AID, represents the most conserved region of the majority of PB1 domains, and is necessary for PB1 domain function. This function is the formation of PB1 domain heterodimers, although not all PB1 domain pairs associate. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Length = 113 |
| >gnl|CDD|239960 cd04587, CBS_pair_CAP-ED_DUF294_PBI_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >gnl|CDD|240113 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >gnl|CDD|239995 cd04623, CBS_pair_10, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239994 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|239995 cd04623, CBS_pair_10, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239984 cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >gnl|CDD|240004 cd04633, CBS_pair_20, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240113 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >gnl|CDD|239996 cd04624, CBS_pair_11, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239958 cd04585, CBS_pair_ACT_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|240007 cd04636, CBS_pair_23, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239980 cd04607, CBS_pair_NTP_transferase_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >gnl|CDD|240115 cd04802, CBS_pair_3, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240116 cd04803, CBS_pair_15, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239977 cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >gnl|CDD|239977 cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >gnl|CDD|225457 COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|239974 cd04601, CBS_pair_IMPDH, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >gnl|CDD|240008 cd04637, CBS_pair_24, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239962 cd04589, CBS_pair_CAP-ED_DUF294_assoc_bac, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >gnl|CDD|239994 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239973 cd04600, CBS_pair_HPP_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >gnl|CDD|239959 cd04586, CBS_pair_BON_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >gnl|CDD|201313 pfam00571, CBS, CBS domain | Back alignment and domain information |
|---|
| >gnl|CDD|239957 cd04584, CBS_pair_ACT_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|239997 cd04625, CBS_pair_12, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239978 cd04605, CBS_pair_MET2_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|240355 PTZ00314, PTZ00314, inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225321 COG2524, COG2524, Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|239956 cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >gnl|CDD|239992 cd04620, CBS_pair_7, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240006 cd04635, CBS_pair_22, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239985 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >gnl|CDD|240001 cd04630, CBS_pair_17, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233350 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|239983 cd04610, CBS_pair_ParBc_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >gnl|CDD|239980 cd04607, CBS_pair_NTP_transferase_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >gnl|CDD|225457 COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|235507 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|239996 cd04624, CBS_pair_11, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240002 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|225979 COG3448, COG3448, CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|201313 pfam00571, CBS, CBS domain | Back alignment and domain information |
|---|
| >gnl|CDD|240000 cd04629, CBS_pair_16, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240002 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239982 cd04609, CBS_pair_PALP_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >gnl|CDD|240012 cd04641, CBS_pair_28, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239979 cd04606, CBS_pair_Mg_transporter, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >gnl|CDD|239969 cd04596, CBS_pair_DRTGG_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >gnl|CDD|240001 cd04630, CBS_pair_17, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|201313 pfam00571, CBS, CBS domain | Back alignment and domain information |
|---|
| >gnl|CDD|215936 pfam00478, IMPDH, IMP dehydrogenase / GMP reductase domain | Back alignment and domain information |
|---|
| >gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240008 cd04637, CBS_pair_24, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239975 cd04602, CBS_pair_IMPDH_2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >gnl|CDD|129488 TIGR00393, kpsF, KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >gnl|CDD|240009 cd04638, CBS_pair_25, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239961 cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >gnl|CDD|240005 cd04634, CBS_pair_21, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|237843 PRK14869, PRK14869, putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240003 cd04632, CBS_pair_19, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239984 cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >gnl|CDD|240004 cd04633, CBS_pair_20, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240000 cd04629, CBS_pair_16, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239988 cd04615, CBS_pair_2, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239986 cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >gnl|CDD|240004 cd04633, CBS_pair_20, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239958 cd04585, CBS_pair_ACT_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|239978 cd04605, CBS_pair_MET2_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|240009 cd04638, CBS_pair_25, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240115 cd04802, CBS_pair_3, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239957 cd04584, CBS_pair_ACT_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239972 cd04599, CBS_pair_GGDEF_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >gnl|CDD|239972 cd04599, CBS_pair_GGDEF_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >gnl|CDD|240014 cd04643, CBS_pair_30, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239968 cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >gnl|CDD|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|239985 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >gnl|CDD|239985 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >gnl|CDD|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >gnl|CDD|225148 COG2239, MgtE, Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|225457 COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|240005 cd04634, CBS_pair_21, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|181127 PRK07807, PRK07807, inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 346 | |||
| PRK15094 | 292 | magnesium/cobalt efflux protein CorC; Provisional | 99.94 | |
| PRK11573 | 413 | hypothetical protein; Provisional | 99.93 | |
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 99.93 | |
| COG4535 | 293 | CorC Putative Mg2+ and Co2+ transporter CorC [Inor | 99.91 | |
| COG1253 | 429 | TlyC Hemolysins and related proteins containing CB | 99.91 | |
| COG4536 | 423 | CorB Putative Mg2+ and Co2+ transporter CorB [Inor | 99.86 | |
| COG2524 | 294 | Predicted transcriptional regulator, contains C-te | 99.83 | |
| COG2524 | 294 | Predicted transcriptional regulator, contains C-te | 99.82 | |
| PRK14869 | 546 | putative manganese-dependent inorganic pyrophospha | 99.77 | |
| COG3620 | 187 | Predicted transcriptional regulator with C-termina | 99.74 | |
| COG3448 | 382 | CBS-domain-containing membrane protein [Signal tra | 99.74 | |
| COG3448 | 382 | CBS-domain-containing membrane protein [Signal tra | 99.71 | |
| COG3620 | 187 | Predicted transcriptional regulator with C-termina | 99.68 | |
| cd04619 | 114 | CBS_pair_6 The CBS domain, named after human CBS, | 99.68 | |
| cd04630 | 114 | CBS_pair_17 The CBS domain, named after human CBS, | 99.67 | |
| cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem re | 99.67 | |
| cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, | 99.66 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 99.66 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 99.66 | |
| cd04618 | 98 | CBS_pair_5 The CBS domain, named after human CBS, | 99.66 | |
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 99.65 | |
| PRK15094 | 292 | magnesium/cobalt efflux protein CorC; Provisional | 99.65 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 99.64 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 99.64 | |
| TIGR00400 | 449 | mgtE Mg2+ transporter (mgtE). This family of proka | 99.64 | |
| cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, | 99.64 | |
| cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two | 99.64 | |
| cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem re | 99.64 | |
| cd04587 | 113 | CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains | 99.63 | |
| cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, | 99.63 | |
| cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem rep | 99.62 | |
| cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains tw | 99.62 | |
| KOG1764 | 381 | consensus 5'-AMP-activated protein kinase, gamma s | 99.62 | |
| cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, | 99.62 | |
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 99.62 | |
| cd04622 | 113 | CBS_pair_9 The CBS domain, named after human CBS, | 99.62 | |
| cd04611 | 111 | CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two | 99.61 | |
| cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, | 99.61 | |
| cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two | 99.6 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 99.6 | |
| cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, | 99.6 | |
| cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains | 99.6 | |
| cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, | 99.6 | |
| cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem re | 99.6 | |
| cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, | 99.6 | |
| cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, | 99.6 | |
| cd04618 | 98 | CBS_pair_5 The CBS domain, named after human CBS, | 99.6 | |
| cd04627 | 123 | CBS_pair_14 The CBS domain, named after human CBS, | 99.59 | |
| cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, | 99.59 | |
| cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tand | 99.59 | |
| cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains | 99.59 | |
| cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, | 99.58 | |
| cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, | 99.58 | |
| cd04589 | 111 | CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains | 99.58 | |
| cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two | 99.58 | |
| cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repe | 99.58 | |
| cd04625 | 112 | CBS_pair_12 The CBS domain, named after human CBS, | 99.58 | |
| cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tand | 99.58 | |
| cd04802 | 112 | CBS_pair_3 The CBS domain, named after human CBS, | 99.58 | |
| cd04626 | 111 | CBS_pair_13 The CBS domain, named after human CBS, | 99.57 | |
| cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, | 99.57 | |
| cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan | 99.57 | |
| cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tand | 99.57 | |
| cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem r | 99.57 | |
| cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, | 99.57 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 99.56 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 99.56 | |
| KOG1764 | 381 | consensus 5'-AMP-activated protein kinase, gamma s | 99.56 | |
| cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two t | 99.56 | |
| cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, | 99.56 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 99.56 | |
| cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, | 99.56 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 99.56 | |
| cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem r | 99.56 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 99.55 | |
| cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem re | 99.55 | |
| cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem re | 99.55 | |
| cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, | 99.55 | |
| cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem rep | 99.55 | |
| cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, | 99.55 | |
| cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, | 99.54 | |
| cd04637 | 122 | CBS_pair_24 The CBS domain, named after human CBS, | 99.53 | |
| cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem r | 99.53 | |
| cd04599 | 105 | CBS_pair_GGDEF_assoc2 This cd contains two tandem | 99.53 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 99.53 | |
| cd04619 | 114 | CBS_pair_6 The CBS domain, named after human CBS, | 99.53 | |
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 99.53 | |
| cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repea | 99.52 | |
| cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, | 99.52 | |
| PRK01862 | 574 | putative voltage-gated ClC-type chloride channel C | 99.52 | |
| cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats | 99.51 | |
| cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repe | 99.51 | |
| cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, | 99.51 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 99.51 | |
| COG0517 | 117 | FOG: CBS domain [General function prediction only] | 99.51 | |
| cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, | 99.5 | |
| cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is | 99.5 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 99.49 | |
| cd04606 | 109 | CBS_pair_Mg_transporter This cd contains two tande | 99.49 | |
| cd04594 | 104 | CBS_pair_EriC_assoc_archaea This cd contains two t | 99.49 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 99.49 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 99.49 | |
| cd04630 | 114 | CBS_pair_17 The CBS domain, named after human CBS, | 99.48 | |
| cd04599 | 105 | CBS_pair_GGDEF_assoc2 This cd contains two tandem | 99.48 | |
| TIGR00400 | 449 | mgtE Mg2+ transporter (mgtE). This family of proka | 99.47 | |
| cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two | 99.47 | |
| cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, | 99.47 | |
| cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem rep | 99.47 | |
| cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, | 99.46 | |
| cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains tw | 99.46 | |
| cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tand | 99.46 | |
| cd04626 | 111 | CBS_pair_13 The CBS domain, named after human CBS, | 99.46 | |
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 99.46 | |
| cd04591 | 105 | CBS_pair_EriC_assoc_euk_bac This cd contains two t | 99.46 | |
| cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, | 99.46 | |
| cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, | 99.45 | |
| cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem rep | 99.45 | |
| cd04625 | 112 | CBS_pair_12 The CBS domain, named after human CBS, | 99.44 | |
| cd04627 | 123 | CBS_pair_14 The CBS domain, named after human CBS, | 99.44 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 99.44 | |
| cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem r | 99.44 | |
| cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, | 99.44 | |
| cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem rep | 99.44 | |
| cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains | 99.44 | |
| cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two | 99.43 | |
| cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, | 99.43 | |
| PRK01862 | 574 | putative voltage-gated ClC-type chloride channel C | 99.43 | |
| cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains | 99.43 | |
| cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem re | 99.43 | |
| cd04802 | 112 | CBS_pair_3 The CBS domain, named after human CBS, | 99.43 | |
| cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, | 99.42 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 99.42 | |
| cd04594 | 104 | CBS_pair_EriC_assoc_archaea This cd contains two t | 99.42 | |
| cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan | 99.42 | |
| cd04589 | 111 | CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains | 99.42 | |
| cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, | 99.42 | |
| cd04611 | 111 | CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two | 99.42 | |
| PRK11573 | 413 | hypothetical protein; Provisional | 99.41 | |
| cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, | 99.41 | |
| cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem r | 99.41 | |
| cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem re | 99.41 | |
| cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tand | 99.41 | |
| cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, | 99.41 | |
| cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two | 99.41 | |
| cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, | 99.4 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 99.4 | |
| cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, | 99.4 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 99.4 | |
| cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two t | 99.4 | |
| cd04587 | 113 | CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains | 99.4 | |
| cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, | 99.39 | |
| cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem re | 99.39 | |
| cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, | 99.39 | |
| cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem r | 99.39 | |
| cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, | 99.39 | |
| cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, | 99.39 | |
| COG0517 | 117 | FOG: CBS domain [General function prediction only] | 99.39 | |
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 99.38 | |
| cd04622 | 113 | CBS_pair_9 The CBS domain, named after human CBS, | 99.38 | |
| cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, | 99.38 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 99.38 | |
| cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tand | 99.37 | |
| cd04637 | 122 | CBS_pair_24 The CBS domain, named after human CBS, | 99.37 | |
| cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, | 99.36 | |
| cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, | 99.36 | |
| cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repea | 99.36 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 99.35 | |
| cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem rep | 99.35 | |
| cd04606 | 109 | CBS_pair_Mg_transporter This cd contains two tande | 99.34 | |
| cd04591 | 105 | CBS_pair_EriC_assoc_euk_bac This cd contains two t | 99.33 | |
| COG1253 | 429 | TlyC Hemolysins and related proteins containing CB | 99.32 | |
| cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats | 99.32 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 99.32 | |
| cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, | 99.3 | |
| cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tande | 99.29 | |
| cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem r | 99.28 | |
| cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is | 99.25 | |
| cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem r | 99.25 | |
| COG4536 | 423 | CorB Putative Mg2+ and Co2+ transporter CorB [Inor | 99.2 | |
| PF00571 | 57 | CBS: CBS domain CBS domain web page. Mutations in | 99.2 | |
| KOG2550 | 503 | consensus IMP dehydrogenase/GMP reductase [Nucleot | 99.18 | |
| cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tande | 99.17 | |
| COG2239 | 451 | MgtE Mg/Co/Ni transporter MgtE (contains CBS domai | 99.17 | |
| PF00571 | 57 | CBS: CBS domain CBS domain web page. Mutations in | 99.13 | |
| COG2239 | 451 | MgtE Mg/Co/Ni transporter MgtE (contains CBS domai | 99.12 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 99.02 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 98.94 | |
| COG4535 | 293 | CorC Putative Mg2+ and Co2+ transporter CorC [Inor | 98.87 | |
| KOG0474 | 762 | consensus Cl- channel CLC-7 and related proteins ( | 98.72 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 98.69 | |
| KOG0474 | 762 | consensus Cl- channel CLC-7 and related proteins ( | 98.68 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 98.57 | |
| KOG2550 | 503 | consensus IMP dehydrogenase/GMP reductase [Nucleot | 98.52 | |
| cd04597 | 113 | CBS_pair_DRTGG_assoc2 This cd contains two tandem | 98.48 | |
| PRK14869 | 546 | putative manganese-dependent inorganic pyrophospha | 98.46 | |
| cd04597 | 113 | CBS_pair_DRTGG_assoc2 This cd contains two tandem | 98.35 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 98.27 | |
| smart00116 | 49 | CBS Domain in cystathionine beta-synthase and othe | 98.06 | |
| KOG0475 | 696 | consensus Cl- channel CLC-3 and related proteins ( | 98.02 | |
| KOG0475 | 696 | consensus Cl- channel CLC-3 and related proteins ( | 98.02 | |
| smart00116 | 49 | CBS Domain in cystathionine beta-synthase and othe | 97.89 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 97.68 | |
| KOG0476 | 931 | consensus Cl- channel CLC-2 and related proteins ( | 97.48 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 97.35 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 97.32 | |
| KOG2118 | 498 | consensus Predicted membrane protein, contains two | 97.0 | |
| PF03471 | 81 | CorC_HlyC: Transporter associated domain; InterPro | 96.68 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 96.63 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 95.43 | |
| cd06409 | 86 | PB1_MUG70 The MUG70 protein is a product of the me | 95.23 | |
| KOG0476 | 931 | consensus Cl- channel CLC-2 and related proteins ( | 89.4 | |
| KOG2118 | 498 | consensus Predicted membrane protein, contains two | 86.51 |
| >PRK15094 magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
Probab=99.94 E-value=2.2e-26 Score=204.63 Aligned_cols=196 Identities=15% Similarity=0.182 Sum_probs=163.1
Q ss_pred hCCCCccccccCCCceeEeCCCCcHHHHHHHHHHcCCcEEEEEe-C-CEEEEEeeHHHHHHHHHhcCCCccccccccccc
Q 019128 116 MFRPSLSTIIPEKSKVVTISPTDTVLMATKKMLELRLSSAVVTV-E-NKPRGILTSKDILMRVISQNLPADSTLVEKVMT 193 (346)
Q Consensus 116 ~~~~~v~~im~~~~~~~~v~~~~~l~~~~~~m~~~~~~~l~V~d-~-~~~~Giit~~dll~~~~~~~~~~~~~~v~~~m~ 193 (346)
+...+++++|+|+.++++++++.++.++++.+.+++++++||++ + ++++|+++.+|++ ........ ...+.++|
T Consensus 64 l~~~~V~diMtpr~~i~~l~~~~sl~e~~~~i~~~~~sr~PV~~~~~d~iiGiv~~kDll-~~~~~~~~--~~~l~~l~- 139 (292)
T PRK15094 64 IADQRVRDIMIPRSQMITLKRNQTLDECLDVIIESAHSRFPVISEDKDHIEGILMAKDLL-PFMRSDAE--AFSMDKVL- 139 (292)
T ss_pred cCCCEEeEEccchHHEEEEeCCCCHHHHHHHHHhcCCcEEEEecCCCCcEEEEEEHHHHH-hHhhccCC--cCCHHHHc-
Confidence 45678999999988999999999999999999999999999998 4 7899999999997 44332211 23578888
Q ss_pred cCCeeecCCCCHHHHHHHhHhCCCceeEEEcCCCcEEEEEehHHHHHHHHHHccCCCCCchH-HHHH-----------HH
Q 019128 194 PNPECATIDTPIVDALHIMHDGKFLHLPVVDRDGDVVDVVDVIHITHAAVATVGNTAGSNNE-AAST-----------MM 261 (346)
Q Consensus 194 ~~~~~v~~~~~l~~~~~~m~~~~~~~~~Vvd~~g~~~Giit~~Di~~~~~~~i~~~~~~~~~-~~~~-----------~~ 261 (346)
++++++++++++.++++.|.+++.+.+||+|++|.++|+||.+||+++++|.+.++.+...+ .... +.
T Consensus 140 r~~~~V~e~~~l~~~L~~m~~~~~~~a~VvDe~G~viGiVTleDIle~ivGei~de~d~~~~~~i~~~~~~~~~v~G~~~ 219 (292)
T PRK15094 140 RQAVVVPESKRVDRMLKEFRSQRYHMAIVIDEFGGVSGLVTIEDILELIVGEIEDEYDEEDDIDFRQLSRHTWTVRALAS 219 (292)
T ss_pred CCCcCcCCCCcHHHHHHHHHhcCCEEEEEEeCCCCEEEEeEHHHHHHHHhCCCccccccccccccEEeCCCeEEEEeccC
Confidence 56679999999999999999999999999999999999999999999999999887763321 1111 11
Q ss_pred HHHHHHhhcCCCCCCccccccccccccccCCCCCcccccCCCCCCCCCCceeEEEecCCCCe
Q 019128 262 QKFWDSAMALSPNDDEEDNRSEGSLKFASEGADTARYLSYPSPSPGVPSAFAFKVQDNKGLM 323 (346)
Q Consensus 262 ~~~~~~~~~~~~~~~~~~T~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~V~d~~g~~ 323 (346)
-.-.++.+.+..++++|+|++|++...++++|+.|+.+.+.++. |+|.+++|+-
T Consensus 220 l~dl~~~l~~~l~~~~~~Tl~G~i~~~l~~iP~~Gd~i~~~~~~--------f~V~~~~~~r 273 (292)
T PRK15094 220 IEDFNEAFGTHFSDEEVDTIGGLVMQAFGHLPARGETIDIDGYQ--------FKVAMADSRR 273 (292)
T ss_pred HHHHHHHhCCCCCCCCCccHHHHHHHHhCcCCCCCCEEEECCEE--------EEEEEccCCe
Confidence 22235556666676789999999999999999999999999999 9999998654
|
|
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism | Back alignment and domain information |
|---|
| >cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >PRK15094 magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR00400 mgtE Mg2+ transporter (mgtE) | Back alignment and domain information |
|---|
| >cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism | Back alignment and domain information |
|---|
| >cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >COG0517 FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >TIGR00400 mgtE Mg2+ transporter (mgtE) | Back alignment and domain information |
|---|
| >cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea | Back alignment and domain information |
|---|
| >cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG0517 FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
|---|
| >cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00571 CBS: CBS domain CBS domain web page | Back alignment and domain information |
|---|
| >KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
|---|
| >COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00571 CBS: CBS domain CBS domain web page | Back alignment and domain information |
|---|
| >COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >smart00116 CBS Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >smart00116 CBS Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >KOG2118 consensus Predicted membrane protein, contains two CBS domains [Function unknown] | Back alignment and domain information |
|---|
| >PF03471 CorC_HlyC: Transporter associated domain; InterPro: IPR005170 This small domain is found in a family of proteins with the CBS IPR002550 from INTERPRO domain and two CBS domains with this domain found at the C terminus of the proteins, the domain is also found at the C terminus of some Na+/H+ antiporters | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain | Back alignment and domain information |
|---|
| >KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2118 consensus Predicted membrane protein, contains two CBS domains [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 346 | ||||
| 2rc3_A | 135 | Crystal Structure Of Cbs Domain, Ne2398 Length = 13 | 2e-04 | ||
| 4fry_A | 157 | The Structure Of A Putative Signal-Transduction Pro | 3e-04 |
| >pdb|2RC3|A Chain A, Crystal Structure Of Cbs Domain, Ne2398 Length = 135 | Back alignment and structure |
|
| >pdb|4FRY|A Chain A, The Structure Of A Putative Signal-Transduction Protein With Cbs Domains From Burkholderia Ambifaria Mc40-6 Length = 157 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 346 | |||
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 6e-29 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 5e-25 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 1e-05 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 9e-29 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 6e-21 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 1e-08 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 1e-27 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 2e-19 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 7e-10 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 3e-27 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 4e-21 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 8e-11 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 9e-05 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 5e-27 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 2e-24 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 1e-07 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 7e-26 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 7e-12 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 4e-11 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 8e-05 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 1e-25 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 2e-12 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 1e-08 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 2e-06 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 2e-25 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 2e-24 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 5e-14 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 2e-04 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 7e-25 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 8e-15 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 7e-10 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 3e-06 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 3e-23 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 6e-13 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 1e-11 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 1e-04 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 7e-22 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 1e-09 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 1e-07 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 6e-04 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 1e-21 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 7e-05 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 2e-04 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 4e-21 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 2e-09 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 1e-06 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 7e-21 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 6e-06 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 1e-04 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 1e-20 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 9e-06 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 1e-20 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 4e-05 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 4e-05 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 4e-20 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 7e-10 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 3e-07 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 1e-06 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 7e-20 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 4e-05 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 6e-05 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 1e-04 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 2e-18 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 8e-15 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 2e-13 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 3e-08 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 2e-18 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 1e-09 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 2e-08 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 4e-08 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 2e-17 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 4e-09 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 5e-07 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 2e-04 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 4e-17 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 5e-10 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 1e-08 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 1e-07 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 4e-17 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 4e-10 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 2e-06 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 7e-17 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 9e-11 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 2e-07 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 7e-17 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 3e-16 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 2e-13 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 1e-09 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 3e-16 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 1e-07 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 5e-06 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 3e-04 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 6e-16 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 6e-08 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 5e-07 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 5e-05 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 3e-15 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 2e-06 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 4e-15 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 1e-12 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 2e-12 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 9e-12 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 8e-09 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 1e-04 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 2e-12 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 4e-06 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 4e-06 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 4e-11 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 2e-10 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 5e-11 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 1e-06 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 3e-09 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 8e-09 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 3e-08 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 6e-08 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 2e-07 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 7e-07 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 7e-07 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 9e-07 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 1e-06 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 2e-06 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 2e-06 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 2e-06 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 6e-06 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 1e-04 | |
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 3e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-04 |
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Length = 165 | Back alignment and structure |
|---|
Score = 108 bits (272), Expect = 6e-29
Identities = 31/148 (20%), Positives = 64/148 (43%), Gaps = 7/148 (4%)
Query: 103 SGPNTFIETLRERMFRPSLSTIIPE-----KSKVVTISPTDTVLMATKKMLELRLSSAVV 157
S + + RE ++ ++T + + VVT+ P ++ A + ++ + VV
Sbjct: 4 SHHHHHHSSGRENLYFQGMATFVKDLLDRKGRDVVTVGPDVSIGEAAGTLHAHKIGAVVV 63
Query: 158 T-VENKPRGILTSKDILMRVISQNLPADSTLVEKVMTPNPECATIDTPIVDALHIMHDGK 216
T + GI T +D++ V Q + V MT N ++ + IM G+
Sbjct: 64 TDADGVVLGIFTERDLVKAVAGQGAASLQQSVSVAMTKNVVRCQHNSTTDQLMEIMTGGR 123
Query: 217 FLHLPVVDRDGDVVDVVDVIHITHAAVA 244
F H+PV + +G + ++ + + A +
Sbjct: 124 FRHVPVEE-NGRLAGIISIGDVVKARIG 150
|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Length = 165 | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Length = 165 | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Length = 135 | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Length = 135 | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Length = 135 | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Length = 157 | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Length = 157 | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Length = 157 | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Length = 138 | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Length = 138 | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Length = 138 | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Length = 138 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Length = 133 | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Length = 133 | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Length = 133 | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Length = 133 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Length = 125 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Length = 125 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Length = 125 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Length = 125 | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Length = 141 | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Length = 141 | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Length = 141 | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Length = 141 | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Length = 159 | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Length = 159 | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Length = 159 | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Length = 138 | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Length = 138 | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Length = 138 | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Length = 138 | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} PDB: 3kpd_A* 3kpc_A* Length = 122 | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} PDB: 3kpd_A* 3kpc_A* Length = 122 | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} PDB: 3kpd_A* 3kpc_A* Length = 122 | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} PDB: 3kpd_A* 3kpc_A* Length = 122 | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Length = 160 | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Length = 160 | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Length = 160 | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Length = 160 | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Length = 180 | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Length = 180 | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Length = 180 | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Length = 157 | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Length = 157 | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Length = 157 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Length = 213 | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Length = 213 | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Length = 213 | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Length = 213 | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Length = 128 | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Length = 128 | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Length = 149 | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Length = 149 | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Length = 245 | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Length = 245 | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Length = 486 | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Length = 503 | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Length = 496 | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Length = 494 | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Length = 514 | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A Length = 473 | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Length = 527 | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Length = 286 | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Length = 491 | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Length = 205 | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A Length = 278 | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Length = 511 | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Length = 185 | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Length = 185 | Back alignment and structure |
|---|
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Length = 632 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 346 | |||
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 99.97 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 99.96 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 99.95 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 99.95 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 99.95 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 99.95 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 99.94 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 99.94 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 99.93 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 99.93 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 99.92 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 99.92 | |
| 3k6e_A | 156 | CBS domain protein; streptococcus pneumoniae TIGR4 | 99.88 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 99.87 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 99.87 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 99.87 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 99.87 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 99.86 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 99.86 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 99.86 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 99.85 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 99.85 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 99.85 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 99.84 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 99.83 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 99.83 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 99.82 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 99.82 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 99.82 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 99.82 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 99.82 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 99.81 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 99.81 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 99.81 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 99.81 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 99.81 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 99.81 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 99.81 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 99.81 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 99.8 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 99.8 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 99.8 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 99.8 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 99.8 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 99.8 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 99.79 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 99.79 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 99.79 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 99.79 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 99.79 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 99.79 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 99.78 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 99.78 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 99.78 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 99.78 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 99.78 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 99.78 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 99.77 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 99.77 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 99.77 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 99.77 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 99.77 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 99.77 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 99.77 | |
| 3k6e_A | 156 | CBS domain protein; streptococcus pneumoniae TIGR4 | 99.77 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 99.76 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 99.76 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 99.76 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 99.76 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 99.76 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 99.76 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 99.75 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 99.75 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 99.75 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 99.75 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 99.75 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 99.75 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 99.74 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 99.74 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 99.74 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 99.73 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 99.73 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 99.73 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 99.72 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 99.72 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 99.72 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 99.72 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 99.71 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 99.71 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 99.71 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 99.71 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 99.7 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 99.7 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 99.7 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 99.69 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 99.68 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 99.68 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 99.66 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 99.66 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 99.64 | |
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 99.63 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 99.63 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 99.6 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 99.59 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 99.58 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 99.57 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 99.56 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 99.55 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 99.54 | |
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 99.53 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 99.5 | |
| 3ghd_A | 70 | A cystathionine beta-synthase domain protein FUSE | 99.49 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 99.48 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 99.48 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 99.44 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 99.43 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 99.42 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 99.41 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 99.37 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 99.35 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 99.31 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 99.28 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 99.28 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 99.24 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 99.13 | |
| 3ghd_A | 70 | A cystathionine beta-synthase domain protein FUSE | 99.13 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 98.97 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 98.61 | |
| 2pli_A | 91 | Uncharacterized protein; CORC-associated region, M | 97.66 | |
| 3llb_A | 83 | Uncharacterized protein; protein PA3983, unknown f | 97.62 | |
| 3lae_A | 81 | UPF0053 protein HI0107; APC85784.2, conserved prot | 97.58 | |
| 2pls_A | 86 | CBS domain protein; APC86064.2, CORC/HLYC transpor | 97.52 | |
| 2r2z_A | 93 | Hemolysin; APC85144, enterococcus faecalis V583, S | 97.49 | |
| 2oai_A | 94 | Hemolysin; PFAM03471, xylella fastidiosa temecula1 | 97.48 | |
| 2p13_A | 90 | CBS domain; alpha-beta structure, structural genom | 97.46 | |
| 2o3g_A | 92 | Putative protein; APC85631.1, neisseria meningitid | 97.45 | |
| 2p3h_A | 101 | Uncharacterized CBS domain-containing protein; str | 97.43 | |
| 2p4p_A | 86 | Hypothetical protein HD1797; CORC_HLYC, PFAM: PF03 | 97.42 | |
| 2rk5_A | 87 | Putative hemolysin; structural genomics, PSI-2, MC | 97.36 | |
| 2nqw_A | 93 | CBS domain protein; PFAM03471, hemolysins, CBS dom | 97.31 | |
| 3ded_A | 113 | Probable hemolysin; structural genomics, P protein | 97.13 |
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
Probab=99.97 E-value=1.4e-30 Score=233.50 Aligned_cols=200 Identities=20% Similarity=0.262 Sum_probs=168.5
Q ss_pred hcCCCCcccccccccCCCeeecCCccHHHHHHHHHhCCcceeeeeeCCeEEEEEehHHHHHHHHHHHHHHHhhhhhHhhh
Q 019128 11 RELNLEETPVSKVMTRNPTFVLSDTLAVEALQKMVQGKFRHLPVVENGEVIALLDIAKCLYDAIARMERAAEKGKAIAAA 90 (346)
Q Consensus 11 ~~~~~~~~~v~dim~~~~i~v~~~~~l~ea~~~m~~~~~~~lpVvd~~~~vGivt~~dll~~~~~~~~~~~~~~~~~~~~ 90 (346)
.+.+....+|+|+|+++++++++++|+.+|++.|.+++++++||+| |+++|++|..|+++.+....
T Consensus 13 ~~~~~~~~~V~dim~~~~~~v~~~~~v~~a~~~m~~~~~~~~~V~d-~~l~GivT~~Di~~~~~~~~------------- 78 (296)
T 3ddj_A 13 ENLYFQGMNIETLMIKNPPILSKEDRLGSAFKKINEGGIGRIIVAN-EKIEGLLTTRDLLSTVESYC------------- 78 (296)
T ss_dssp -CCTTCCSSGGGTCEESCCEECTTSBHHHHHHHTTGGGCCEEEEES-SSEEEEEEHHHHHGGGTTCC-------------
T ss_pred hhhhhcccCHHHhccCCCcEECCCccHHHHHHHHHHCCCceEEEEC-CeEEEEEeHHHHHHHhcccc-------------
Confidence 4557788999999999999999999999999999999999999999 99999999999987532100
Q ss_pred hhhhhhccCCCCCChhhHHHHHHHHhCCCCccccccCCCceeEeCCCCcHHHHHHHHHHcCCcEEEEEe-CCEEEEEeeH
Q 019128 91 VEGVEKHWGTSISGPNTFIETLRERMFRPSLSTIIPEKSKVVTISPTDTVLMATKKMLELRLSSAVVTV-ENKPRGILTS 169 (346)
Q Consensus 91 ~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~v~~im~~~~~~~~v~~~~~l~~~~~~m~~~~~~~l~V~d-~~~~~Giit~ 169 (346)
. ...+...+.. ....+++++|.+ +++++.+++++.++++.|.+++++++||+| +|+++|++|.
T Consensus 79 ------------~-~~~~~~~~~~-~~~~~v~~im~~--~~~~v~~~~~~~~a~~~m~~~~~~~lpVvd~~~~lvGivt~ 142 (296)
T 3ddj_A 79 ------------K-DSCSQGDLYH-ISTTPIIDYMTP--NPVTVYNTSDEFTAINIMVTRNFGSLPVVDINDKPVGIVTE 142 (296)
T ss_dssp ----------------CCHHHHHH-HHTSBGGGTSEE--SCCCEETTSCHHHHHHHHHHHTCSEEEEECTTSCEEEEEEH
T ss_pred ------------c-ccccchhhHH-HhcccHHHhccC--CCEEEcCCCCHHHHHHHHHHcCCCEEEEEcCCCcEEEEEeH
Confidence 0 0011112211 224679999985 788999999999999999999999999998 7899999999
Q ss_pred HHHHHHHHhcCCCccccccccccccCCeeecCCCCHHHHHHHhHhCCCceeEEEcCCCcEEEEEehHHHHHHHH
Q 019128 170 KDILMRVISQNLPADSTLVEKVMTPNPECATIDTPIVDALHIMHDGKFLHLPVVDRDGDVVDVVDVIHITHAAV 243 (346)
Q Consensus 170 ~dll~~~~~~~~~~~~~~v~~~m~~~~~~v~~~~~l~~~~~~m~~~~~~~~~Vvd~~g~~~Giit~~Di~~~~~ 243 (346)
+|++ +.+..... ..++.++|.+++.++++++++.++++.|.+++++++||+|++|+++|+||..|+++++.
T Consensus 143 ~dl~-~~~~~~~~--~~~v~~~m~~~~~~v~~~~~l~~~~~~m~~~~~~~~~Vvd~~~~~~Givt~~dl~~~~~ 213 (296)
T 3ddj_A 143 REFL-LLYKDLDE--IFPVKVFMSTKVQTIYKEVRLDQAVKLMLRRGFRRLPVIDDDNKVVGIVTVVNAIKQLA 213 (296)
T ss_dssp HHHG-GGGGGSCC--CCBHHHHSBCSCCCEETTSBHHHHHHHHHHHTCSEEEEECTTSCEEEEEEHHHHHHHHH
T ss_pred HHHH-Hhhhcccc--cccHHHhhcCCCeEECCCCCHHHHHHHHHHcCCCEEEEEcCCCEEEEEEEHHHHHHHHH
Confidence 9997 54443322 45899999999999999999999999999999999999999999999999999998754
|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* | Back alignment and structure |
|---|
| >3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A | Back alignment and structure |
|---|
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >2pli_A Uncharacterized protein; CORC-associated region, MCSG, PSI2, structural genomics, Pro structure initiative; 1.70A {Neisseria meningitidis} SCOP: d.145.1.4 | Back alignment and structure |
|---|
| >3llb_A Uncharacterized protein; protein PA3983, unknown function, structural genomics, PSI2, MCSG, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: d.145.1.0 | Back alignment and structure |
|---|
| >3lae_A UPF0053 protein HI0107; APC85784.2, conserved protein, haemophilus influenzae RD KW20, structural genomics, PSI-2; HET: MSE; 1.45A {Haemophilus influenzae} SCOP: d.145.1.4 PDB: 2o1r_A* | Back alignment and structure |
|---|
| >2pls_A CBS domain protein; APC86064.2, CORC/HLYC transporter associated domain, CBS DOM protein, structural genomics, PSI-2 structure initiative; 2.15A {Chlorobium tepidum tls} SCOP: d.145.1.4 | Back alignment and structure |
|---|
| >2r2z_A Hemolysin; APC85144, enterococcus faecalis V583, STRU initiative, midwest center for structural genomics, MCSG; 1.20A {Enterococcus faecalis} SCOP: d.145.1.4 | Back alignment and structure |
|---|
| >2oai_A Hemolysin; PFAM03471, xylella fastidiosa temecula1, structur genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; HET: MLY; 1.80A {Xylella fastidiosa} SCOP: d.145.1.4 PDB: 2r8d_A* | Back alignment and structure |
|---|
| >2p13_A CBS domain; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; 1.65A {Nitrosomonas europaea} SCOP: d.145.1.4 | Back alignment and structure |
|---|
| >2o3g_A Putative protein; APC85631.1, neisseria meningitid structural genomics, PSI-2, protein structure initiative; 2.55A {Neisseria meningitidis} SCOP: d.145.1.4 | Back alignment and structure |
|---|
| >2p3h_A Uncharacterized CBS domain-containing protein; structural genomics, CORC_HLYC, PFAM03471, putative transpor protein; 1.80A {Corynebacterium glutamicum} SCOP: d.145.1.4 | Back alignment and structure |
|---|
| >2p4p_A Hypothetical protein HD1797; CORC_HLYC, PFAM: PF03471, structural GE PSI-2, protein structure initiative, midwest center for STR genomics; HET: MLY MSE; 1.80A {Haemophilus ducreyi} SCOP: d.145.1.4 | Back alignment and structure |
|---|
| >2rk5_A Putative hemolysin; structural genomics, PSI-2, MCSG, protein structure initiative, midwest center for structural genomics, membrane; 1.50A {Streptococcus mutans UA159} SCOP: d.145.1.4 | Back alignment and structure |
|---|
| >2nqw_A CBS domain protein; PFAM03471, hemolysins, CBS domains, transporter associated D CORC_HLYC, structural genomics, PSI-2; 1.30A {Porphyromonas gingivalis} SCOP: d.145.1.4 | Back alignment and structure |
|---|
| >3ded_A Probable hemolysin; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG, membrane; HET: MSE; 2.14A {Chromobacterium violaceum} SCOP: d.145.1.4 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 346 | ||||
| d2rc3a1 | 127 | d.37.1.1 (A:23-149) Uncharacterized protein NE2398 | 6e-15 | |
| d2rc3a1 | 127 | d.37.1.1 (A:23-149) Uncharacterized protein NE2398 | 5e-06 | |
| d2rc3a1 | 127 | d.37.1.1 (A:23-149) Uncharacterized protein NE2398 | 4e-04 | |
| d2v8qe1 | 145 | d.37.1.1 (E:182-326) 5'-AMP-activated protein kina | 9e-12 | |
| d2v8qe1 | 145 | d.37.1.1 (E:182-326) 5'-AMP-activated protein kina | 0.001 | |
| d1jr1a4 | 120 | d.37.1.1 (A:113-232) Type II inosine monophosphate | 4e-11 | |
| d1jr1a4 | 120 | d.37.1.1 (A:113-232) Type II inosine monophosphate | 0.001 | |
| d2d4za3 | 160 | d.37.1.1 (A:527-606,A:691-770) Chloride channel pr | 2e-10 | |
| d2d4za3 | 160 | d.37.1.1 (A:527-606,A:691-770) Chloride channel pr | 5e-05 | |
| d2yzia1 | 132 | d.37.1.1 (A:4-135) Uncharacterized protein PH0107 | 7e-10 | |
| d2yzia1 | 132 | d.37.1.1 (A:4-135) Uncharacterized protein PH0107 | 6e-06 | |
| d2yzia1 | 132 | d.37.1.1 (A:4-135) Uncharacterized protein PH0107 | 2e-04 | |
| d2yzia1 | 132 | d.37.1.1 (A:4-135) Uncharacterized protein PH0107 | 0.004 | |
| d2v8qe2 | 159 | d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas | 1e-09 | |
| d2v8qe2 | 159 | d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas | 2e-04 | |
| d2v8qe2 | 159 | d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas | 0.001 | |
| d2nyca1 | 140 | d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's | 1e-09 | |
| d2nyca1 | 140 | d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's | 1e-07 | |
| d2nyca1 | 140 | d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's | 4e-05 | |
| d2yzqa1 | 156 | d.37.1.1 (A:123-278) Uncharacterized protein PH178 | 3e-09 | |
| d2yzqa1 | 156 | d.37.1.1 (A:123-278) Uncharacterized protein PH178 | 1e-06 | |
| d2yzqa1 | 156 | d.37.1.1 (A:123-278) Uncharacterized protein PH178 | 2e-06 | |
| d1pvma4 | 142 | d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Ar | 4e-09 | |
| d1pvma4 | 142 | d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Ar | 0.003 | |
| d2ef7a1 | 127 | d.37.1.1 (A:1-127) Uncharacterized protein ST2348 | 8e-09 | |
| d2ef7a1 | 127 | d.37.1.1 (A:1-127) Uncharacterized protein ST2348 | 0.001 | |
| d2ef7a1 | 127 | d.37.1.1 (A:1-127) Uncharacterized protein ST2348 | 0.002 | |
| d1y5ha3 | 123 | d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {M | 1e-08 | |
| d1y5ha3 | 123 | d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {M | 7e-04 | |
| d1y5ha3 | 123 | d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {M | 0.001 | |
| d1y5ha3 | 123 | d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {M | 0.003 | |
| d1zfja4 | 126 | d.37.1.1 (A:95-220) Type II inosine monophosphate | 2e-08 | |
| d1pbja3 | 120 | d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {A | 4e-08 | |
| d1pbja3 | 120 | d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {A | 9e-05 | |
| d2yvxa2 | 144 | d.37.1.1 (A:132-275) Magnesium transporter MgtE {T | 4e-08 | |
| d2yvxa2 | 144 | d.37.1.1 (A:132-275) Magnesium transporter MgtE {T | 0.003 | |
| d2riha1 | 131 | d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 | 6e-08 | |
| d2ouxa2 | 127 | d.37.1.1 (A:136-262) Magnesium transporter MgtE {E | 6e-08 | |
| d2ooxe1 | 179 | d.37.1.1 (E:3-181) Uncharacterized protein C1556.0 | 6e-08 | |
| d1o50a3 | 145 | d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Th | 1e-07 | |
| d1o50a3 | 145 | d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Th | 1e-04 | |
| d3ddja2 | 135 | d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 | 3e-07 | |
| d3ddja2 | 135 | d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 | 0.001 | |
| d3ddja2 | 135 | d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 | 0.004 | |
| d2o16a3 | 139 | d.37.1.1 (A:20-158) Hypothetical protein VC0737 {V | 6e-07 | |
| d2o16a3 | 139 | d.37.1.1 (A:20-158) Hypothetical protein VC0737 {V | 9e-06 | |
| d2o16a3 | 139 | d.37.1.1 (A:20-158) Hypothetical protein VC0737 {V | 6e-04 | |
| d2o16a3 | 139 | d.37.1.1 (A:20-158) Hypothetical protein VC0737 {V | 0.003 | |
| d2ooxe2 | 153 | d.37.1.1 (E:182-334) Uncharacterized protein C1556 | 4e-06 | |
| d2ooxe2 | 153 | d.37.1.1 (E:182-334) Uncharacterized protein C1556 | 0.001 | |
| d2yzqa2 | 122 | d.37.1.1 (A:1-122) Uncharacterized protein PH1780 | 6e-06 | |
| d2yzqa2 | 122 | d.37.1.1 (A:1-122) Uncharacterized protein PH1780 | 0.003 | |
| d3ddja1 | 141 | d.37.1.1 (A:136-276) Uncharacterized protein SSO32 | 1e-05 | |
| d3ddja1 | 141 | d.37.1.1 (A:136-276) Uncharacterized protein SSO32 | 0.004 | |
| d1vr9a3 | 121 | d.37.1.1 (A:1-121) Hypothetical protein TM0892, CB | 5e-05 | |
| d1vr9a3 | 121 | d.37.1.1 (A:1-121) Hypothetical protein TM0892, CB | 0.004 | |
| d2j9la1 | 169 | d.37.1.1 (A:578-746) Chloride channel protein 5, C | 1e-04 | |
| d2j9la1 | 169 | d.37.1.1 (A:578-746) Chloride channel protein 5, C | 0.001 |
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Length = 127 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: CBS-domain pair superfamily: CBS-domain pair family: CBS-domain pair domain: Uncharacterized protein NE2398 species: Nitrosomonas europaea [TaxId: 915]
Score = 68.3 bits (166), Expect = 6e-15
Identities = 31/116 (26%), Positives = 58/116 (50%), Gaps = 1/116 (0%)
Query: 129 SKVVTISPTDTVLMATKKMLELRLSSAVVTVENKPRGILTSKDILMRVISQNLPADSTLV 188
VV I P D+V A +KM + + +V + K GILT +D + + P T V
Sbjct: 13 HTVVAIGPDDSVFNAMQKMAADNIGALLVMKDEKLVGILTERDFSRKSYLLDKPVKDTQV 72
Query: 189 EKVMTPNPECATIDTPIVDALHIMHDGKFLHLPVVDRDGDVVDVVDVIHITHAAVA 244
+++MT ++ D + ++ + + HLPV+D DG V+ ++ + + A++
Sbjct: 73 KEIMTRQVAYVDLNNTNEDCMALITEMRVRHLPVLD-DGKVIGLLSIGDLVKDAIS 127
|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Length = 127 | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Length = 127 | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 120 | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 120 | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Length = 160 | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Length = 160 | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Length = 132 | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Length = 132 | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Length = 132 | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Length = 132 | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 156 | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 156 | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 156 | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 142 | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 142 | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Length = 127 | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Length = 127 | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Length = 127 | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 123 | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 123 | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 123 | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 123 | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Length = 126 | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 120 | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 120 | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Length = 144 | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Length = 144 | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Length = 131 | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Length = 127 | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 179 | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Length = 145 | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Length = 145 | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Length = 135 | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Length = 135 | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Length = 135 | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Length = 139 | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Length = 139 | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Length = 139 | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Length = 139 | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 153 | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 153 | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 122 | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 122 | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Length = 141 | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Length = 141 | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Length = 121 | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Length = 121 | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 346 | |||
| d2rc3a1 | 127 | Uncharacterized protein NE2398 {Nitrosomonas europ | 99.88 | |
| d2ef7a1 | 127 | Uncharacterized protein ST2348 {Sulfolobus tokodai | 99.88 | |
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 99.87 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 99.87 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 99.86 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 99.85 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 99.85 | |
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 99.85 | |
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 99.84 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.84 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 99.84 | |
| d2ef7a1 | 127 | Uncharacterized protein ST2348 {Sulfolobus tokodai | 99.84 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 99.84 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 99.83 | |
| d3ddja1 | 141 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.83 | |
| d2rc3a1 | 127 | Uncharacterized protein NE2398 {Nitrosomonas europ | 99.83 | |
| d2ouxa2 | 127 | Magnesium transporter MgtE {Enterococcus faecalis | 99.83 | |
| d1vr9a3 | 121 | Hypothetical protein TM0892, CBS tandem {Thermotog | 99.83 | |
| d2yzqa2 | 122 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.82 | |
| d2yzqa2 | 122 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.82 | |
| d2d4za3 | 160 | Chloride channel protein, CBS tandem {Marbled elec | 99.81 | |
| d2yvxa2 | 144 | Magnesium transporter MgtE {Thermus thermophilus [ | 99.81 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.81 | |
| d1zfja4 | 126 | Type II inosine monophosphate dehydrogenase CBS do | 99.81 | |
| d2ooxe2 | 153 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.81 | |
| d3ddja1 | 141 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.81 | |
| d2nyca1 | 140 | Nuclear protein SNF4 {Baker's yeast (Saccharomyces | 99.8 | |
| d1vr9a3 | 121 | Hypothetical protein TM0892, CBS tandem {Thermotog | 99.8 | |
| d2ouxa2 | 127 | Magnesium transporter MgtE {Enterococcus faecalis | 99.8 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 99.8 | |
| d2v8qe2 | 159 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.8 | |
| d2riha1 | 131 | Uncharacterized protein PAE2072 {Pyrobaculum aerop | 99.79 | |
| d3ddja2 | 135 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.79 | |
| d1o50a3 | 145 | Hypothetical protein TM0935 {Thermotoga maritima [ | 99.79 | |
| d2ooxe1 | 179 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.78 | |
| d2yvxa2 | 144 | Magnesium transporter MgtE {Thermus thermophilus [ | 99.78 | |
| d1o50a3 | 145 | Hypothetical protein TM0935 {Thermotoga maritima [ | 99.78 | |
| d3ddja2 | 135 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.78 | |
| d2d4za3 | 160 | Chloride channel protein, CBS tandem {Marbled elec | 99.78 | |
| d2v8qe1 | 145 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.76 | |
| d1zfja4 | 126 | Type II inosine monophosphate dehydrogenase CBS do | 99.76 | |
| d2riha1 | 131 | Uncharacterized protein PAE2072 {Pyrobaculum aerop | 99.76 | |
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 99.75 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 99.75 | |
| d1jr1a4 | 120 | Type II inosine monophosphate dehydrogenase CBS do | 99.75 | |
| d2v8qe2 | 159 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.73 | |
| d2nyca1 | 140 | Nuclear protein SNF4 {Baker's yeast (Saccharomyces | 99.72 | |
| d1jr1a4 | 120 | Type II inosine monophosphate dehydrogenase CBS do | 99.72 | |
| d2ooxe2 | 153 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.7 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 99.7 | |
| d2ooxe1 | 179 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.69 | |
| d2v8qe1 | 145 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.67 | |
| d2o1ra1 | 78 | Hypothetical protein HI0107 {Haemophilus influenza | 97.72 | |
| d2plia1 | 84 | Uncharacterized protein NMB0537 {Neisseria meningi | 97.45 | |
| d2p4pa1 | 82 | Hypothetical protein HD1797 {Haemophilus ducreyi [ | 97.41 | |
| d2o3ga1 | 76 | Putative protein NMB1485 {Neisseria meningitidis [ | 97.31 | |
| d2r2za1 | 84 | Putative hemolysin EF0700 {Enterococcus faecalis [ | 97.29 | |
| d2p13a1 | 85 | Uncharacterized protein NE2227 {Nitrosomonas europ | 97.28 | |
| d3deda1 | 87 | Probable hemolysin CV0231 {Chromobacterium violace | 97.25 | |
| d2rk5a1 | 84 | Putative hemolysin SMU1693 {Streptococcus mutans [ | 97.19 | |
| d2plsa1 | 84 | Hypothetical protein CT0541 {Chlorobium tepidum [T | 97.1 | |
| d2oaia1 | 87 | Hemolysin TlyC {Xylella fastidiosa [TaxId: 2371]} | 97.07 | |
| d2nqwa1 | 87 | Hypothetical protein PG0272 {Porphyromonas gingiva | 96.96 | |
| d2p3ha1 | 98 | Uncharacterized protein Cgl1194/Cg1349 {Corynebact | 95.59 | |
| d1lkvx_ | 213 | FliG {Thermotoga maritima [TaxId: 2336]} | 85.99 |
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: CBS-domain pair superfamily: CBS-domain pair family: CBS-domain pair domain: Uncharacterized protein NE2398 species: Nitrosomonas europaea [TaxId: 915]
Probab=99.88 E-value=1.4e-22 Score=156.22 Aligned_cols=123 Identities=26% Similarity=0.453 Sum_probs=110.5
Q ss_pred CccccccC-CCceeEeCCCCcHHHHHHHHHHcCCcEEEEEeCCEEEEEeeHHHHHHHHHhcCCCccccccccccccCCee
Q 019128 120 SLSTIIPE-KSKVVTISPTDTVLMATKKMLELRLSSAVVTVENKPRGILTSKDILMRVISQNLPADSTLVEKVMTPNPEC 198 (346)
Q Consensus 120 ~v~~im~~-~~~~~~v~~~~~l~~~~~~m~~~~~~~l~V~d~~~~~Giit~~dll~~~~~~~~~~~~~~v~~~m~~~~~~ 198 (346)
+++++|.. .++++++++++++.+|++.|.+++++++||+++|+++|++|.+|+++++...+......+++++|++++.+
T Consensus 3 tV~dim~~k~~~v~~i~~~~tl~~a~~~m~~~~~~~vpV~~~~~~vGiit~~Di~~~~~~~~~~~~~~~v~~im~~~~~~ 82 (127)
T d2rc3a1 3 TVKHLLQEKGHTVVAIGPDDSVFNAMQKMAADNIGALLVMKDEKLVGILTERDFSRKSYLLDKPVKDTQVKEIMTRQVAY 82 (127)
T ss_dssp BHHHHHHHHCCCCCEECTTSBHHHHHHHHHHHTCSEEEEEETTEEEEEEEHHHHHHHGGGSSSCGGGSBGGGTSBCSCCC
T ss_pred cHHHHHccCCCccEEECCcCcHHHHHHHHHHcCCCEEEEEECCeEEEEEEccchhhhhhhhcccccceeEeeeccceeEE
Confidence 46667753 24789999999999999999999999999999999999999999985666666666678999999999999
Q ss_pred ecCCCCHHHHHHHhHhCCCceeEEEcCCCcEEEEEehHHHHHHHH
Q 019128 199 ATIDTPIVDALHIMHDGKFLHLPVVDRDGDVVDVVDVIHITHAAV 243 (346)
Q Consensus 199 v~~~~~l~~~~~~m~~~~~~~~~Vvd~~g~~~Giit~~Di~~~~~ 243 (346)
+.+++++.++++.|.+++++++||+| +|+++|+||..|++++++
T Consensus 83 v~~~~~l~~a~~~m~~~~~~~lpVvd-~~~~~GiIt~~Dil~~~i 126 (127)
T d2rc3a1 83 VDLNNTNEDCMALITEMRVRHLPVLD-DGKVIGLLSIGDLVKDAI 126 (127)
T ss_dssp BCTTCBHHHHHHHHHHHTCSEEEEEE-TTEEEEEEEHHHHHHHHH
T ss_pred eccCccHHHHHHHHHHCCCcEEEEEE-CCEEEEEEEHHHHHHHHh
Confidence 99999999999999999999999998 699999999999999854
|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2o1ra1 d.145.1.4 (A:1-78) Hypothetical protein HI0107 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2plia1 d.145.1.4 (A:5-88) Uncharacterized protein NMB0537 {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d2p4pa1 d.145.1.4 (A:1-82) Hypothetical protein HD1797 {Haemophilus ducreyi [TaxId: 730]} | Back information, alignment and structure |
|---|
| >d2o3ga1 d.145.1.4 (A:180-255) Putative protein NMB1485 {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d2r2za1 d.145.1.4 (A:5-88) Putative hemolysin EF0700 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2p13a1 d.145.1.4 (A:431-515) Uncharacterized protein NE2227 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d3deda1 d.145.1.4 (A:341-427) Probable hemolysin CV0231 {Chromobacterium violaceum [TaxId: 536]} | Back information, alignment and structure |
|---|
| >d2rk5a1 d.145.1.4 (A:5-88) Putative hemolysin SMU1693 {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d2plsa1 d.145.1.4 (A:345-428) Hypothetical protein CT0541 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d2oaia1 d.145.1.4 (A:5-91) Hemolysin TlyC {Xylella fastidiosa [TaxId: 2371]} | Back information, alignment and structure |
|---|
| >d2nqwa1 d.145.1.4 (A:4-90) Hypothetical protein PG0272 {Porphyromonas gingivalis [TaxId: 837]} | Back information, alignment and structure |
|---|
| >d2p3ha1 d.145.1.4 (A:5-102) Uncharacterized protein Cgl1194/Cg1349 {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d1lkvx_ a.118.14.1 (X:) FliG {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|