Citrus Sinensis ID: 019186

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-----
MSELIEGLPDAVALRCLARVPFFLHPKLELVSRSWRAAIRSPELFKARQEVGSSENLLCVCAFDPENLWQLYDPLRDLWITLPVLPSKIRHLAHFGVVSTAGKLFVLGGGSDAVDPLTGDQDGSFATNEVWSYDPVTRQWSPRASMLVPRAMFACCALKEKIVVAGGFTSCRKSISQAEMYDPEKDVWVPIPDLHRTHNSACTGVVIGGKVHVLHKGLSTVQVLDHMGLGWTVEDYGWLQGPMAIVHDSVYLMSHGLIIKQHRDVRKVVASASEFRRRIGFAMIGMGDDIYVIGGVIGPDRWNWDIKPMSDVDVLTVGAERPTWRQVSPMTRCRGTILGCTQLRI
cccccccccHHHHHHHHHHcccccccccccccHHHHHHccccHHHHHHHcccccccEEEEEEcccccEEEEEEcccccEEEcccccccccccccEEEEEEccEEEEEcccccccccccccccccccccEEEEEEcccccEEcccccccccccEEEEEEccEEEEEcccccccccccEEEEEEcccccEEEcccccccccccEEEEEEccEEEEEEccccEEEEEEcccccEEEcccccccccEEEEccEEEEEEccEEEEEEccccEEEEcccccccccEEEEEEEccEEEEEEcccccccccccccccccEEEEEEccccccEEEccccccccccEEEEEEEEc
cccccccccHHHHHHHHHHccHcccHHHHHHHHHHHHHHccHHHHHHHHHcccccEEEEEEEcccccHHHcccHHcccEEEccccccccccccccEEEEEccEEEEEEccccccccccccccccccccEEEEEcccccccEEcccccccccccEEEEEccEEEEEEccccccccccEEEEEccccccEEEcccccccccccEEEEEEccEEEEEcccccEEEEEccccccEEEcccccccccEEEEccEEEEEcccccEEEEccccccccccccccccccEEEEEEccEEEEEEcccccccccccccccEEEEEEEcccccccEEEEcccccccccEEEEEEEEc
mselieglPDAVALRClarvpfflhpklelVSRSWRAAIRSPELFKARqevgssenllcvcafdpenlwqlydplrdlwitlpvlpskirhlahfgvvsTAGKLFvlgggsdavdpltgdqdgsfatnevwsydpvtrqwsprasmlvpRAMFACCALKEKIVVAGGFTSCRKSISqaemydpekdvwvpipdlhrthnsactgvVIGGKVHVLHKGLSTVQVLDhmglgwtvedygwlqgpmaiVHDSVYLMSHGLIIKQHRDVRKVVASASEFRRRIGFAMIGMGDDIYVIGgvigpdrwnwdikpmsdvdvltvgaerptwrqvspmtrcrgtilgctqlri
MSELIEGLPDAVALRCLARVPFFLHPKLELVSRSWRAAIRSPELFKARQEVGSSENLLCVCAFDPENLWQLYDPLRDLWITLPVLPSKIRHLAHFGVVSTAGKLFVLGGGSDAVDPLTGDQDGSFATNEVWSYDPVTRQWSPRASMLVPRAMFACCALKEKIVVAGGFTSCRKSISQAEMYDPEKDVWVPIPDLHRTHNSACTGVVIGGKVHVLHKGLSTVQVLDHMGLGWTVEDYGWLQGPMAIVHDSVYLMSHGLIIKQHRDVRKVVASASEFRRRIGFAMIGMGDDIYVIGGVIGPDRWNWDIKPMSDVDVLTvgaerptwrqvspmtrcrgtilgctqlri
MSELIEGLPDAVALRCLARVPFFLHPKLELVSRSWRAAIRSPELFKARQEVGSSENLLCVCAFDPENLWQLYDPLRDLWITLPVLPSKIRHLAHFGVVSTAGKLFVLGGGSDAVDPLTGDQDGSFATNEVWSYDPVTRQWSPRASMLVPRAMFACCALKEKIVVAGGFTSCRKSISQAEMYDPEKDVWVPIPDLHRTHNSACTGVVIGGKVHVLHKGLSTVQVLDHMGLGWTVEDYGWLQGPMAIVHDSVYLMSHGLIIKQHRDVRKVVASASEFRRRIGFAmigmgddiyviggvigPDRWNWDIKPMSDVDVLTVGAERPTWRQVSPMTRCRGTILGCTQLRI
*****EGLPDAVALRCLARVPFFLHPKLELVSRSWRAAIRSPELFKARQEVGSSENLLCVCAFDPENLWQLYDPLRDLWITLPVLPSKIRHLAHFGVVSTAGKLFVLGGGSDAVDPLTGDQDGSFATNEVWSYDPVTRQWSPRASMLVPRAMFACCALKEKIVVAGGFTSCRKSISQAEMYDPEKDVWVPIPDLHRTHNSACTGVVIGGKVHVLHKGLSTVQVLDHMGLGWTVEDYGWLQGPMAIVHDSVYLMSHGLIIKQHRDVRKVVASASEFRRRIGFAMIGMGDDIYVIGGVIGPDRWNWDIKPMSDVDVLTVGAERPTWRQVSPMTRCRGTILGCT****
*SELIEGLPDAVALRCLARVPFFLHPKLELVSRSWRAAIRSPELFKARQEVGSSENLLCVCAFDPENLWQLYDPLRDLWITLPVLPSKIRHLAHFGVVSTAGKLFVLGGGSDAVDPLTGDQDGSFATNEVWSYDPVTRQWSPRASMLVPRAMFACCALKEKIVVAGGFTSCRKSISQAEMYDPEKDVWVPIPDLHRTHNSACTGVVIGGKVHVLHKGLSTVQVLDHMGLGWTVEDYGWLQGPMAIVHDSVYLMSHGLIIKQHRDVRKVVASASEFRRRIGFAMIGMGDDIYVIGGVIGPDRWNWDIKPMSDVDVLTVGAERPTWRQVSPMTRCRGTILGCTQLRI
MSELIEGLPDAVALRCLARVPFFLHPKLELVSRSWRAAIRSPELFKARQEVGSSENLLCVCAFDPENLWQLYDPLRDLWITLPVLPSKIRHLAHFGVVSTAGKLFVLGGGSDAVDPLTGDQDGSFATNEVWSYDPVTRQWSPRASMLVPRAMFACCALKEKIVVAGGFTSCRKSISQAEMYDPEKDVWVPIPDLHRTHNSACTGVVIGGKVHVLHKGLSTVQVLDHMGLGWTVEDYGWLQGPMAIVHDSVYLMSHGLIIKQHRDVRKVVASASEFRRRIGFAMIGMGDDIYVIGGVIGPDRWNWDIKPMSDVDVLTVGAERPTWRQVSPMTRCRGTILGCTQLRI
**ELIEGLPDAVALRCLARVPFFLHPKLELVSRSWRAAIRSPELFKARQEVGSSENLLCVCAFDPENLWQLYDPLRDLWITLPVLPSKIRHLAHFGVVSTAGKLFVLGGGSDAVDPLTGDQDGSFATNEVWSYDPVTRQWSPRASMLVPRAMFACCALKEKIVVAGGFTSCRKSISQAEMYDPEKDVWVPIPDLHRTHNSACTGVVIGGKVHVLHKGLSTVQVLDHMGLGWTVEDYGWLQGPMAIVHDSVYLMSHGLIIKQHRDVRKVVASASEFRRRIGFAMIGMGDDIYVIGGVIGPDRWNWDIKPMSDVDVLTVGAERPTWRQVSPMTRCRGTILGCTQLRI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSELIEGLPDAVALRCLARVPFFLHPKLELVSRSWRAAIRSPELFKARQEVGSSENLLCVCAFDPENLWQLYDPLRDLWITLPVLPSKIRHLAHFGVVSTAGKLFVLGGGSDAVDPLTGDQDGSFATNEVWSYDPVTRQWSPRASMLVPRAMFACCALKEKIVVAGGFTSCRKSISQAEMYDPEKDVWVPIPDLHRTHNSACTGVVIGGKVHVLHKGLSTVQVLDHMGLGWTVEDYGWLQGPMAIVHDSVYLMSHGLIIKQHRDVRKVVASASEFRRRIGFAMIGMGDDIYVIGGVIGPDRWNWDIKPMSDVDVLTVGAERPTWRQVSPMTRCRGTILGCTQLRI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query345 2.2.26 [Sep-21-2011]
Q9M1W7352 F-box/kelch-repeat protei yes no 1.0 0.980 0.739 1e-154
Q0WW40383 F-box/kelch-repeat protei no no 0.968 0.872 0.287 8e-28
Q9CAG8376 F-box/kelch-repeat protei no no 0.582 0.534 0.331 2e-20
Q93W93434 F-box/kelch-repeat protei no no 0.605 0.481 0.325 2e-20
Q8LAW2372 F-box protein AFR OS=Arab no no 0.808 0.75 0.261 1e-18
Q9FKJ0393 F-box/kelch-repeat protei no no 0.791 0.694 0.265 9e-18
Q84M94421 F-box/kelch-repeat protei no no 0.805 0.660 0.248 2e-17
Q8L736467 F-box/kelch-repeat protei no no 0.617 0.456 0.257 8e-17
Q9FZJ3346 Putative F-box/kelch-repe no no 0.707 0.705 0.248 3e-16
Q0V7S6442 F-box/kelch-repeat protei no no 0.582 0.454 0.307 5e-16
>sp|Q9M1W7|SKI30_ARATH F-box/kelch-repeat protein SKIP30 OS=Arabidopsis thaliana GN=SKIP30 PE=1 SV=2 Back     alignment and function desciption
 Score =  545 bits (1404), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 255/345 (73%), Positives = 297/345 (86%)

Query: 1   MSELIEGLPDAVALRCLARVPFFLHPKLELVSRSWRAAIRSPELFKARQEVGSSENLLCV 60
           MS L++G+P+AVALRCLA VP  LHP LELVSRSWRAAIRS ELF+ R+E+ SSE+LLCV
Sbjct: 8   MSGLLDGIPEAVALRCLAHVPLHLHPNLELVSRSWRAAIRSHELFRVRKELRSSEHLLCV 67

Query: 61  CAFDPENLWQLYDPLRDLWITLPVLPSKIRHLAHFGVVSTAGKLFVLGGGSDAVDPLTGD 120
           CAFDPEN+WQ+Y P  D W+TLP+LPS+IRHLAHFG V+TAG LFVLGGGSDAV P+TGD
Sbjct: 68  CAFDPENIWQVYSPNCDRWLTLPLLPSRIRHLAHFGAVTTAGMLFVLGGGSDAVSPVTGD 127

Query: 121 QDGSFATNEVWSYDPVTRQWSPRASMLVPRAMFACCALKEKIVVAGGFTSCRKSISQAEM 180
            DG+FAT++VWSYD V RQW+PRASMLVPRAMFACC L+ KIVVAGGFT+CRKSIS AEM
Sbjct: 128 HDGTFATDQVWSYDFVQRQWTPRASMLVPRAMFACCVLQGKIVVAGGFTTCRKSISGAEM 187

Query: 181 YDPEKDVWVPIPDLHRTHNSACTGVVIGGKVHVLHKGLSTVQVLDHMGLGWTVEDYGWLQ 240
           YDPE DVW  IPDLH+THNSAC+G+V+ GKVHVLHKGLSTVQVL+ + LGW V+DYGW Q
Sbjct: 188 YDPENDVWTSIPDLHQTHNSACSGLVVNGKVHVLHKGLSTVQVLESVKLGWDVKDYGWPQ 247

Query: 241 GPMAIVHDSVYLMSHGLIIKQHRDVRKVVASASEFRRRIGFAMIGMGDDIYVIGGVIGPD 300
           GPM +V D +Y+MSHGL+ KQ  D  K+VASASEF+RRIG AM  + D++ ++GGVIGPD
Sbjct: 248 GPMVVVEDVLYVMSHGLVFKQEGDTWKMVASASEFKRRIGMAMTSLSDEVLIVGGVIGPD 307

Query: 301 RWNWDIKPMSDVDVLTVGAERPTWRQVSPMTRCRGTILGCTQLRI 345
           R NWDIKP+SDVD LTVG +RP WR V+PMTRCRGTILGCTQL I
Sbjct: 308 RLNWDIKPLSDVDALTVGNDRPAWRSVAPMTRCRGTILGCTQLTI 352
Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.
Arabidopsis thaliana (taxid: 3702)
>sp|Q0WW40|FBK5_ARATH F-box/kelch-repeat protein At1g16250 OS=Arabidopsis thaliana GN=At1g16250 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAG8|FBK28_ARATH F-box/kelch-repeat protein At1g67480 OS=Arabidopsis thaliana GN=At1g67480 PE=2 SV=1 Back     alignment and function description
>sp|Q93W93|FBK22_ARATH F-box/kelch-repeat protein At1g55270 OS=Arabidopsis thaliana GN=At1g55270 PE=2 SV=1 Back     alignment and function description
>sp|Q8LAW2|AFR_ARATH F-box protein AFR OS=Arabidopsis thaliana GN=AFR PE=1 SV=2 Back     alignment and function description
>sp|Q9FKJ0|FK132_ARATH F-box/kelch-repeat protein At5g60570 OS=Arabidopsis thaliana GN=At5g60570 PE=2 SV=1 Back     alignment and function description
>sp|Q84M94|FBK15_ARATH F-box/kelch-repeat protein At1g26930 OS=Arabidopsis thaliana GN=At1g26930 PE=2 SV=1 Back     alignment and function description
>sp|Q8L736|SKI11_ARATH F-box/kelch-repeat protein SKIP11 OS=Arabidopsis thaliana GN=SKIP11 PE=1 SV=2 Back     alignment and function description
>sp|Q9FZJ3|FBK16_ARATH Putative F-box/kelch-repeat protein At1g27420 OS=Arabidopsis thaliana GN=At1g27420 PE=4 SV=2 Back     alignment and function description
>sp|Q0V7S6|FK125_ARATH F-box/kelch-repeat protein OR23 OS=Arabidopsis thaliana GN=OR23 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query345
224085497345 f-box family protein [Populus trichocarp 1.0 1.0 0.875 0.0
255567564345 Protein AFR, putative [Ricinus communis] 1.0 1.0 0.872 0.0
224062428345 f-box family protein [Populus trichocarp 1.0 1.0 0.863 1e-180
359479633345 PREDICTED: F-box/kelch-repeat protein SK 1.0 1.0 0.843 1e-173
356536139344 PREDICTED: F-box/kelch-repeat protein SK 0.997 1.0 0.828 1e-172
255645989344 unknown [Glycine max] 0.997 1.0 0.826 1e-171
356504941345 PREDICTED: F-box/kelch-repeat protein SK 1.0 1.0 0.831 1e-171
356500182344 PREDICTED: F-box/kelch-repeat protein SK 0.997 1.0 0.826 1e-171
255635285345 unknown [Glycine max] 1.0 1.0 0.826 1e-170
356572206345 PREDICTED: F-box/kelch-repeat protein SK 1.0 1.0 0.817 1e-169
>gi|224085497|ref|XP_002307595.1| f-box family protein [Populus trichocarpa] gi|118482816|gb|ABK93324.1| unknown [Populus trichocarpa] gi|222857044|gb|EEE94591.1| f-box family protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/345 (87%), Positives = 327/345 (94%)

Query: 1   MSELIEGLPDAVALRCLARVPFFLHPKLELVSRSWRAAIRSPELFKARQEVGSSENLLCV 60
           MSELIEGLPDAVA+RC+ARVPF+LHPKLELVSRSWRA +RSPELFKARQEVGS+E+LLCV
Sbjct: 1   MSELIEGLPDAVAIRCIARVPFYLHPKLELVSRSWRAVVRSPELFKARQEVGSAEDLLCV 60

Query: 61  CAFDPENLWQLYDPLRDLWITLPVLPSKIRHLAHFGVVSTAGKLFVLGGGSDAVDPLTGD 120
           CAFDPENLWQLYDP RDLWITLPVLPSKIRHLAHFGVVS+AGKLFVLGGGSDAVDPLTGD
Sbjct: 61  CAFDPENLWQLYDPHRDLWITLPVLPSKIRHLAHFGVVSSAGKLFVLGGGSDAVDPLTGD 120

Query: 121 QDGSFATNEVWSYDPVTRQWSPRASMLVPRAMFACCALKEKIVVAGGFTSCRKSISQAEM 180
           QDGSFATNEVWSYDPV RQW+ RASMLVPRAMFAC  L  KIVVAGGFTSCRKSISQAEM
Sbjct: 121 QDGSFATNEVWSYDPVLRQWAARASMLVPRAMFACGTLNGKIVVAGGFTSCRKSISQAEM 180

Query: 181 YDPEKDVWVPIPDLHRTHNSACTGVVIGGKVHVLHKGLSTVQVLDHMGLGWTVEDYGWLQ 240
           YDPEKDVW+PIPDLHRTHNS C+GVVIGGK+HVLH+GLSTVQVLD++G GWTVEDYGWLQ
Sbjct: 181 YDPEKDVWIPIPDLHRTHNSTCSGVVIGGKLHVLHRGLSTVQVLDNVGSGWTVEDYGWLQ 240

Query: 241 GPMAIVHDSVYLMSHGLIIKQHRDVRKVVASASEFRRRIGFAMIGMGDDIYVIGGVIGPD 300
           GPMA+VHD++Y+MSHGLI KQ    RKVV SASEFR+RIGFAM+G+GDDIYVIGGVIGPD
Sbjct: 241 GPMAVVHDALYVMSHGLIFKQEGKTRKVVVSASEFRKRIGFAMMGLGDDIYVIGGVIGPD 300

Query: 301 RWNWDIKPMSDVDVLTVGAERPTWRQVSPMTRCRGTILGCTQLRI 345
           RWNWDI+PMSDVD+LTVG +RPTWRQ +PMTRCRGTILGCTQLRI
Sbjct: 301 RWNWDIRPMSDVDILTVGGDRPTWRQATPMTRCRGTILGCTQLRI 345

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255567564|ref|XP_002524761.1| Protein AFR, putative [Ricinus communis] gi|223535945|gb|EEF37604.1| Protein AFR, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224062428|ref|XP_002300832.1| f-box family protein [Populus trichocarpa] gi|222842558|gb|EEE80105.1| f-box family protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359479633|ref|XP_003632309.1| PREDICTED: F-box/kelch-repeat protein SKIP30-like isoform 1 [Vitis vinifera] gi|359479635|ref|XP_003632310.1| PREDICTED: F-box/kelch-repeat protein SKIP30-like isoform 2 [Vitis vinifera] gi|359479637|ref|XP_003632311.1| PREDICTED: F-box/kelch-repeat protein SKIP30-like isoform 3 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356536139|ref|XP_003536597.1| PREDICTED: F-box/kelch-repeat protein SKIP30-like isoform 1 [Glycine max] gi|356536141|ref|XP_003536598.1| PREDICTED: F-box/kelch-repeat protein SKIP30-like isoform 2 [Glycine max] gi|356536143|ref|XP_003536599.1| PREDICTED: F-box/kelch-repeat protein SKIP30-like isoform 3 [Glycine max] Back     alignment and taxonomy information
>gi|255645989|gb|ACU23482.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356504941|ref|XP_003521251.1| PREDICTED: F-box/kelch-repeat protein SKIP30-like [Glycine max] Back     alignment and taxonomy information
>gi|356500182|ref|XP_003518912.1| PREDICTED: F-box/kelch-repeat protein SKIP30-like [Glycine max] Back     alignment and taxonomy information
>gi|255635285|gb|ACU17996.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356572206|ref|XP_003554261.1| PREDICTED: F-box/kelch-repeat protein SKIP30-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query345
TAIR|locus:2077299352 AT3G63220 "AT3G63220" [Arabido 1.0 0.980 0.718 1.9e-138
TAIR|locus:2032855383 AT1G16250 "AT1G16250" [Arabido 0.663 0.597 0.352 9.4e-27
TAIR|locus:2035696434 AT1G55270 "AT1G55270" [Arabido 0.640 0.509 0.319 6.5e-22
TAIR|locus:2008773376 AT1G67480 "AT1G67480" [Arabido 0.579 0.531 0.334 9e-22
TAIR|locus:2175143393 AT5G60570 "AT5G60570" [Arabido 0.628 0.552 0.305 1.3e-17
TAIR|locus:2030601475 AT1G22040 "AT1G22040" [Arabido 0.240 0.174 0.376 1.5e-17
TAIR|locus:2143468347 AT5G03020 "AT5G03020" [Arabido 0.498 0.495 0.345 1.6e-17
TAIR|locus:2046683372 AFR "ATTENUATED FAR-RED RESPON 0.753 0.698 0.275 2.6e-17
TAIR|locus:2143428368 AT5G02990 "AT5G02990" [Arabido 0.715 0.671 0.290 5.6e-16
TAIR|locus:2139350442 AT4G03030 "AT4G03030" [Arabido 0.582 0.454 0.307 1.1e-15
TAIR|locus:2077299 AT3G63220 "AT3G63220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1355 (482.0 bits), Expect = 1.9e-138, P = 1.9e-138
 Identities = 248/345 (71%), Positives = 285/345 (82%)

Query:     1 MSELIEGLPDAVALRCLARVPFFLHPKLELVSRSWRAAIRSPELFKARQEVGSSENLLCV 60
             MS L++G+P+AVALRCLA VP  LHP LELVSRSWRAAIRS ELF+ R+E+ SSE+LLCV
Sbjct:     8 MSGLLDGIPEAVALRCLAHVPLHLHPNLELVSRSWRAAIRSHELFRVRKELRSSEHLLCV 67

Query:    61 CAFDPENLWQLYDPLRDLWITLPVLPSKIRHLAHFGVVSTAGKLFVLGGGSDAVDPLTGD 120
             CAFDPEN+WQ+Y P  D W+TLP+LPS+IRHLAHFG V+TAG LFVLGGGSDAV P+TGD
Sbjct:    68 CAFDPENIWQVYSPNCDRWLTLPLLPSRIRHLAHFGAVTTAGMLFVLGGGSDAVSPVTGD 127

Query:   121 QDGSFATNEVWSYDPVTRQWSPRASMLVPRAMFACCALKEKIVVAGGFTSCRKSISQAEM 180
              DG+FAT++VWSYD V RQW+PRASMLVPRAMFACC L+ KIVVAGGFT+CRKSIS AEM
Sbjct:   128 HDGTFATDQVWSYDFVQRQWTPRASMLVPRAMFACCVLQGKIVVAGGFTTCRKSISGAEM 187

Query:   181 YDPEKDVWVPIPDLHRTHNSACTGVVIGGKVHVLHKGLSTVQVLDHMGLGWTVEDYGWLQ 240
             YDPE DVW  IPDLH+THNSAC+G+V+ GKVHVLHKGLSTVQVL+ + LGW V+DYGW Q
Sbjct:   188 YDPENDVWTSIPDLHQTHNSACSGLVVNGKVHVLHKGLSTVQVLESVKLGWDVKDYGWPQ 247

Query:   241 GPMAIVHDSVYLMSHGLIIKQHRDVRKVVASASEFRRRIGFAXXXXXXXXXXXXXXXXPD 300
             GPM +V D +Y+MSHGL+ KQ  D  K+VASASEF+RRIG A                PD
Sbjct:   248 GPMVVVEDVLYVMSHGLVFKQEGDTWKMVASASEFKRRIGMAMTSLSDEVLIVGGVIGPD 307

Query:   301 RWNWDIKPMSDVDVLTVGAERPTWRQVSPMTRCRGTILGCTQLRI 345
             R NWDIKP+SDVD LTVG +RP WR V+PMTRCRGTILGCTQL I
Sbjct:   308 RLNWDIKPLSDVDALTVGNDRPAWRSVAPMTRCRGTILGCTQLTI 352
GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0009062 "fatty acid catabolic process" evidence=RCA
TAIR|locus:2032855 AT1G16250 "AT1G16250" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2035696 AT1G55270 "AT1G55270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008773 AT1G67480 "AT1G67480" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175143 AT5G60570 "AT5G60570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2030601 AT1G22040 "AT1G22040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143468 AT5G03020 "AT5G03020" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046683 AFR "ATTENUATED FAR-RED RESPONSE" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143428 AT5G02990 "AT5G02990" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139350 AT4G03030 "AT4G03030" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9M1W7SKI30_ARATHNo assigned EC number0.73911.00.9801yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query345
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 4e-12
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 6e-10
pfam0134446 pfam01344, Kelch_1, Kelch motif 1e-07
smart0061247 smart00612, Kelch, Kelch domain 2e-07
pfam0134446 pfam01344, Kelch_1, Kelch motif 3e-07
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 7e-07
smart0061247 smart00612, Kelch, Kelch domain 1e-06
pfam1396450 pfam13964, Kelch_6, Kelch motif 2e-05
pfam1396450 pfam13964, Kelch_6, Kelch motif 6e-05
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 7e-05
smart0025641 smart00256, FBOX, A Receptor for Ubiquitination Ta 0.001
pfam0064648 pfam00646, F-box, F-box domain 0.001
pfam0134446 pfam01344, Kelch_1, Kelch motif 0.002
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information 
 Score = 66.7 bits (163), Expect = 4e-12
 Identities = 32/123 (26%), Positives = 50/123 (40%), Gaps = 12/123 (9%)

Query: 72  YDPLRDLWITLPVLPSKIRHLAHFGVVSTAGKLFVLGGGSDAVDPLTGDQDGSFATNEVW 131
           +    + W      P  I H      +   GK++V+GG S   +            N V 
Sbjct: 411 FSLNTNKWSKG--SPLPISHYGG-CAIYHDGKIYVIGGISYIDNIK--------VYNIVE 459

Query: 132 SYDPVTRQWSPRASMLVPRAMFACCALKEKIVVAGGFTSCRKSISQAEMYDPEKDVWVPI 191
           SY+PVT +W+  +S+  PR   + C    KI V GG       I++ E+YD + + W   
Sbjct: 460 SYNPVTNKWTELSSLNFPRINASLCIFNNKIYVVGGD-KYEYYINEIEVYDDKTNTWTLF 518

Query: 192 PDL 194
              
Sbjct: 519 CKF 521

Length = 534
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|197608 smart00256, FBOX, A Receptor for Ubiquitination Targets Back     alignment and domain information
>gnl|CDD|201368 pfam00646, F-box, F-box domain Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 345
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PHA02713557 hypothetical protein; Provisional 100.0
PLN02153341 epithiospecifier protein 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PLN02153341 epithiospecifier protein 100.0
PLN02193470 nitrile-specifier protein 100.0
PLN02193470 nitrile-specifier protein 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PHA03098534 kelch-like protein; Provisional 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
PHA02713557 hypothetical protein; Provisional 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
PHA03098534 kelch-like protein; Provisional 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 99.98
PHA02790480 Kelch-like protein; Provisional 99.97
KOG1230 521 consensus Protein containing repeated kelch motifs 99.95
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 99.94
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 99.91
KOG1230521 consensus Protein containing repeated kelch motifs 99.91
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.88
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.86
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.83
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.78
PF1396450 Kelch_6: Kelch motif 99.33
PF1396450 Kelch_6: Kelch motif 99.22
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 99.16
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.09
PF1341549 Kelch_3: Galactose oxidase, central domain 99.06
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.04
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 99.02
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.92
PF1341549 Kelch_3: Galactose oxidase, central domain 98.89
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.88
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.83
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 98.78
smart0061247 Kelch Kelch domain. 98.75
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.73
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.72
smart0061247 Kelch Kelch domain. 98.66
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.61
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.43
PLN02772 398 guanylate kinase 98.37
KOG0281499 consensus Beta-TrCP (transducin repeats containing 98.31
PF1385442 Kelch_5: Kelch motif 98.31
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.3
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.28
PLN02772 398 guanylate kinase 98.26
PF1385442 Kelch_5: Kelch motif 98.26
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.14
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 98.12
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.09
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.04
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 97.98
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 97.82
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.81
smart0025641 FBOX A Receptor for Ubiquitination Targets. 97.7
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 97.63
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 97.29
PF03089337 RAG2: Recombination activating protein 2; InterPro 97.26
PF12768281 Rax2: Cortical protein marker for cell polarity 97.25
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.05
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 97.03
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.0
KOG2055514 consensus WD40 repeat protein [General function pr 96.98
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 96.95
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.79
PRK11028330 6-phosphogluconolactonase; Provisional 96.77
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 96.7
PF12768281 Rax2: Cortical protein marker for cell polarity 96.5
KOG0310 487 consensus Conserved WD40 repeat-containing protein 96.31
KOG0274 537 consensus Cdc4 and related F-box and WD-40 protein 96.15
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 96.08
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 96.04
KOG0310 487 consensus Conserved WD40 repeat-containing protein 95.92
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 95.77
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 95.77
PRK13684334 Ycf48-like protein; Provisional 95.76
KOG2055514 consensus WD40 repeat protein [General function pr 95.7
PRK11028330 6-phosphogluconolactonase; Provisional 95.41
PRK04792448 tolB translocation protein TolB; Provisional 95.38
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 95.25
KOG2997366 consensus F-box protein FBX9 [General function pre 95.21
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 95.18
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 95.14
PF03089337 RAG2: Recombination activating protein 2; InterPro 95.12
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 95.08
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 95.07
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 94.98
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 94.95
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 94.94
KOG0316307 consensus Conserved WD40 repeat-containing protein 94.94
PRK04922433 tolB translocation protein TolB; Provisional 94.65
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 94.62
COG4946 668 Uncharacterized protein related to the periplasmic 94.56
KOG2321 703 consensus WD40 repeat protein [General function pr 94.43
COG3823262 Glutamine cyclotransferase [Posttranslational modi 94.35
PRK00178430 tolB translocation protein TolB; Provisional 94.23
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 94.08
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 93.81
smart00284255 OLF Olfactomedin-like domains. 93.54
COG1520 370 FOG: WD40-like repeat [Function unknown] 93.51
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 93.46
PF09910339 DUF2139: Uncharacterized protein conserved in arch 93.39
PTZ00421 493 coronin; Provisional 93.33
PLN00181793 protein SPA1-RELATED; Provisional 93.25
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 93.11
PRK13684334 Ycf48-like protein; Provisional 92.76
PRK05137435 tolB translocation protein TolB; Provisional 92.48
KOG0315311 consensus G-protein beta subunit-like protein (con 92.28
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 92.17
PRK04792448 tolB translocation protein TolB; Provisional 92.16
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 91.98
PRK05137435 tolB translocation protein TolB; Provisional 91.65
COG4880603 Secreted protein containing C-terminal beta-propel 91.25
PRK03629429 tolB translocation protein TolB; Provisional 91.19
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 91.15
COG1520370 FOG: WD40-like repeat [Function unknown] 91.04
PLN00181793 protein SPA1-RELATED; Provisional 91.0
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 90.93
smart00284255 OLF Olfactomedin-like domains. 90.66
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 90.36
PF10282 345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 90.23
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 89.94
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 89.86
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 89.81
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 89.38
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 88.99
COG3823262 Glutamine cyclotransferase [Posttranslational modi 88.97
KOG0289506 consensus mRNA splicing factor [General function p 88.65
PLN029191057 haloacid dehalogenase-like hydrolase family protei 87.85
KOG0646 476 consensus WD40 repeat protein [General function pr 87.35
COG4946 668 Uncharacterized protein related to the periplasmic 87.25
KOG0772 641 consensus Uncharacterized conserved protein, conta 87.08
PRK04922433 tolB translocation protein TolB; Provisional 86.92
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 86.59
KOG0643327 consensus Translation initiation factor 3, subunit 85.85
KOG0289506 consensus mRNA splicing factor [General function p 85.53
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 85.04
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 84.3
PRK02889427 tolB translocation protein TolB; Provisional 83.42
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 83.3
KOG0266456 consensus WD40 repeat-containing protein [General 82.78
KOG0640430 consensus mRNA cleavage stimulating factor complex 82.37
PRK00178430 tolB translocation protein TolB; Provisional 82.18
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 82.02
PLN00033398 photosystem II stability/assembly factor; Provisio 81.86
KOG0296 399 consensus Angio-associated migratory cell protein 81.83
PRK04043419 tolB translocation protein TolB; Provisional 81.82
PRK03629429 tolB translocation protein TolB; Provisional 81.59
PRK02889427 tolB translocation protein TolB; Provisional 81.14
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 80.85
KOG0316307 consensus Conserved WD40 repeat-containing protein 80.74
KOG0263707 consensus Transcription initiation factor TFIID, s 80.21
KOG0647347 consensus mRNA export protein (contains WD40 repea 80.03
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=2.5e-45  Score=344.96  Aligned_cols=312  Identities=24%  Similarity=0.415  Sum_probs=259.9

Q ss_pred             CCChHHHHHHhhccCCCc--chhhHHHh--hHHHHHhhcC-hhhHHHHHhcC-CCCcEEEEEecCC-----CCeEEEEeC
Q 019186            6 EGLPDAVALRCLARVPFF--LHPKLELV--SRSWRAAIRS-PELFKARQEVG-SSENLLCVCAFDP-----ENLWQLYDP   74 (345)
Q Consensus         6 ~~lp~~~~~~~l~~~p~~--~~~~~~~~--~~~w~~~~~~-~~~~~~~~~~~-~~~~~l~v~gg~~-----~~~~~~yd~   74 (345)
                      |-||+..+.++....+..  .......+  .+.|..+... +.++.++.... ...+.|+++||..     .+.++.|||
T Consensus       229 ~ll~~~~l~~~v~~~~~~~~~~~c~~~l~ea~~~~~~~~~~~~~~~~~t~~r~~~~~~l~~vGG~~~~~~~~~~ve~yd~  308 (571)
T KOG4441|consen  229 PLLPPQFLVEIVESEPLIKRDSACRDLLDEAKKYHLLPQRRPVMQSPRTRPRRSVSGKLVAVGGYNRQGQSLRSVECYDP  308 (571)
T ss_pred             cCCCHHHHHHHHhhhhhhccCHHHHHHHHHHHHHhhCcccCccccCCCcccCcCCCCeEEEECCCCCCCcccceeEEecC
Confidence            567777777666665411  11111111  2244443221 11344444444 5678999999955     578999999


Q ss_pred             CCCCEEeCCCCCccccccceeEEEEECCEEEEEcCCCCCCCCCCCCCCCCcCcCceEEEeCCCCCcccCCCCCCCceeee
Q 019186           75 LRDLWITLPVLPSKIRHLAHFGVVSTAGKLFVLGGGSDAVDPLTGDQDGSFATNEVWSYDPVTRQWSPRASMLVPRAMFA  154 (345)
Q Consensus        75 ~~~~W~~~~~~~~~~~~~~~~~~~~~~~~lyv~GG~~~~~~~~~~~~~~~~~~~~~~~yd~~t~~W~~~~~~~~~r~~~~  154 (345)
                      .+++|..+++|+.+   |.++++++++|+||++||++..          ....+++++||+.+++|+.+++|..+|..++
T Consensus       309 ~~~~w~~~a~m~~~---r~~~~~~~~~~~lYv~GG~~~~----------~~~l~~ve~YD~~~~~W~~~a~M~~~R~~~~  375 (571)
T KOG4441|consen  309 KTNEWSSLAPMPSP---RCRVGVAVLNGKLYVVGGYDSG----------SDRLSSVERYDPRTNQWTPVAPMNTKRSDFG  375 (571)
T ss_pred             CcCcEeecCCCCcc---cccccEEEECCEEEEEccccCC----------CcccceEEEecCCCCceeccCCccCccccce
Confidence            99999999999987   8899999999999999998631          2268999999999999999999999999999


Q ss_pred             eeEeCCeEEEEcCcCCCCCCCceEEEEeCCCCceEeCCCCCccCCCceeEEEECCEEEEEec------CcceEEEEECCC
Q 019186          155 CCALKEKIVVAGGFTSCRKSISQAEMYDPEKDVWVPIPDLHRTHNSACTGVVIGGKVHVLHK------GLSTVQVLDHMG  228 (345)
Q Consensus       155 ~~~~~~~iyv~gG~~~~~~~~~~v~~yd~~~~~W~~~~~~~~~~~~~~~~~~~~~~iyv~gG------~~~~i~~yd~~~  228 (345)
                      +++++|.||++||.++. ..++++|.|||.+++|+.+++|+.. +.++++++++++||++||      ...++++|||.+
T Consensus       376 v~~l~g~iYavGG~dg~-~~l~svE~YDp~~~~W~~va~m~~~-r~~~gv~~~~g~iYi~GG~~~~~~~l~sve~YDP~t  453 (571)
T KOG4441|consen  376 VAVLDGKLYAVGGFDGE-KSLNSVECYDPVTNKWTPVAPMLTR-RSGHGVAVLGGKLYIIGGGDGSSNCLNSVECYDPET  453 (571)
T ss_pred             eEEECCEEEEEeccccc-cccccEEEecCCCCcccccCCCCcc-eeeeEEEEECCEEEEEcCcCCCccccceEEEEcCCC
Confidence            99999999999999854 5688999999999999999999997 999999999999999999      568899999999


Q ss_pred             CCeeeccCCCC---CCceEEEcCeEEEEeC-------cEEEEecCCc--eEEeccchhhcccceeEEEEECCeEEEEcce
Q 019186          229 LGWTVEDYGWL---QGPMAIVHDSVYLMSH-------GLIIKQHRDV--RKVVASASEFRRRIGFAMIGMGDDIYVIGGV  296 (345)
Q Consensus       229 ~~W~~~~~~~~---~~~~~~~~~~l~~~~~-------~~i~~~d~~~--W~~~~~~p~~~~r~~~~~~~~~~~l~i~GG~  296 (345)
                      ++|+.+++++.   .+.+++++++||++||       ..+..||+++  |+.++.++  .+|..++++.+++++|++||+
T Consensus       454 ~~W~~~~~M~~~R~~~g~a~~~~~iYvvGG~~~~~~~~~VE~ydp~~~~W~~v~~m~--~~rs~~g~~~~~~~ly~vGG~  531 (571)
T KOG4441|consen  454 NTWTLIAPMNTRRSGFGVAVLNGKIYVVGGFDGTSALSSVERYDPETNQWTMVAPMT--SPRSAVGVVVLGGKLYAVGGF  531 (571)
T ss_pred             CceeecCCcccccccceEEEECCEEEEECCccCCCccceEEEEcCCCCceeEcccCc--cccccccEEEECCEEEEEecc
Confidence            99999998877   7889999999999999       4588999988  99998887  689999999999999999998


Q ss_pred             ecCCCCcccccccCceeeeccCCCCCceeEcCCCCCcceeEEeeeeee
Q 019186          297 IGPDRWNWDIKPMSDVDVLTVGAERPTWRQVSPMTRCRGTILGCTQLR  344 (345)
Q Consensus       297 ~~~~~~~~~~~~~~~v~~yd~~~~~~~W~~v~~~~~~r~~~~~~~~~~  344 (345)
                      ++.       .+++.|++|||.++  +|..+.++...|.. ++|++++
T Consensus       532 ~~~-------~~l~~ve~ydp~~d--~W~~~~~~~~~~~~-~~~~~~~  569 (571)
T KOG4441|consen  532 DGN-------NNLNTVECYDPETD--TWTEVTEPESGRGG-AGVAVIP  569 (571)
T ss_pred             cCc-------cccceeEEcCCCCC--ceeeCCCccccccC-cceEEec
Confidence            887       58999999999999  99999995566665 6777665

>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG4880 Secreted protein containing C-terminal beta-propeller domain distantly related to WD-40 repeats [General function prediction only] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query345
2vpj_A301 Crystal Structure Of The Kelch Domain Of Human Klhl 7e-10
2woz_A318 The Novel Beta-Propeller Of The Btb-Kelch Protein K 7e-09
1x2j_A316 Structural Basis For The Defects Of Human Lung Canc 2e-08
2dyh_A318 Crystal Structure Of The Keap1 Protein In Complexed 2e-08
1u6d_X308 Crystal Structure Of The Kelch Domain Of Human Keap 2e-07
3vng_A309 Crystal Structure Of Keap1 In Complex With Syntheti 2e-07
1zgk_A308 1.35 Angstrom Structure Of The Kelch Domain Of Keap 8e-07
2xn4_A302 Crystal Structure Of The Kelch Domain Of Human Klhl 2e-06
3ii7_A306 Crystal Structure Of The Kelch Domain Of Human Klhl 1e-04
>pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301 Back     alignment and structure 
Iteration: 1

 Score = 61.2 bits (147), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 83/186 (44%), Gaps = 18/186 (9%)
Query: 46  KARQEVGSSENLLCVCAF----DPENLWQLYDPLRDLWITLPVLPSKIRHLAHFGVVSTA 101
           + R  +G++E LL V  F     P ++ + YDP    W  LP +  K R++A    VS  
Sbjct: 6   RTRARLGANEVLLVVGGFGSQQSPIDVVEKYDPKTQEWSFLPSITRKRRYVAS---VSLH 62
Query: 102 GKLFVLGGGSDAVDPLTGDQDGSFATNEVWSYDPVTRQWSPRASMLVPRAMFACCALKEK 161
            +++V+GG  D    L+  +   +  +E    D V   W   A M V R +     L + 
Sbjct: 63  DRIYVIGG-YDGRSRLSSVECLDYTADE----DGV---WYSVAPMNVRRGLAGATTLGDM 114
Query: 162 IVVAGGFTSCRKSISQAEMYDPEKDVWVPIPDLHRTHNSACTGVVIGGKVHVLHKGLSTV 221
           I V+GGF   R+  S  E YDP  D W  + D+      A  G+V+   V     G   +
Sbjct: 115 IYVSGGFDGSRRHTSM-ERYDPNIDQWSMLGDMQTAREGA--GLVVASGVIYCLGGYDGL 171
Query: 222 QVLDHM 227
            +L+ +
Sbjct: 172 NILNSV 177
>pdb|2WOZ|A Chain A, The Novel Beta-Propeller Of The Btb-Kelch Protein Krp1 Provides The Binding Site For Lasp-1 That Is Necessary For Pseudopodia Extension Length = 318 Back     alignment and structure
>pdb|1X2J|A Chain A, Structural Basis For The Defects Of Human Lung Cancer Somatic Mutations In The Repression Activity Of Keap1 On Nrf2 Length = 316 Back     alignment and structure
>pdb|2DYH|A Chain A, Crystal Structure Of The Keap1 Protein In Complexed With The N-Terminal Region Of The Nrf2 Transcription Factor Length = 318 Back     alignment and structure
>pdb|1U6D|X Chain X, Crystal Structure Of The Kelch Domain Of Human Keap1 Length = 308 Back     alignment and structure
>pdb|3VNG|A Chain A, Crystal Structure Of Keap1 In Complex With Synthetic Small Molecular Based On A Co-crystallization Length = 309 Back     alignment and structure
>pdb|1ZGK|A Chain A, 1.35 Angstrom Structure Of The Kelch Domain Of Keap1 Length = 308 Back     alignment and structure
>pdb|2XN4|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl2 (mayven) Length = 302 Back     alignment and structure
>pdb|3II7|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl7 Length = 306 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query345
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 3e-37
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 4e-28
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 3e-25
2xn4_A 302 Kelch-like protein 2; structural protein, cytoskel 2e-09
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 1e-35
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 2e-28
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 4e-28
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 4e-24
1zgk_A 308 Kelch-like ECH-associated protein 1; beta-propelle 4e-13
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 3e-35
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 2e-28
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 5e-28
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 5e-25
3ii7_A 306 Kelch-like protein 7; protein-binding, kelch-repea 4e-20
3ii7_A 306 Kelch-like protein 7; protein-binding, kelch-repea 8e-09
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 3e-35
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 3e-31
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 6e-24
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 2e-12
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 1e-05
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 2e-33
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 1e-29
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 5e-24
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 2e-14
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 5e-33
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 9e-30
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 4e-25
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 3e-24
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-20
2vpj_A 301 Kelch-like protein 12; adaptor protein, WNT signal 4e-14
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 5e-13
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 2e-22
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 8e-20
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 6e-14
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 2e-12
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 3e-12
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 1e-08
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 1e-08
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 8e-08
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 5e-07
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
 Score =  134 bits (340), Expect = 3e-37
 Identities = 67/298 (22%), Positives = 103/298 (34%), Gaps = 69/298 (23%)

Query: 46  KARQEVGSSENLLCV--CAFDPENLWQLYDPLRDLWITLPVLPSKIRHLAHFGVVSTAGK 103
           + R  +   + ++ V   A       + YD   + W  +  LPS        G+V  AG 
Sbjct: 7   RLRTPMNLPKLMVVVGGQAPKAIRSVECYDFKEERWHQVAELPS---RRCRAGMVYMAGL 63

Query: 104 LFVLGGGSDAVDPLTGDQDGSFATNEVWSYDPVTRQWSPRASMLVPRAMFACCALKEKIV 163
           +F +GG            +GS     V SYDPV  QW+  A+M   R+      L   + 
Sbjct: 64  VFAVGG-----------FNGSLRVRTVDSYDPVKDQWTSVANMRDRRSTLGAAVLNGLLY 112

Query: 164 VAGGFTSCRKSISQAEMYDPEKDVWVPIPDLHRTHNSACTGV------VIGGKVHVLHKG 217
             GGF      +S  E Y+ + + W  +  ++   +S   GV       +GG      + 
Sbjct: 113 AVGGFDGST-GLSSVEAYNIKSNEWFHVAPMNTRRSSVGVGVVGGLLYAVGGYDVASRQC 171

Query: 218 LSTVQVLDHMGLGWTVEDYGWLQGPMAIVHDSVYLMSHGLIIKQHRDVRKVVASASEFRR 277
           LSTV+  +     WT                                    +A  S   R
Sbjct: 172 LSTVECYNATTNEWT-----------------------------------YIAEMST--R 194

Query: 278 RIGFAMIGMGDDIYVIGGVIGPDRWNWDIKPMSDVDVLTVGAERPTWRQVSPMTRCRG 335
           R G  +  + + +Y +GG  GP            V+V         WRQV+ M  CR 
Sbjct: 195 RSGAGVGVLNNLLYAVGGHDGPLV-------RKSVEVYDPTTN--AWRQVADMNMCRR 243
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query345
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 99.97
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.96
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.99
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.98
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 98.88
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.55
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.49
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.4
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.38
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 98.31
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.29
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.14
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.12
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.09
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.03
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.98
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.91
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 97.9
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.86
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.82
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.8
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.7
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.65
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.64
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.62
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.59
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.53
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 97.53
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.49
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.45
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 97.45
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 97.43
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 97.39
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.39
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.3
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 97.28
3jrp_A379 Fusion protein of protein transport protein SEC13 97.28
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.28
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.27
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.25
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 97.24
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 97.23
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.21
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.2
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.2
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.19
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 97.16
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.15
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 97.14
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.12
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 97.09
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 97.08
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 97.07
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.05
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 97.0
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 97.0
3v9f_A781 Two-component system sensor histidine kinase/RESP 96.99
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 96.97
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.97
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 96.95
3v9f_A 781 Two-component system sensor histidine kinase/RESP 96.93
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 96.92
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.91
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 96.9
3jrp_A 379 Fusion protein of protein transport protein SEC13 96.89
4g56_B357 MGC81050 protein; protein arginine methyltransfera 96.87
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 96.87
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 96.87
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 96.86
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 96.84
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 96.8
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 96.78
4a2l_A 795 BT_4663, two-component system sensor histidine kin 96.75
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 96.74
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 96.72
3jro_A 753 Fusion protein of protein transport protein SEC13 96.7
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 96.69
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 96.68
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 96.66
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.65
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 96.62
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 96.59
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 96.56
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 96.54
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 96.54
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.53
2pm7_B297 Protein transport protein SEC13, protein transport 96.52
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 96.51
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 96.51
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 96.5
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 96.45
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 96.43
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 96.42
4g56_B357 MGC81050 protein; protein arginine methyltransfera 96.42
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 96.41
4a2l_A795 BT_4663, two-component system sensor histidine kin 96.38
3v65_B386 Low-density lipoprotein receptor-related protein; 96.36
4e54_B435 DNA damage-binding protein 2; beta barrel, double 96.33
3jro_A 753 Fusion protein of protein transport protein SEC13 96.32
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 96.31
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 96.3
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 96.3
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 96.25
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 96.23
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 96.21
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 96.2
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 96.19
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 96.15
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 96.14
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 96.11
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 96.09
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 96.08
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 96.05
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 96.04
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 96.02
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 96.0
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 95.99
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 95.97
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 95.93
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 95.92
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 95.92
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 95.91
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 95.87
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 95.85
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 95.85
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 95.83
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 95.82
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 95.82
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 95.8
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 95.78
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 95.77
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 95.77
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 95.76
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 95.74
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 95.72
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 95.71
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 95.68
3p5b_L400 Low density lipoprotein receptor variant; B-propel 95.66
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 95.66
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 95.65
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 95.57
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 95.52
4e54_B435 DNA damage-binding protein 2; beta barrel, double 95.51
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 95.5
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 95.49
3ott_A758 Two-component system sensor histidine kinase; beta 95.41
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 95.4
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 95.36
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 95.31
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 95.27
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 95.25
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 95.23
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 95.2
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 95.18
2pm7_B297 Protein transport protein SEC13, protein transport 95.15
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 95.02
2p4o_A306 Hypothetical protein; putative lactonase, structur 95.02
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 95.01
3v65_B386 Low-density lipoprotein receptor-related protein; 94.95
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 94.93
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 94.88
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 94.8
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 94.78
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 94.78
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 94.75
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 94.75
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 94.71
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 94.69
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 94.63
2p4o_A306 Hypothetical protein; putative lactonase, structur 94.6
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 94.55
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 94.55
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 94.45
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 94.43
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 94.43
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 94.41
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 94.37
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 94.36
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 94.33
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 94.31
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 94.21
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 94.2
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 94.17
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 94.13
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 94.1
3ott_A758 Two-component system sensor histidine kinase; beta 94.09
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.03
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 93.96
2fp8_A322 Strictosidine synthase; six bladed beta propeller 93.87
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 93.73
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 93.62
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 93.58
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 93.55
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 93.53
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 93.49
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 93.46
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 93.4
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 93.39
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 93.37
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 93.31
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 93.23
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 93.21
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 93.12
2xyi_A430 Probable histone-binding protein CAF1; transcripti 93.02
2ymu_A577 WD-40 repeat protein; unknown function, two domain 92.89
3p5b_L400 Low density lipoprotein receptor variant; B-propel 92.88
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 92.72
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 92.61
2fp8_A322 Strictosidine synthase; six bladed beta propeller 92.54
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 92.53
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 92.45
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 92.26
2ymu_A577 WD-40 repeat protein; unknown function, two domain 92.21
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 92.19
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 91.64
1itv_A195 MMP9; adaptive molecular recognition, beta propell 91.63
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 91.59
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 91.35
3oyo_A225 Hemopexin fold protein CP4; seeds, plant protein; 91.26
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 91.18
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 91.11
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 90.93
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 90.9
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 90.86
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 90.83
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 90.73
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 90.72
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 90.72
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 90.48
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 90.46
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 90.41
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 90.4
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 90.17
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 89.87
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 89.83
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 89.79
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 89.75
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 89.72
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 89.58
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 89.4
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 89.24
1su3_A450 Interstitial collagenase; prodomain, hemopexin dom 89.05
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 88.65
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 88.58
1k32_A 1045 Tricorn protease; protein degradation, substrate g 88.55
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 88.27
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 87.45
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 87.42
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 86.68
3c7x_A196 Matrix metalloproteinase-14; membrane protein inte 86.6
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 86.49
2ece_A462 462AA long hypothetical selenium-binding protein; 85.4
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 84.5
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 83.77
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 83.7
2qe8_A343 Uncharacterized protein; structural genomics, join 83.52
1hxn_A219 Hemopexin, HPX; heme, binding protein; 1.80A {Oryc 82.25
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 81.79
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 81.78
2xyi_A430 Probable histone-binding protein CAF1; transcripti 81.35
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 81.08
3c7x_A196 Matrix metalloproteinase-14; membrane protein inte 80.7
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 80.62
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
Probab=100.00  E-value=1.1e-45  Score=327.22  Aligned_cols=273  Identities=21%  Similarity=0.374  Sum_probs=236.2

Q ss_pred             HHHhcCCCCcEEEEEec---CCCCeEEEEeCCCCCEEeCCCCCccccccceeEEEEECCEEEEEcCCCCCCCCCCCCCCC
Q 019186           47 ARQEVGSSENLLCVCAF---DPENLWQLYDPLRDLWITLPVLPSKIRHLAHFGVVSTAGKLFVLGGGSDAVDPLTGDQDG  123 (345)
Q Consensus        47 ~~~~~~~~~~~l~v~gg---~~~~~~~~yd~~~~~W~~~~~~~~~~~~~~~~~~~~~~~~lyv~GG~~~~~~~~~~~~~~  123 (345)
                      ...+....++.||++||   ...+++++||+.+++|+.++++|.+   |.++++++.+++|||+||.....       ..
T Consensus        16 ~~~~~~~~~~~i~v~GG~~~~~~~~~~~~d~~~~~W~~~~~~p~~---r~~~~~~~~~~~lyv~GG~~~~~-------~~   85 (308)
T 1zgk_A           16 RGSHAPKVGRLIYTAGGYFRQSLSYLEAYNPSNGTWLRLADLQVP---RSGLAGCVVGGLLYAVGGRNNSP-------DG   85 (308)
T ss_dssp             -----CCCCCCEEEECCBSSSBCCCEEEEETTTTEEEECCCCSSC---CBSCEEEEETTEEEEECCEEEET-------TE
T ss_pred             CCccccCCCCEEEEEeCcCCCCcceEEEEcCCCCeEeECCCCCcc---cccceEEEECCEEEEECCCcCCC-------CC
Confidence            33444456899999999   3467899999999999999998876   88999999999999999973100       01


Q ss_pred             CcCcCceEEEeCCCCCcccCCCCCCCceeeeeeEeCCeEEEEcCcCCCCCCCceEEEEeCCCCceEeCCCCCccCCCcee
Q 019186          124 SFATNEVWSYDPVTRQWSPRASMLVPRAMFACCALKEKIVVAGGFTSCRKSISQAEMYDPEKDVWVPIPDLHRTHNSACT  203 (345)
Q Consensus       124 ~~~~~~~~~yd~~t~~W~~~~~~~~~r~~~~~~~~~~~iyv~gG~~~~~~~~~~v~~yd~~~~~W~~~~~~~~~~~~~~~  203 (345)
                      ....+++++||+.+++|+++++++.+|..+++++++++||++||.... ...+++++||+.+++|+.++++|.+ +..++
T Consensus        86 ~~~~~~~~~~d~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~-~~~~~~~~yd~~~~~W~~~~~~p~~-r~~~~  163 (308)
T 1zgk_A           86 NTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGC-IHHNSVERYEPERDEWHLVAPMLTR-RIGVG  163 (308)
T ss_dssp             EEECCCEEEEETTTTEEEECCCCSSCCBTCEEEEETTEEEEECCEETT-EECCCEEEEETTTTEEEECCCCSSC-CBSCE
T ss_pred             CeecceEEEECCCCCeEeECCCCCcCccccEEEEECCEEEEEcCCCCC-cccccEEEECCCCCeEeECCCCCcc-ccceE
Confidence            124688999999999999999999999999999999999999998753 4578899999999999999999999 88999


Q ss_pred             EEEECCEEEEEec-----CcceEEEEECCCCCeeeccCCCC---CCceEEEcCeEEEEeC-------cEEEEecCCc--e
Q 019186          204 GVVIGGKVHVLHK-----GLSTVQVLDHMGLGWTVEDYGWL---QGPMAIVHDSVYLMSH-------GLIIKQHRDV--R  266 (345)
Q Consensus       204 ~~~~~~~iyv~gG-----~~~~i~~yd~~~~~W~~~~~~~~---~~~~~~~~~~l~~~~~-------~~i~~~d~~~--W  266 (345)
                      +++++++||++||     ..+++++||+.+++|+.++.++.   .++++.++++||++||       ..++.||+++  |
T Consensus       164 ~~~~~~~iyv~GG~~~~~~~~~~~~yd~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~v~~yd~~~~~W  243 (308)
T 1zgk_A          164 VAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETW  243 (308)
T ss_dssp             EEEETTEEEEECCBCSSCBCCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCBCSSSBCCCEEEEETTTTEE
T ss_pred             EEEECCEEEEEeCCCCCCcCceEEEEeCCCCeEeeCCCCCCccccceEEEECCEEEEEeCCCCCCccceEEEEeCCCCcE
Confidence            9999999999999     36789999999999999876655   6788889999999998       6799999987  9


Q ss_pred             EEeccchhhcccceeEEEEECCeEEEEcceecCCCCcccccccCceeeeccCCCCCceeEcCCCCCcceeEEeeeee
Q 019186          267 KVVASASEFRRRIGFAMIGMGDDIYVIGGVIGPDRWNWDIKPMSDVDVLTVGAERPTWRQVSPMTRCRGTILGCTQL  343 (345)
Q Consensus       267 ~~~~~~p~~~~r~~~~~~~~~~~l~i~GG~~~~~~~~~~~~~~~~v~~yd~~~~~~~W~~v~~~~~~r~~~~~~~~~  343 (345)
                      ++++.+|  .+|..|+++.++++|||+||.+..       ...+++++||++++  +|.++++||.+|.. ++||++
T Consensus       244 ~~~~~~p--~~r~~~~~~~~~~~i~v~GG~~~~-------~~~~~v~~yd~~~~--~W~~~~~~p~~r~~-~~~~~l  308 (308)
T 1zgk_A          244 TFVAPMK--HRRSALGITVHQGRIYVLGGYDGH-------TFLDSVECYDPDTD--TWSEVTRMTSGRSG-VGVAVT  308 (308)
T ss_dssp             EECCCCS--SCCBSCEEEEETTEEEEECCBCSS-------CBCCEEEEEETTTT--EEEEEEECSSCCBS-CEEEEC
T ss_pred             EECCCCC--CCccceEEEEECCEEEEEcCcCCC-------cccceEEEEcCCCC--EEeecCCCCCCccc-ceeEeC
Confidence            9999887  688999999999999999998764       46789999999999  99999999999998 788764
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3oyo_A Hemopexin fold protein CP4; seeds, plant protein; 2.10A {Vigna unguiculata} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3c7x_A Matrix metalloproteinase-14; membrane protein interaction, Pro-MMP-2, TIMP-2, metastasis, calcium, cleavage on PAIR of basic residues, hydrolase; 1.70A {Homo sapiens} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1hxn_A Hemopexin, HPX; heme, binding protein; 1.80A {Oryctolagus cuniculus} SCOP: b.66.1.1 Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3c7x_A Matrix metalloproteinase-14; membrane protein interaction, Pro-MMP-2, TIMP-2, metastasis, calcium, cleavage on PAIR of basic residues, hydrolase; 1.70A {Homo sapiens} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 345
d1k3ia3 387 b.69.1.1 (A:151-537) Galactose oxidase, central do 1e-11
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 2e-09
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 1e-06
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 7e-05
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-09
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 6e-08
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 5e-07
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 1e-06
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: Galactose oxidase, central domain
family: Galactose oxidase, central domain
domain: Galactose oxidase, central domain
species: Fungi (Fusarium sp.) [TaxId: 29916]

 Score = 62.9 bits (151), Expect = 1e-11
 Identities = 32/199 (16%), Positives = 57/199 (28%), Gaps = 20/199 (10%)

Query: 74  PLRDLWITLPVLPSKIRHLAHFGVVSTAGKLFVLGGGSDAVDPLTGDQDGSFATNEVWSY 133
           P    W     LP      A   +  T+G++ +     +  D   G   G        S+
Sbjct: 6   PGLGRWGPTIDLPIVPAAAA---IEPTSGRVLMWSSYRN--DAFGGSPGG---ITLTSSW 57

Query: 134 DPVTRQWSPRASMLVPRAMFACCALKEKIVVAGG--FTSCRKSISQAEMYDPEKDVWVPI 191
           DP T   S R   +    MF         +   G    +      +  +YD   D W+P 
Sbjct: 58  DPSTGIVSDRTVTVTKHDMFCPGIS----MDGNGQIVVTGGNDAKKTSLYDSSSDSWIPG 113

Query: 192 PDLHRTHNSACTGVVIGGKVHVLHKG------LSTVQVLDHMGLGWTVEDYGWLQGPMAI 245
           PD+        +  +  G+V  +             +V       WT      +   +  
Sbjct: 114 PDMQVARGYQSSATMSDGRVFTIGGSWSGGVFEKNGEVYSPSSKTWTSLPNAKVNPMLTA 173

Query: 246 VHDSVYLMSHGLIIKQHRD 264
               +Y   +   +   + 
Sbjct: 174 DKQGLYRSDNHAWLFGWKK 192
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query345
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.97
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.94
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 98.56
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 97.7
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 97.5
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 97.25
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 97.23
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 97.2
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 97.16
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 97.01
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 96.92
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 96.85
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 96.68
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 96.53
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 96.42
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 96.3
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 96.24
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 96.23
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 96.11
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 96.08
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 96.04
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 95.91
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 95.88
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 95.87
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 95.77
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 95.69
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 95.67
d1tbga_340 beta1-subunit of the signal-transducing G protein 95.67
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 95.67
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 95.62
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 95.41
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 95.41
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 95.39
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 95.27
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 95.24
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 95.17
d1tbga_340 beta1-subunit of the signal-transducing G protein 95.04
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 94.98
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 94.95
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 94.9
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 94.87
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 94.77
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 94.76
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 94.48
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 94.04
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 94.02
d1flga_ 582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 93.93
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 93.57
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 93.51
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 93.31
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 93.16
d1w6sa_ 596 Methanol dehydrogenase, heavy chain {Methylobacter 92.56
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 92.34
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 92.3
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 91.83
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 91.68
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 91.32
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 90.55
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 89.89
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 89.65
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 88.1
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 87.82
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 87.42
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 87.23
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 86.16
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 85.89
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 85.78
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 84.51
d1w6sa_ 596 Methanol dehydrogenase, heavy chain {Methylobacter 82.81
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 82.71
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 82.43
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.6e-42  Score=301.45  Aligned_cols=265  Identities=22%  Similarity=0.386  Sum_probs=232.9

Q ss_pred             CCcEEEEEecC---CCCeEEEEeCCCCCEEeCCCCCccccccceeEEEEECCEEEEEcCCCCCCCCCCCCCCCCcCcCce
Q 019186           54 SENLLCVCAFD---PENLWQLYDPLRDLWITLPVLPSKIRHLAHFGVVSTAGKLFVLGGGSDAVDPLTGDQDGSFATNEV  130 (345)
Q Consensus        54 ~~~~l~v~gg~---~~~~~~~yd~~~~~W~~~~~~~~~~~~~~~~~~~~~~~~lyv~GG~~~~~~~~~~~~~~~~~~~~~  130 (345)
                      .++.||++||.   ..+++++||+.+++|++++++|.+   |.+|++++++++|||+||.....       ......+++
T Consensus         3 ~g~~iyv~GG~~~~~~~~~~~yd~~t~~W~~~~~~p~~---R~~~~~~~~~~~iyv~GG~~~~~-------~~~~~~~~~   72 (288)
T d1zgka1           3 VGRLIYTAGGYFRQSLSYLEAYNPSNGTWLRLADLQVP---RSGLAGCVVGGLLYAVGGRNNSP-------DGNTDSSAL   72 (288)
T ss_dssp             CCCCEEEECCBSSSBCCCEEEEETTTTEEEECCCCSSC---CBSCEEEEETTEEEEECCEEEET-------TEEEECCCE
T ss_pred             cCCEEEEECCcCCCCCceEEEEECCCCeEEECCCCCCc---cceeEEEEECCEEEEEeCcccCC-------CCccccchh
Confidence            47789999993   367899999999999999999886   89999999999999999974321       123357899


Q ss_pred             EEEeCCCCCcccCCCCCCCceeeeeeEeCCeEEEEcCcCCCCCCCceEEEEeCCCCceEeCCCCCccCCCceeEEEECCE
Q 019186          131 WSYDPVTRQWSPRASMLVPRAMFACCALKEKIVVAGGFTSCRKSISQAEMYDPEKDVWVPIPDLHRTHNSACTGVVIGGK  210 (345)
Q Consensus       131 ~~yd~~t~~W~~~~~~~~~r~~~~~~~~~~~iyv~gG~~~~~~~~~~v~~yd~~~~~W~~~~~~~~~~~~~~~~~~~~~~  210 (345)
                      ++||+.+++|+++++++.+|..|+++++++++|++||..+. ...+.++.||+.++.|...+.++.. +..++++.++++
T Consensus        73 ~~yd~~~~~w~~~~~~p~~r~~~~~~~~~~~i~~~gg~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~-r~~~~~~~~~~~  150 (288)
T d1zgka1          73 DCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGC-IHHNSVERYEPERDEWHLVAPMLTR-RIGVGVAVLNRL  150 (288)
T ss_dssp             EEEETTTTEEEECCCCSSCCBTCEEEEETTEEEEECCEETT-EECCCEEEEETTTTEEEECCCCSSC-CBSCEEEEETTE
T ss_pred             hhcccccccccccccccceecceeccccceeeEEecceecc-cccceeeeeccccCccccccccccc-cccceeeeeeec
Confidence            99999999999999999999999999999999999998754 4578899999999999999999988 889999999999


Q ss_pred             EEEEec-----CcceEEEEECCCCCeeeccCCCC---CCceEEEcCeEEEEeC-------cEEEEecCCc--eEEeccch
Q 019186          211 VHVLHK-----GLSTVQVLDHMGLGWTVEDYGWL---QGPMAIVHDSVYLMSH-------GLIIKQHRDV--RKVVASAS  273 (345)
Q Consensus       211 iyv~gG-----~~~~i~~yd~~~~~W~~~~~~~~---~~~~~~~~~~l~~~~~-------~~i~~~d~~~--W~~~~~~p  273 (345)
                      +|++||     ....++.||+.+++|...+..+.   .+.++..+++|+++++       ...+.||..+  |+.++++|
T Consensus       151 ~~~~GG~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~i~i~GG~~~~~~~~~~~~~~~~~~~~~~~~~~p  230 (288)
T d1zgka1         151 LYAVGGFDGTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMK  230 (288)
T ss_dssp             EEEECCBCSSCBCCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCBCSSSBCCCEEEEETTTTEEEECCCCS
T ss_pred             ceEecCcccccccceEEEeeccccccccccccccccccccccceeeeEEEecCccccccccceeeeeecceeeecccCcc
Confidence            999999     46779999999999998876555   6788889999999998       6778888877  99998777


Q ss_pred             hhcccceeEEEEECCeEEEEcceecCCCCcccccccCceeeeccCCCCCceeEcCCCCCcceeEEeeee
Q 019186          274 EFRRRIGFAMIGMGDDIYVIGGVIGPDRWNWDIKPMSDVDVLTVGAERPTWRQVSPMTRCRGTILGCTQ  342 (345)
Q Consensus       274 ~~~~r~~~~~~~~~~~l~i~GG~~~~~~~~~~~~~~~~v~~yd~~~~~~~W~~v~~~~~~r~~~~~~~~  342 (345)
                        .+|..|+++.++++|||+||.+..       ..++++++||++++  +|+++++||.+|.. |++||
T Consensus       231 --~~r~~~~~~~~~~~l~v~GG~~~~-------~~~~~v~~yd~~~~--~W~~~~~~p~~R~~-~~~~~  287 (288)
T d1zgka1         231 --HRRSALGITVHQGRIYVLGGYDGH-------TFLDSVECYDPDTD--TWSEVTRMTSGRSG-VGVAV  287 (288)
T ss_dssp             --SCCBSCEEEEETTEEEEECCBCSS-------CBCCEEEEEETTTT--EEEEEEECSSCCBS-CEEEE
T ss_pred             --CcccceEEEEECCEEEEEecCCCC-------eecceEEEEECCCC--EEEECCCCCCCcEe-EEEEE
Confidence              689999999999999999998765       47789999999999  99999999999988 67665
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure