Citrus Sinensis ID: 019269
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 343 | ||||||
| 356533259 | 411 | PREDICTED: uncharacterized protein LOC10 | 0.895 | 0.746 | 0.781 | 1e-139 | |
| 225441177 | 411 | PREDICTED: uncharacterized protein LOC10 | 0.918 | 0.766 | 0.770 | 1e-139 | |
| 356572480 | 412 | PREDICTED: uncharacterized protein LOC10 | 0.897 | 0.747 | 0.776 | 1e-138 | |
| 147817636 | 465 | hypothetical protein VITISV_004035 [Viti | 0.918 | 0.677 | 0.742 | 1e-136 | |
| 356548347 | 412 | PREDICTED: uncharacterized protein LOC10 | 0.895 | 0.745 | 0.769 | 1e-136 | |
| 224117840 | 412 | predicted protein [Populus trichocarpa] | 0.895 | 0.745 | 0.783 | 1e-136 | |
| 255556900 | 409 | amino acid binding protein, putative [Ri | 0.886 | 0.743 | 0.779 | 1e-133 | |
| 224056635 | 413 | predicted protein [Populus trichocarpa] | 0.965 | 0.801 | 0.721 | 1e-132 | |
| 224105273 | 411 | predicted protein [Populus trichocarpa] | 0.892 | 0.744 | 0.763 | 1e-131 | |
| 357510825 | 405 | hypothetical protein MTR_7g102330 [Medic | 0.877 | 0.743 | 0.745 | 1e-128 |
| >gi|356533259|ref|XP_003535183.1| PREDICTED: uncharacterized protein LOC100789465 [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 502 bits (1292), Expect = e-139, Method: Compositional matrix adjust.
Identities = 240/307 (78%), Positives = 276/307 (89%)
Query: 37 KPSDVFLLKLSCYDRKGLLYDVTAVLCELELTIEKVKISTTPDGKVMDLFFVTDTRELLH 96
KPSDVFLL SC+DRKGLL+DVT VLCELELTI+KVK+STTPDGKVMDLFF+TDTRELLH
Sbjct: 105 KPSDVFLLNFSCHDRKGLLHDVTEVLCELELTIKKVKVSTTPDGKVMDLFFITDTRELLH 164
Query: 97 TRKRKEDTYEHLKTILGNAMISCDVEMVGTEITACSQASSFLPSAIIDMLHLDMPVELPS 156
T+KRK++T EHL I+G+A+IS D+E+VG EITACS+A FLP+AI D+ L++P
Sbjct: 165 TKKRKDETIEHLTEIMGDAIISIDIELVGPEITACSKAPPFLPTAITDIFDLELPDLARG 224
Query: 157 GSLTCSNVSVTIDNSLSPGHTLVQIVCQDHKGLLYDIMRTLKDYNIQVSYGRFSRRQRGN 216
G+L VS+T+DN LSP HTLVQI+CQDHKGLLYDIMRTLKDYNIQ+SYGRF+ + RG
Sbjct: 225 GTLRSDYVSITMDNLLSPAHTLVQIMCQDHKGLLYDIMRTLKDYNIQISYGRFTTKPRGK 284
Query: 217 CEIDLFIMQADGKKIVDPSKQNGLSSRLWMELLQPLRVTVVSRGPDTELLVANPVELSGK 276
CEIDLFIMQADGKKIVDP+KQN LSSRL MELL+PLRV +VSRGPDTELLV+NPVELSGK
Sbjct: 285 CEIDLFIMQADGKKIVDPNKQNSLSSRLRMELLRPLRVAIVSRGPDTELLVSNPVELSGK 344
Query: 277 GRPLVFHDITLALKMLDICIFSAEIGRHMIGDREWEVYRVLLDEGDGLSVPRNKIEEGVW 336
GRPLVF+DITLALKMLD CIFSA+IGRH+IGDREWEVYR+LLDEG+GLSVPRNK+EEGVW
Sbjct: 345 GRPLVFYDITLALKMLDTCIFSAKIGRHLIGDREWEVYRILLDEGEGLSVPRNKVEEGVW 404
Query: 337 KLLMGWE 343
K+LMGWE
Sbjct: 405 KMLMGWE 411
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225441177|ref|XP_002268949.1| PREDICTED: uncharacterized protein LOC100265834 [Vitis vinifera] gi|297739971|emb|CBI30153.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356572480|ref|XP_003554396.1| PREDICTED: uncharacterized protein LOC100818216 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|147817636|emb|CAN64495.1| hypothetical protein VITISV_004035 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356548347|ref|XP_003542564.1| PREDICTED: uncharacterized protein LOC100816138 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224117840|ref|XP_002317681.1| predicted protein [Populus trichocarpa] gi|222860746|gb|EEE98293.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255556900|ref|XP_002519483.1| amino acid binding protein, putative [Ricinus communis] gi|223541346|gb|EEF42897.1| amino acid binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224056635|ref|XP_002298947.1| predicted protein [Populus trichocarpa] gi|222846205|gb|EEE83752.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224105273|ref|XP_002333837.1| predicted protein [Populus trichocarpa] gi|222838705|gb|EEE77070.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357510825|ref|XP_003625701.1| hypothetical protein MTR_7g102330 [Medicago truncatula] gi|355500716|gb|AES81919.1| hypothetical protein MTR_7g102330 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 343 | ||||||
| TAIR|locus:2057936 | 410 | ACR10 "ACT domain repeats 10" | 0.874 | 0.731 | 0.674 | 1.9e-106 | |
| TAIR|locus:2039782 | 411 | ACR9 "ACT domain repeats 9" [A | 0.868 | 0.725 | 0.537 | 1.5e-81 | |
| TAIR|locus:2044289 | 456 | ACR5 "ACT domain repeat 5" [Ar | 0.221 | 0.166 | 0.362 | 1.1e-05 | |
| TAIR|locus:2025317 | 453 | ACR3 "ACT domain repeat 3" [Ar | 0.518 | 0.392 | 0.229 | 1.2e-05 | |
| TAIR|locus:2132609 | 449 | ACR7 "ACT domain repeat 7" [Ar | 0.696 | 0.532 | 0.223 | 0.00012 | |
| TAIR|locus:2034630 | 441 | ACR8 "AT1G12420" [Arabidopsis | 0.626 | 0.487 | 0.243 | 0.00026 | |
| TAIR|locus:2033223 | 455 | ACR4 "ACT domain repeat 4" [Ar | 0.492 | 0.371 | 0.255 | 0.00027 | |
| TAIR|locus:2078678 | 433 | ACR6 "ACT domain repeat 6" [Ar | 0.387 | 0.307 | 0.272 | 0.00042 | |
| TAIR|locus:2152094 | 477 | ACR1 "ACT domain repeat 1" [Ar | 0.134 | 0.096 | 0.428 | 0.00085 |
| TAIR|locus:2057936 ACR10 "ACT domain repeats 10" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1053 (375.7 bits), Expect = 1.9e-106, P = 1.9e-106
Identities = 205/304 (67%), Positives = 244/304 (80%)
Query: 40 DVFLLKLSCYDRKGLLYDVTAVLCELELTIEKVKISTTPDGKVMDLFFVTDTRELLHTRK 99
D+FLLKL+C DR GLLYDVT VL +LE+ IEKVKISTTPDGKVMDLFFVTDTRELL T K
Sbjct: 111 DLFLLKLACSDRTGLLYDVTEVLYKLEINIEKVKISTTPDGKVMDLFFVTDTRELLGTVK 170
Query: 100 RKEDTYEHLKTILGNAMISCDVEMVGTEITACSQASSFLPSAIIDMLHLDMPVELPSGSL 159
R+ + YE+L+ +G++MIS D+E+VG EITACS +SS + + D+ E SG
Sbjct: 171 RRNEVYEYLRDAIGDSMISYDIELVGPEITACSTSSSVAET----LFSSDVSGEHSSGLH 226
Query: 160 TCSNVSVTIDNSLSPGHTLVQIVCQDHKGLLYDIMRTLKDYNIQVSYGRFSRRQRGNCEI 219
T SNVS+ +DNSLS HTL+ I CQDHKGLLYDIMRT KD+NIQ+SYGRF+ + NCEI
Sbjct: 227 TSSNVSIAVDNSLSSAHTLIHITCQDHKGLLYDIMRTFKDFNIQISYGRFTIKLGKNCEI 286
Query: 220 DLFIMQADGKKIVDPSKQNGLSSRLWMELLQPLRVTVVSRGPDTELLVANPVELSGKGRP 279
DLFI+Q+DG+KI+D SK N L +RL EL QPLRV +++RGPDTELLV NPVELSGKGRP
Sbjct: 287 DLFIVQSDGRKILDSSKLNALITRLRAELQQPLRVVMMNRGPDTELLVTNPVELSGKGRP 346
Query: 280 LVFHDITLALKMLDICIFSAEIGRHMIGDREWEVYRVLLDEGDGLSVPRNKIEEGVWKLL 339
VFHDI LALK +D CIFSAEIGRH+ GDREWEVY+VL++E D L +PR+KIEE VWK L
Sbjct: 347 QVFHDIALALKKIDTCIFSAEIGRHVTGDREWEVYKVLINEEDSLPIPRSKIEEEVWKTL 406
Query: 340 MGWE 343
MGWE
Sbjct: 407 MGWE 410
|
|
| TAIR|locus:2039782 ACR9 "ACT domain repeats 9" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2044289 ACR5 "ACT domain repeat 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2025317 ACR3 "ACT domain repeat 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2132609 ACR7 "ACT domain repeat 7" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2034630 ACR8 "AT1G12420" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2033223 ACR4 "ACT domain repeat 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2078678 ACR6 "ACT domain repeat 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2152094 ACR1 "ACT domain repeat 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 343 | |||
| cd04896 | 75 | cd04896, ACT_ACR-like_3, ACT domain-containing pro | 5e-39 | |
| cd04927 | 76 | cd04927, ACT_ACR-like_2, Second ACT domain, of a n | 2e-38 | |
| cd04898 | 77 | cd04898, ACT_ACR-like_4, ACT domain-containing pro | 4e-38 | |
| cd04899 | 70 | cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domain | 2e-15 | |
| cd04873 | 70 | cd04873, ACT_UUR-ACR-like, ACT domains of the bact | 3e-12 | |
| cd04873 | 70 | cd04873, ACT_UUR-ACR-like, ACT domains of the bact | 5e-09 | |
| PRK05092 | 931 | PRK05092, PRK05092, PII uridylyl-transferase; Prov | 5e-09 | |
| COG2844 | 867 | COG2844, GlnD, UTP:GlnB (protein PII) uridylyltran | 1e-08 | |
| cd04873 | 70 | cd04873, ACT_UUR-ACR-like, ACT domains of the bact | 4e-08 | |
| TIGR01693 | 850 | TIGR01693, UTase_glnD, [Protein-PII] uridylyltrans | 3e-07 | |
| cd02116 | 60 | cd02116, ACT, ACT domains are commonly involved in | 1e-06 | |
| cd04900 | 73 | cd04900, ACT_UUR-like_1, ACT domain family, ACT_UU | 9e-06 | |
| cd04926 | 72 | cd04926, ACT_ACR_4, C-terminal ACT domain, of a no | 1e-05 | |
| COG2844 | 867 | COG2844, GlnD, UTP:GlnB (protein PII) uridylyltran | 3e-05 | |
| PRK05092 | 931 | PRK05092, PRK05092, PII uridylyl-transferase; Prov | 5e-05 | |
| PRK01759 | 854 | PRK01759, glnD, PII uridylyl-transferase; Provisio | 7e-05 | |
| cd04876 | 71 | cd04876, ACT_RelA-SpoT, ACT domain found C-termina | 3e-04 | |
| pfam01842 | 66 | pfam01842, ACT, ACT domain | 0.001 | |
| cd04895 | 72 | cd04895, ACT_ACR_1, ACT domain-containing protein | 0.002 | |
| pfam13291 | 77 | pfam13291, ACT_4, ACT domain | 0.002 | |
| PRK00275 | 895 | PRK00275, glnD, PII uridylyl-transferase; Provisio | 0.003 | |
| PRK03059 | 856 | PRK03059, PRK03059, PII uridylyl-transferase; Prov | 0.003 |
| >gnl|CDD|153168 cd04896, ACT_ACR-like_3, ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
Score = 132 bits (334), Expect = 5e-39
Identities = 47/75 (62%), Positives = 59/75 (78%)
Query: 177 TLVQIVCQDHKGLLYDIMRTLKDYNIQVSYGRFSRRQRGNCEIDLFIMQADGKKIVDPSK 236
TL+QI C D KGLLYDI+RT KD NIQ+SYGRFS + +G E+DLFI+Q+DGKKI+DP K
Sbjct: 1 TLLQIRCVDQKGLLYDILRTSKDCNIQISYGRFSSKVKGYREVDLFIVQSDGKKIMDPKK 60
Query: 237 QNGLSSRLWMELLQP 251
Q L +RL E++ P
Sbjct: 61 QAALCARLREEMVCP 75
|
This CD includes the third ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) have been described, however, the ACR-like sequences in this CD are distinct from those characterized. This CD includes the Oryza sativa ACR-like protein (Os05g0113000) encoded on chromosome 5 and the Arabidopsis thaliana predicted gene product, At2g39570. Members of this CD belong to the superfamily of ACT regulatory domains. Length = 75 |
| >gnl|CDD|153199 cd04927, ACT_ACR-like_2, Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >gnl|CDD|153170 cd04898, ACT_ACR-like_4, ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >gnl|CDD|153171 cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >gnl|CDD|153145 cd04873, ACT_UUR-ACR-like, ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD | Back alignment and domain information |
|---|
| >gnl|CDD|153145 cd04873, ACT_UUR-ACR-like, ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD | Back alignment and domain information |
|---|
| >gnl|CDD|235342 PRK05092, PRK05092, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225400 COG2844, GlnD, UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|153145 cd04873, ACT_UUR-ACR-like, ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD | Back alignment and domain information |
|---|
| >gnl|CDD|233534 TIGR01693, UTase_glnD, [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|153139 cd02116, ACT, ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|153172 cd04900, ACT_UUR-like_1, ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >gnl|CDD|153198 cd04926, ACT_ACR_4, C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >gnl|CDD|225400 COG2844, GlnD, UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|235342 PRK05092, PRK05092, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234980 PRK01759, glnD, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|153148 cd04876, ACT_RelA-SpoT, ACT domain found C-terminal of the RelA/SpoT domains | Back alignment and domain information |
|---|
| >gnl|CDD|190133 pfam01842, ACT, ACT domain | Back alignment and domain information |
|---|
| >gnl|CDD|153167 cd04895, ACT_ACR_1, ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >gnl|CDD|222030 pfam13291, ACT_4, ACT domain | Back alignment and domain information |
|---|
| >gnl|CDD|234709 PRK00275, glnD, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235101 PRK03059, PRK03059, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 343 | |||
| PRK01759 | 854 | glnD PII uridylyl-transferase; Provisional | 99.97 | |
| PRK05007 | 884 | PII uridylyl-transferase; Provisional | 99.96 | |
| PRK01759 | 854 | glnD PII uridylyl-transferase; Provisional | 99.96 | |
| PRK05007 | 884 | PII uridylyl-transferase; Provisional | 99.96 | |
| PRK00275 | 895 | glnD PII uridylyl-transferase; Provisional | 99.95 | |
| PRK04374 | 869 | PII uridylyl-transferase; Provisional | 99.95 | |
| PRK03059 | 856 | PII uridylyl-transferase; Provisional | 99.95 | |
| TIGR01693 | 850 | UTase_glnD [Protein-PII] uridylyltransferase. This | 99.94 | |
| PRK05092 | 931 | PII uridylyl-transferase; Provisional | 99.93 | |
| PRK00275 | 895 | glnD PII uridylyl-transferase; Provisional | 99.93 | |
| TIGR01693 | 850 | UTase_glnD [Protein-PII] uridylyltransferase. This | 99.93 | |
| PRK04374 | 869 | PII uridylyl-transferase; Provisional | 99.93 | |
| PRK03381 | 774 | PII uridylyl-transferase; Provisional | 99.92 | |
| PRK03381 | 774 | PII uridylyl-transferase; Provisional | 99.92 | |
| PRK05092 | 931 | PII uridylyl-transferase; Provisional | 99.92 | |
| COG2844 | 867 | GlnD UTP:GlnB (protein PII) uridylyltransferase [P | 99.92 | |
| COG2844 | 867 | GlnD UTP:GlnB (protein PII) uridylyltransferase [P | 99.92 | |
| PRK03059 | 856 | PII uridylyl-transferase; Provisional | 99.91 | |
| cd04895 | 72 | ACT_ACR_1 ACT domain-containing protein which is c | 99.84 | |
| cd04897 | 75 | ACT_ACR_3 ACT domain-containing protein which is c | 99.84 | |
| cd04896 | 75 | ACT_ACR-like_3 ACT domain-containing protein which | 99.77 | |
| cd04897 | 75 | ACT_ACR_3 ACT domain-containing protein which is c | 99.74 | |
| cd04896 | 75 | ACT_ACR-like_3 ACT domain-containing protein which | 99.69 | |
| PRK11589 | 190 | gcvR glycine cleavage system transcriptional repre | 99.68 | |
| cd04895 | 72 | ACT_ACR_1 ACT domain-containing protein which is c | 99.68 | |
| cd04927 | 76 | ACT_ACR-like_2 Second ACT domain, of a novel type | 99.64 | |
| cd04900 | 73 | ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, | 99.63 | |
| cd04925 | 74 | ACT_ACR_2 ACT domain-containing protein which is c | 99.58 | |
| PRK11589 | 190 | gcvR glycine cleavage system transcriptional repre | 99.58 | |
| cd04900 | 73 | ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, | 99.58 | |
| cd04927 | 76 | ACT_ACR-like_2 Second ACT domain, of a novel type | 99.57 | |
| cd04925 | 74 | ACT_ACR_2 ACT domain-containing protein which is c | 99.57 | |
| cd04928 | 68 | ACT_TyrKc Uncharacterized, N-terminal ACT domain o | 99.52 | |
| COG2716 | 176 | GcvR Glycine cleavage system regulatory protein [A | 99.35 | |
| cd04926 | 72 | ACT_ACR_4 C-terminal ACT domain, of a novel type o | 99.33 | |
| cd04926 | 72 | ACT_ACR_4 C-terminal ACT domain, of a novel type o | 99.32 | |
| PRK00227 | 693 | glnD PII uridylyl-transferase; Provisional | 99.32 | |
| cd04928 | 68 | ACT_TyrKc Uncharacterized, N-terminal ACT domain o | 99.31 | |
| COG2716 | 176 | GcvR Glycine cleavage system regulatory protein [A | 99.3 | |
| cd04899 | 70 | ACT_ACR-UUR-like_2 C-terminal ACT domains of the b | 99.25 | |
| PRK00227 | 693 | glnD PII uridylyl-transferase; Provisional | 99.2 | |
| cd04899 | 70 | ACT_ACR-UUR-like_2 C-terminal ACT domains of the b | 99.19 | |
| cd04898 | 77 | ACT_ACR-like_4 ACT domain-containing protein which | 99.01 | |
| cd04873 | 70 | ACT_UUR-ACR-like ACT domains of the bacterial sign | 98.99 | |
| cd04873 | 70 | ACT_UUR-ACR-like ACT domains of the bacterial sign | 98.89 | |
| PF13740 | 76 | ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. | 98.71 | |
| PF13740 | 76 | ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. | 98.65 | |
| cd04894 | 69 | ACT_ACR-like_1 ACT domain-containing protein which | 98.47 | |
| cd04893 | 77 | ACT_GcvR_1 ACT domains that comprise the Glycine C | 98.46 | |
| PF01842 | 66 | ACT: ACT domain; InterPro: IPR002912 The ACT domai | 98.45 | |
| cd04870 | 75 | ACT_PSP_1 CT domains found N-terminal of phosphose | 98.39 | |
| cd04870 | 75 | ACT_PSP_1 CT domains found N-terminal of phosphose | 98.38 | |
| cd04893 | 77 | ACT_GcvR_1 ACT domains that comprise the Glycine C | 98.38 | |
| PF01842 | 66 | ACT: ACT domain; InterPro: IPR002912 The ACT domai | 98.34 | |
| cd04875 | 74 | ACT_F4HF-DF N-terminal ACT domain of formyltetrahy | 98.12 | |
| cd04875 | 74 | ACT_F4HF-DF N-terminal ACT domain of formyltetrahy | 98.04 | |
| cd04872 | 88 | ACT_1ZPV ACT domain proteins similar to the yet un | 98.02 | |
| cd04872 | 88 | ACT_1ZPV ACT domain proteins similar to the yet un | 97.98 | |
| cd04869 | 81 | ACT_GcvR_2 ACT domains that comprise the Glycine C | 97.97 | |
| COG4747 | 142 | ACT domain-containing protein [General function pr | 97.95 | |
| PRK00194 | 90 | hypothetical protein; Validated | 97.94 | |
| cd04869 | 81 | ACT_GcvR_2 ACT domains that comprise the Glycine C | 97.93 | |
| PRK00194 | 90 | hypothetical protein; Validated | 97.91 | |
| COG4747 | 142 | ACT domain-containing protein [General function pr | 97.84 | |
| PRK13011 | 286 | formyltetrahydrofolate deformylase; Reviewed | 97.77 | |
| PRK06027 | 286 | purU formyltetrahydrofolate deformylase; Reviewed | 97.76 | |
| cd04894 | 69 | ACT_ACR-like_1 ACT domain-containing protein which | 97.75 | |
| TIGR00655 | 280 | PurU formyltetrahydrofolate deformylase. This mode | 97.75 | |
| PF13291 | 80 | ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. | 97.74 | |
| PF13291 | 80 | ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. | 97.71 | |
| PRK06027 | 286 | purU formyltetrahydrofolate deformylase; Reviewed | 97.68 | |
| PRK13010 | 289 | purU formyltetrahydrofolate deformylase; Reviewed | 97.64 | |
| COG3830 | 90 | ACT domain-containing protein [Signal transduction | 97.64 | |
| cd04887 | 74 | ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te | 97.61 | |
| PRK13010 | 289 | purU formyltetrahydrofolate deformylase; Reviewed | 97.53 | |
| cd04887 | 74 | ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te | 97.53 | |
| TIGR00655 | 280 | PurU formyltetrahydrofolate deformylase. This mode | 97.52 | |
| PRK13011 | 286 | formyltetrahydrofolate deformylase; Reviewed | 97.45 | |
| COG3830 | 90 | ACT domain-containing protein [Signal transduction | 97.35 | |
| COG0788 | 287 | PurU Formyltetrahydrofolate hydrolase [Nucleotide | 97.32 | |
| cd04889 | 56 | ACT_PDH-BS-like C-terminal ACT domain of the monof | 97.15 | |
| COG0788 | 287 | PurU Formyltetrahydrofolate hydrolase [Nucleotide | 97.15 | |
| cd04886 | 73 | ACT_ThrD-II-like C-terminal ACT domain of biodegra | 97.14 | |
| PRK06737 | 76 | acetolactate synthase 1 regulatory subunit; Valida | 97.14 | |
| PRK13562 | 84 | acetolactate synthase 1 regulatory subunit; Provis | 97.12 | |
| PRK08178 | 96 | acetolactate synthase 1 regulatory subunit; Review | 97.04 | |
| PRK08178 | 96 | acetolactate synthase 1 regulatory subunit; Review | 97.03 | |
| CHL00100 | 174 | ilvH acetohydroxyacid synthase small subunit | 97.02 | |
| cd04886 | 73 | ACT_ThrD-II-like C-terminal ACT domain of biodegra | 97.0 | |
| cd04909 | 69 | ACT_PDH-BS C-terminal ACT domain of the monofuncti | 96.98 | |
| PRK06737 | 76 | acetolactate synthase 1 regulatory subunit; Valida | 96.95 | |
| cd04878 | 72 | ACT_AHAS N-terminal ACT domain of the Escherichia | 96.94 | |
| cd04908 | 66 | ACT_Bt0572_1 N-terminal ACT domain of a novel prot | 96.92 | |
| cd04889 | 56 | ACT_PDH-BS-like C-terminal ACT domain of the monof | 96.92 | |
| cd04879 | 71 | ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te | 96.91 | |
| TIGR00119 | 157 | acolac_sm acetolactate synthase, small subunit. ac | 96.89 | |
| cd04877 | 74 | ACT_TyrR N-terminal ACT domain of the TyrR protein | 96.86 | |
| TIGR00119 | 157 | acolac_sm acetolactate synthase, small subunit. ac | 96.84 | |
| PRK11895 | 161 | ilvH acetolactate synthase 3 regulatory subunit; R | 96.82 | |
| cd04881 | 79 | ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin | 96.82 | |
| cd04888 | 76 | ACT_PheB-BS C-terminal ACT domain of a small (~147 | 96.81 | |
| PRK11895 | 161 | ilvH acetolactate synthase 3 regulatory subunit; R | 96.81 | |
| cd04888 | 76 | ACT_PheB-BS C-terminal ACT domain of a small (~147 | 96.81 | |
| cd04905 | 80 | ACT_CM-PDT C-terminal ACT domain of the bifunction | 96.81 | |
| cd04877 | 74 | ACT_TyrR N-terminal ACT domain of the TyrR protein | 96.74 | |
| cd04881 | 79 | ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin | 96.72 | |
| PRK11152 | 76 | ilvM acetolactate synthase 2 regulatory subunit; P | 96.72 | |
| cd04908 | 66 | ACT_Bt0572_1 N-terminal ACT domain of a novel prot | 96.72 | |
| cd04874 | 72 | ACT_Af1403 N-terminal ACT domain of the yet unchar | 96.69 | |
| PRK07431 | 587 | aspartate kinase; Provisional | 96.69 | |
| PRK13562 | 84 | acetolactate synthase 1 regulatory subunit; Provis | 96.68 | |
| PRK08577 | 136 | hypothetical protein; Provisional | 96.67 | |
| cd04903 | 71 | ACT_LSD C-terminal ACT domain of the L-serine dehy | 96.66 | |
| cd04878 | 72 | ACT_AHAS N-terminal ACT domain of the Escherichia | 96.62 | |
| cd04909 | 69 | ACT_PDH-BS C-terminal ACT domain of the monofuncti | 96.55 | |
| cd04905 | 80 | ACT_CM-PDT C-terminal ACT domain of the bifunction | 96.51 | |
| PRK11152 | 76 | ilvM acetolactate synthase 2 regulatory subunit; P | 96.5 | |
| cd04882 | 65 | ACT_Bt0572_2 C-terminal ACT domain of a novel prot | 96.44 | |
| CHL00100 | 174 | ilvH acetohydroxyacid synthase small subunit | 96.41 | |
| cd04879 | 71 | ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te | 96.41 | |
| cd04902 | 73 | ACT_3PGDH-xct C-terminal ACT (regulatory) domain o | 96.39 | |
| cd04903 | 71 | ACT_LSD C-terminal ACT domain of the L-serine dehy | 96.39 | |
| cd04882 | 65 | ACT_Bt0572_2 C-terminal ACT domain of a novel prot | 96.35 | |
| cd04884 | 72 | ACT_CBS C-terminal ACT domain of the cystathionine | 96.3 | |
| cd04901 | 69 | ACT_3PGDH C-terminal ACT (regulatory) domain of D- | 96.29 | |
| cd04876 | 71 | ACT_RelA-SpoT ACT domain found C-terminal of the R | 96.27 | |
| PRK04435 | 147 | hypothetical protein; Provisional | 96.23 | |
| PRK08577 | 136 | hypothetical protein; Provisional | 96.22 | |
| cd04880 | 75 | ACT_AAAH-PDT-like ACT domain of the nonheme iron-d | 96.11 | |
| PRK07431 | 587 | aspartate kinase; Provisional | 96.1 | |
| cd02116 | 60 | ACT ACT domains are commonly involved in specifica | 96.08 | |
| PRK04435 | 147 | hypothetical protein; Provisional | 96.06 | |
| cd04902 | 73 | ACT_3PGDH-xct C-terminal ACT (regulatory) domain o | 96.05 | |
| cd02116 | 60 | ACT ACT domains are commonly involved in specifica | 96.02 | |
| cd04898 | 77 | ACT_ACR-like_4 ACT domain-containing protein which | 95.99 | |
| cd04874 | 72 | ACT_Af1403 N-terminal ACT domain of the yet unchar | 95.81 | |
| cd04876 | 71 | ACT_RelA-SpoT ACT domain found C-terminal of the R | 95.78 | |
| cd04901 | 69 | ACT_3PGDH C-terminal ACT (regulatory) domain of D- | 95.7 | |
| PRK06635 | 404 | aspartate kinase; Reviewed | 95.7 | |
| cd04931 | 90 | ACT_PAH ACT domain of the nonheme iron-dependent a | 95.64 | |
| cd04883 | 72 | ACT_AcuB C-terminal ACT domain of the Bacillus sub | 95.59 | |
| PF13710 | 63 | ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. | 95.53 | |
| cd04883 | 72 | ACT_AcuB C-terminal ACT domain of the Bacillus sub | 95.42 | |
| cd04884 | 72 | ACT_CBS C-terminal ACT domain of the cystathionine | 95.4 | |
| cd04931 | 90 | ACT_PAH ACT domain of the nonheme iron-dependent a | 95.33 | |
| TIGR00719 | 208 | sda_beta L-serine dehydratase, iron-sulfur-depende | 95.24 | |
| cd04880 | 75 | ACT_AAAH-PDT-like ACT domain of the nonheme iron-d | 95.14 | |
| PRK07334 | 403 | threonine dehydratase; Provisional | 95.1 | |
| cd04904 | 74 | ACT_AAAH ACT domain of the nonheme iron-dependent, | 95.08 | |
| cd04929 | 74 | ACT_TPH ACT domain of the nonheme iron-dependent a | 95.06 | |
| PRK07334 | 403 | threonine dehydratase; Provisional | 95.06 | |
| PF13710 | 63 | ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. | 95.04 | |
| PRK06635 | 404 | aspartate kinase; Reviewed | 94.95 | |
| PRK10872 | 743 | relA (p)ppGpp synthetase I/GTP pyrophosphokinase; | 94.84 | |
| cd04871 | 84 | ACT_PSP_2 ACT domains found N-terminal of phosphos | 94.81 | |
| TIGR00719 | 208 | sda_beta L-serine dehydratase, iron-sulfur-depende | 94.6 | |
| TIGR00656 | 401 | asp_kin_monofn aspartate kinase, monofunctional cl | 94.56 | |
| COG1707 | 218 | ACT domain-containing protein [General function pr | 94.28 | |
| PRK10872 | 743 | relA (p)ppGpp synthetase I/GTP pyrophosphokinase; | 94.18 | |
| PRK11092 | 702 | bifunctional (p)ppGpp synthetase II/ guanosine-3', | 94.08 | |
| TIGR00656 | 401 | asp_kin_monofn aspartate kinase, monofunctional cl | 94.05 | |
| PRK11092 | 702 | bifunctional (p)ppGpp synthetase II/ guanosine-3', | 93.96 | |
| cd04904 | 74 | ACT_AAAH ACT domain of the nonheme iron-dependent, | 93.84 | |
| PRK11899 | 279 | prephenate dehydratase; Provisional | 93.73 | |
| COG1707 | 218 | ACT domain-containing protein [General function pr | 93.61 | |
| TIGR00691 | 683 | spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( | 93.28 | |
| PRK06291 | 465 | aspartate kinase; Provisional | 93.26 | |
| TIGR00691 | 683 | spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( | 93.23 | |
| cd04871 | 84 | ACT_PSP_2 ACT domains found N-terminal of phosphos | 93.12 | |
| cd04930 | 115 | ACT_TH ACT domain of the nonheme iron-dependent ar | 93.06 | |
| PRK11899 | 279 | prephenate dehydratase; Provisional | 93.06 | |
| cd04885 | 68 | ACT_ThrD-I Tandem C-terminal ACT domains of threon | 93.0 | |
| PRK11790 | 409 | D-3-phosphoglycerate dehydrogenase; Provisional | 92.75 | |
| PRK06291 | 465 | aspartate kinase; Provisional | 92.62 | |
| PRK08210 | 403 | aspartate kinase I; Reviewed | 92.51 | |
| PRK06382 | 406 | threonine dehydratase; Provisional | 92.17 | |
| COG0077 | 279 | PheA Prephenate dehydratase [Amino acid transport | 92.01 | |
| PF13840 | 65 | ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2 | 91.99 | |
| PRK11790 | 409 | D-3-phosphoglycerate dehydrogenase; Provisional | 91.91 | |
| COG0317 | 701 | SpoT Guanosine polyphosphate pyrophosphohydrolases | 91.89 | |
| PLN02551 | 521 | aspartokinase | 91.79 | |
| COG0317 | 701 | SpoT Guanosine polyphosphate pyrophosphohydrolases | 91.7 | |
| cd04929 | 74 | ACT_TPH ACT domain of the nonheme iron-dependent a | 91.41 | |
| PRK08210 | 403 | aspartate kinase I; Reviewed | 91.31 | |
| cd04930 | 115 | ACT_TH ACT domain of the nonheme iron-dependent ar | 90.61 | |
| COG0527 | 447 | LysC Aspartokinases [Amino acid transport and meta | 90.58 | |
| cd04906 | 85 | ACT_ThrD-I_1 First of two tandem C-terminal ACT do | 90.55 | |
| PRK09034 | 454 | aspartate kinase; Reviewed | 90.45 | |
| COG0077 | 279 | PheA Prephenate dehydratase [Amino acid transport | 90.45 | |
| cd04885 | 68 | ACT_ThrD-I Tandem C-terminal ACT domains of threon | 90.31 | |
| PLN02551 | 521 | aspartokinase | 90.25 | |
| PRK13581 | 526 | D-3-phosphoglycerate dehydrogenase; Provisional | 90.02 | |
| PRK09436 | 819 | thrA bifunctional aspartokinase I/homoserine dehyd | 89.91 | |
| COG0440 | 163 | IlvH Acetolactate synthase, small (regulatory) sub | 89.84 | |
| PRK10622 | 386 | pheA bifunctional chorismate mutase/prephenate deh | 89.32 | |
| PRK09181 | 475 | aspartate kinase; Validated | 89.3 | |
| PF13840 | 65 | ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2 | 89.24 | |
| TIGR01327 | 525 | PGDH D-3-phosphoglycerate dehydrogenase. This mode | 89.23 | |
| PRK06545 | 359 | prephenate dehydrogenase; Validated | 89.11 | |
| PRK09084 | 448 | aspartate kinase III; Validated | 89.09 | |
| COG0440 | 163 | IlvH Acetolactate synthase, small (regulatory) sub | 88.88 | |
| PRK09181 | 475 | aspartate kinase; Validated | 88.76 | |
| TIGR00657 | 441 | asp_kinases aspartate kinase. The Lys-sensitive en | 88.54 | |
| PRK10622 | 386 | pheA bifunctional chorismate mutase/prephenate deh | 88.35 | |
| PRK06349 | 426 | homoserine dehydrogenase; Provisional | 88.25 | |
| PRK06382 | 406 | threonine dehydratase; Provisional | 88.06 | |
| TIGR01327 | 525 | PGDH D-3-phosphoglycerate dehydrogenase. This mode | 87.93 | |
| PRK13581 | 526 | D-3-phosphoglycerate dehydrogenase; Provisional | 87.81 | |
| PRK08198 | 404 | threonine dehydratase; Provisional | 87.23 | |
| cd04906 | 85 | ACT_ThrD-I_1 First of two tandem C-terminal ACT do | 87.23 | |
| TIGR01127 | 380 | ilvA_1Cterm threonine dehydratase, medium form. A | 86.33 | |
| PRK08818 | 370 | prephenate dehydrogenase; Provisional | 86.31 | |
| TIGR01127 | 380 | ilvA_1Cterm threonine dehydratase, medium form. A | 86.03 | |
| PRK09436 | 819 | thrA bifunctional aspartokinase I/homoserine dehyd | 86.01 | |
| PRK09034 | 454 | aspartate kinase; Reviewed | 84.8 | |
| PRK08818 | 370 | prephenate dehydrogenase; Provisional | 84.54 | |
| KOG2663 | 309 | consensus Acetolactate synthase, small subunit [Am | 84.43 | |
| PF05088 | 1528 | Bac_GDH: Bacterial NAD-glutamate dehydrogenase | 83.98 | |
| PRK08198 | 404 | threonine dehydratase; Provisional | 83.95 | |
| cd04935 | 75 | ACT_AKiii-DAPDC_1 ACT domains of a bifunctional AK | 83.71 | |
| cd04891 | 61 | ACT_AK-LysC-DapG-like_1 ACT domains of the lysine- | 83.53 | |
| PRK09084 | 448 | aspartate kinase III; Validated | 83.49 | |
| COG2150 | 167 | Predicted regulator of amino acid metabolism, cont | 82.33 | |
| cd04913 | 75 | ACT_AKii-LysC-BS-like_1 ACT domains of the lysine- | 82.3 | |
| cd04932 | 75 | ACT_AKiii-LysC-EC_1 ACT domains located C-terminal | 82.08 | |
| cd04932 | 75 | ACT_AKiii-LysC-EC_1 ACT domains located C-terminal | 81.87 | |
| COG2150 | 167 | Predicted regulator of amino acid metabolism, cont | 81.82 | |
| TIGR00657 | 441 | asp_kinases aspartate kinase. The Lys-sensitive en | 81.77 | |
| COG4492 | 150 | PheB ACT domain-containing protein [General functi | 81.01 | |
| PRK06545 | 359 | prephenate dehydrogenase; Validated | 80.96 | |
| PLN02317 | 382 | arogenate dehydratase | 80.62 | |
| cd04912 | 75 | ACT_AKiii-LysC-EC-like_1 ACT domains located C-ter | 80.6 | |
| cd04890 | 62 | ACT_AK-like_1 ACT domains found C-terminal to the | 80.25 |
| >PRK01759 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
Probab=99.97 E-value=6.8e-29 Score=263.49 Aligned_cols=174 Identities=19% Similarity=0.299 Sum_probs=151.6
Q ss_pred CCccEEEEEeCCCCCeEEEEEEECCcccHHHHHHHHHHhCCeeEEEEEEEEeecCCEEEEEEEEe-cCCCCCCChHHHHH
Q 019269 161 CSNVSVTIDNSLSPGHTLVQIVCQDHKGLLYDIMRTLKDYNIQVSYGRFSRRQRGNCEIDLFIMQ-ADGKKIVDPSKQNG 239 (343)
Q Consensus 161 ~~~~~V~i~~~~~~~~t~i~V~~~DrpGLl~~i~~~L~~~glnI~~A~i~t~t~g~~~~d~F~v~-~~g~~i~~~~~~~~ 239 (343)
..++.|.++++.+.++|+|+|+++||||||++|+++|+.+|+||++|+|.| +.+++++|+|+|. .+|.++. ++++++
T Consensus 662 ~~~~~V~i~~~~~~~~t~V~V~~~DrpGLfa~Ia~~L~~~~L~I~~A~I~T-~~~g~alD~F~V~d~~g~~~~-~~~~~~ 739 (854)
T PRK01759 662 RGDLLVKISNRFSRGGTEIFIYCQDQANLFLKVVSTIGAKKLSIHDAQIIT-SQDGYVLDSFIVTELNGKLLE-FDRRRQ 739 (854)
T ss_pred CCCCEEEEEecCCCCeEEEEEEecCCccHHHHHHHHHHHCCCeEEEEEEEE-ccCCEEEEEEEEeCCCCCCCC-HHHHHH
Confidence 346788899999999999999999999999999999999999999999996 5889999999997 6788875 668899
Q ss_pred HHHHHHHHHcCCcceee---ecC-----CCCceeeee-------eeEEEEeCCCccHHHHHHHHHHhCCceEEEEEeecc
Q 019269 240 LSSRLWMELLQPLRVTV---VSR-----GPDTELLVA-------NPVELSGKGRPLVFHDITLALKMLDICIFSAEIGRH 304 (343)
Q Consensus 240 l~~~L~~~L~~~~~~~~---~~~-----~~~~~v~~~-------~~ieV~~~DrpGLL~~I~~~l~~~gi~I~~AkI~~~ 304 (343)
|++.|.++|.++..... .++ ..+++|.++ |+|+|.|.|||||||+|+++|.++|++|++|||+
T Consensus 740 l~~~L~~aL~~~~~~~~~~~~~~~~~~~~~~~~V~~dn~~s~~~T~iev~a~DrpGLL~~I~~~l~~~~l~i~~AkI~-- 817 (854)
T PRK01759 740 LEQALTKALNTNKLKKLNLEENHKLQHFHVKTEVRFLNEEKQEQTEMELFALDRAGLLAQVSQVFSELNLNLLNAKIT-- 817 (854)
T ss_pred HHHHHHHHHcCCCCcchhccccccccCCCCCCEEEEccCCCCCeEEEEEEeCCchHHHHHHHHHHHHCCCEEEEEEEc--
Confidence 99999999987653321 111 125777764 6899999999999999999999999999999999
Q ss_pred ccCceEeeeeEEEEEcCCCCCCCchHHHHHHHHHHcC
Q 019269 305 MIGDREWEVYRVLLDEGDGLSVPRNKIEEGVWKLLMG 341 (343)
Q Consensus 305 T~g~~~~dv~~F~v~~~~g~~l~~~~~~~~l~~~L~~ 341 (343)
|.|+||+|+ |||+|.+|+|++++.+ ++|+++|+.
T Consensus 818 T~gerv~D~--Fyv~~~~g~~l~~~~~-~~l~~~L~~ 851 (854)
T PRK01759 818 TIGEKAEDF--FILTNQQGQALDEEER-KALKSRLLS 851 (854)
T ss_pred ccCceEEEE--EEEECCCCCcCChHHH-HHHHHHHHH
Confidence 999999999 9999999999997744 999998863
|
|
| >PRK05007 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK01759 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK05007 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK00275 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK04374 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK03059 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >PRK05092 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK00275 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >PRK04374 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK03381 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK03381 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK05092 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK03059 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional | Back alignment and domain information |
|---|
| >cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional | Back alignment and domain information |
|---|
| >cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains | Back alignment and domain information |
|---|
| >COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >PRK00227 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains | Back alignment and domain information |
|---|
| >COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >PRK00227 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >cd04898 ACT_ACR-like_4 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD | Back alignment and domain information |
|---|
| >cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD | Back alignment and domain information |
|---|
| >PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A | Back alignment and domain information |
|---|
| >PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A | Back alignment and domain information |
|---|
| >cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold | Back alignment and domain information |
|---|
| >cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) | Back alignment and domain information |
|---|
| >cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) | Back alignment and domain information |
|---|
| >cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold | Back alignment and domain information |
|---|
| >cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) | Back alignment and domain information |
|---|
| >cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) | Back alignment and domain information |
|---|
| >cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein | Back alignment and domain information |
|---|
| >cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein | Back alignment and domain information |
|---|
| >cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >COG4747 ACT domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00194 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >PRK00194 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG4747 ACT domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13011 formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >PRK06027 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >TIGR00655 PurU formyltetrahydrofolate deformylase | Back alignment and domain information |
|---|
| >PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A | Back alignment and domain information |
|---|
| >PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A | Back alignment and domain information |
|---|
| >PRK06027 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >PRK13010 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >COG3830 ACT domain-containing protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains | Back alignment and domain information |
|---|
| >PRK13010 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains | Back alignment and domain information |
|---|
| >TIGR00655 PurU formyltetrahydrofolate deformylase | Back alignment and domain information |
|---|
| >PRK13011 formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >COG3830 ACT domain-containing protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate | Back alignment and domain information |
|---|
| >COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains | Back alignment and domain information |
|---|
| >PRK06737 acetolactate synthase 1 regulatory subunit; Validated | Back alignment and domain information |
|---|
| >PRK13562 acetolactate synthase 1 regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed | Back alignment and domain information |
|---|
| >CHL00100 ilvH acetohydroxyacid synthase small subunit | Back alignment and domain information |
|---|
| >cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains | Back alignment and domain information |
|---|
| >cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) | Back alignment and domain information |
|---|
| >PRK06737 acetolactate synthase 1 regulatory subunit; Validated | Back alignment and domain information |
|---|
| >cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) | Back alignment and domain information |
|---|
| >cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains | Back alignment and domain information |
|---|
| >cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate | Back alignment and domain information |
|---|
| >cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >TIGR00119 acolac_sm acetolactate synthase, small subunit | Back alignment and domain information |
|---|
| >cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein | Back alignment and domain information |
|---|
| >TIGR00119 acolac_sm acetolactate synthase, small subunit | Back alignment and domain information |
|---|
| >PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed | Back alignment and domain information |
|---|
| >cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains | Back alignment and domain information |
|---|
| >cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a | Back alignment and domain information |
|---|
| >PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed | Back alignment and domain information |
|---|
| >cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a | Back alignment and domain information |
|---|
| >cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme | Back alignment and domain information |
|---|
| >cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein | Back alignment and domain information |
|---|
| >cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains | Back alignment and domain information |
|---|
| >PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains | Back alignment and domain information |
|---|
| >cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a | Back alignment and domain information |
|---|
| >PRK07431 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13562 acetolactate synthase 1 regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08577 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit | Back alignment and domain information |
|---|
| >cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) | Back alignment and domain information |
|---|
| >cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) | Back alignment and domain information |
|---|
| >cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme | Back alignment and domain information |
|---|
| >PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains | Back alignment and domain information |
|---|
| >CHL00100 ilvH acetohydroxyacid synthase small subunit | Back alignment and domain information |
|---|
| >cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit | Back alignment and domain information |
|---|
| >cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains | Back alignment and domain information |
|---|
| >cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria | Back alignment and domain information |
|---|
| >cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria | Back alignment and domain information |
|---|
| >cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains | Back alignment and domain information |
|---|
| >PRK04435 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08577 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >PRK07431 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme | Back alignment and domain information |
|---|
| >PRK04435 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme | Back alignment and domain information |
|---|
| >cd04898 ACT_ACR-like_4 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a | Back alignment and domain information |
|---|
| >cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains | Back alignment and domain information |
|---|
| >cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria | Back alignment and domain information |
|---|
| >PRK06635 aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) | Back alignment and domain information |
|---|
| >cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB | Back alignment and domain information |
|---|
| >PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B | Back alignment and domain information |
|---|
| >cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB | Back alignment and domain information |
|---|
| >cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria | Back alignment and domain information |
|---|
| >cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) | Back alignment and domain information |
|---|
| >TIGR00719 sda_beta L-serine dehydratase, iron-sulfur-dependent, beta subunit | Back alignment and domain information |
|---|
| >cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >PRK07334 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes | Back alignment and domain information |
|---|
| >PRK07334 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B | Back alignment and domain information |
|---|
| >PRK06635 aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >cd04871 ACT_PSP_2 ACT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) | Back alignment and domain information |
|---|
| >TIGR00719 sda_beta L-serine dehydratase, iron-sulfur-dependent, beta subunit | Back alignment and domain information |
|---|
| >TIGR00656 asp_kin_monofn aspartate kinase, monofunctional class | Back alignment and domain information |
|---|
| >COG1707 ACT domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR00656 asp_kin_monofn aspartate kinase, monofunctional class | Back alignment and domain information |
|---|
| >PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >PRK11899 prephenate dehydratase; Provisional | Back alignment and domain information |
|---|
| >COG1707 ACT domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family | Back alignment and domain information |
|---|
| >PRK06291 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family | Back alignment and domain information |
|---|
| >cd04871 ACT_PSP_2 ACT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) | Back alignment and domain information |
|---|
| >cd04930 ACT_TH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH) | Back alignment and domain information |
|---|
| >PRK11899 prephenate dehydratase; Provisional | Back alignment and domain information |
|---|
| >cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) | Back alignment and domain information |
|---|
| >PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06291 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08210 aspartate kinase I; Reviewed | Back alignment and domain information |
|---|
| >PRK06382 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >COG0077 PheA Prephenate dehydratase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13840 ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2_O 2DTJ_A 3AAW_A 2RE1_B 3MAH_A 1ZVP_D | Back alignment and domain information |
|---|
| >PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >PLN02551 aspartokinase | Back alignment and domain information |
|---|
| >COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes | Back alignment and domain information |
|---|
| >PRK08210 aspartate kinase I; Reviewed | Back alignment and domain information |
|---|
| >cd04930 ACT_TH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH) | Back alignment and domain information |
|---|
| >COG0527 LysC Aspartokinases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04906 ACT_ThrD-I_1 First of two tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) | Back alignment and domain information |
|---|
| >PRK09034 aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >COG0077 PheA Prephenate dehydratase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) | Back alignment and domain information |
|---|
| >PLN02551 aspartokinase | Back alignment and domain information |
|---|
| >PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional | Back alignment and domain information |
|---|
| >COG0440 IlvH Acetolactate synthase, small (regulatory) subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10622 pheA bifunctional chorismate mutase/prephenate dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK09181 aspartate kinase; Validated | Back alignment and domain information |
|---|
| >PF13840 ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2_O 2DTJ_A 3AAW_A 2RE1_B 3MAH_A 1ZVP_D | Back alignment and domain information |
|---|
| >TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase | Back alignment and domain information |
|---|
| >PRK06545 prephenate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK09084 aspartate kinase III; Validated | Back alignment and domain information |
|---|
| >COG0440 IlvH Acetolactate synthase, small (regulatory) subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09181 aspartate kinase; Validated | Back alignment and domain information |
|---|
| >TIGR00657 asp_kinases aspartate kinase | Back alignment and domain information |
|---|
| >PRK10622 pheA bifunctional chorismate mutase/prephenate dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06349 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06382 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase | Back alignment and domain information |
|---|
| >PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08198 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >cd04906 ACT_ThrD-I_1 First of two tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) | Back alignment and domain information |
|---|
| >TIGR01127 ilvA_1Cterm threonine dehydratase, medium form | Back alignment and domain information |
|---|
| >PRK08818 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01127 ilvA_1Cterm threonine dehydratase, medium form | Back alignment and domain information |
|---|
| >PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional | Back alignment and domain information |
|---|
| >PRK09034 aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK08818 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG2663 consensus Acetolactate synthase, small subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF05088 Bac_GDH: Bacterial NAD-glutamate dehydrogenase | Back alignment and domain information |
|---|
| >PRK08198 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >cd04935 ACT_AKiii-DAPDC_1 ACT domains of a bifunctional AKIII (LysC)-like aspartokinase/meso-diaminopimelate decarboxylase (DAPDC) bacterial protein | Back alignment and domain information |
|---|
| >cd04891 ACT_AK-LysC-DapG-like_1 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII and related proteins | Back alignment and domain information |
|---|
| >PRK09084 aspartate kinase III; Validated | Back alignment and domain information |
|---|
| >COG2150 Predicted regulator of amino acid metabolism, contains ACT domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd04913 ACT_AKii-LysC-BS-like_1 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related proteins | Back alignment and domain information |
|---|
| >cd04932 ACT_AKiii-LysC-EC_1 ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII | Back alignment and domain information |
|---|
| >cd04932 ACT_AKiii-LysC-EC_1 ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII | Back alignment and domain information |
|---|
| >COG2150 Predicted regulator of amino acid metabolism, contains ACT domain [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00657 asp_kinases aspartate kinase | Back alignment and domain information |
|---|
| >COG4492 PheB ACT domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06545 prephenate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02317 arogenate dehydratase | Back alignment and domain information |
|---|
| >cd04912 ACT_AKiii-LysC-EC-like_1 ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII | Back alignment and domain information |
|---|
| >cd04890 ACT_AK-like_1 ACT domains found C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 343 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-07 | |
| 2ko1_A | 88 | CTR148A, GTP pyrophosphokinase; homodimer, alpha+b | 1e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 52.2 bits (124), Expect = 2e-07
Identities = 63/409 (15%), Positives = 113/409 (27%), Gaps = 132/409 (32%)
Query: 2 VLHSVLGDWG---LTNKVGFIEEETDGCMPFLFFSFSPKPSDVFLLKLSCYDRKG----- 53
++ VLG G + V + + M F +F L L +
Sbjct: 154 LIDGVLG-SGKTWVALDV-CLSYKVQCKMDF----------KIFWLNLKNCNSPETVLEM 201
Query: 54 ---LLYDVTAVLCE-------LELTIEKVK------ISTTP------------DGKVMDL 85
LLY + ++L I ++ + + P + K +
Sbjct: 202 LQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLLNVQNAKAWNA 261
Query: 86 F------FVTDTRELLHTRKRKEDTYEHLKTILGNAMISCDVEMVGTEITACSQASSFLP 139
F +T TR T T H+ M T + S L
Sbjct: 262 FNLSCKILLT-TRFKQVTDFLSAATTTHISLD--------HHSMTLTP----DEVKSLL- 307
Query: 140 SAIIDMLHLDMPVELPSGS-LTCSNVSVTIDNSLSPGHTLVQIVCQDHKGLLYDIMRTLK 198
+D D+P E+ + + S ++ +I + L+ + C ++ + L+
Sbjct: 308 LKYLDCRPQDLPREVLTTNPRRLSIIAESIRDGLATWDNWKHVNCDKLTTIIESSLNVLE 367
Query: 199 DYNIQVSYGRFSRRQRGNCEIDLFIMQADGKKIVDPSKQNGLSSRLWMELLQPLRVTVVS 258
+ + L + I P+ L S +W ++ +
Sbjct: 368 PAEYRKMF------------DRLSVFPPS-AHI--PTI---LLSLIWFDV-----IKSDV 404
Query: 259 RGPDTELLVANPVELSGKGRPLVFHDITLALKM--------------------------- 291
+L + VE K + I L LK+
Sbjct: 405 MVVVNKLHKYSLVEKQPKESTISIPSIYLELKVKLENEYALHRSIVDHYNIPKTFDSDDL 464
Query: 292 ----LDICIFSAEIGRHMIG---DREWEVYR-VLLDEGDGLSVPRNKIE 332
LD +S IG H+ ++R V LD KI
Sbjct: 465 IPPYLDQYFYS-HIGHHLKNIEHPERMTLFRMVFLD----FRFLEQKIR 508
|
| >2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Length = 88 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 343 | |||
| 2nyi_A | 195 | Unknown protein; protein structure initiative, PSI | 99.75 | |
| 2nyi_A | 195 | Unknown protein; protein structure initiative, PSI | 99.75 | |
| 1u8s_A | 192 | Glycine cleavage system transcriptional repressor, | 99.7 | |
| 1u8s_A | 192 | Glycine cleavage system transcriptional repressor, | 99.68 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 98.82 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 98.82 | |
| 2f06_A | 144 | Conserved hypothetical protein; structural genomic | 98.3 | |
| 1zpv_A | 91 | ACT domain protein; structural genomics, PSI, prot | 98.19 | |
| 1zpv_A | 91 | ACT domain protein; structural genomics, PSI, prot | 98.15 | |
| 2f06_A | 144 | Conserved hypothetical protein; structural genomic | 98.06 | |
| 2ko1_A | 88 | CTR148A, GTP pyrophosphokinase; homodimer, alpha+b | 97.97 | |
| 2ko1_A | 88 | CTR148A, GTP pyrophosphokinase; homodimer, alpha+b | 97.81 | |
| 2re1_A | 167 | Aspartokinase, alpha and beta subunits; structural | 97.72 | |
| 3n0v_A | 286 | Formyltetrahydrofolate deformylase; formyl transfe | 97.67 | |
| 3nrb_A | 287 | Formyltetrahydrofolate deformylase; N-terminal ACT | 97.65 | |
| 3obi_A | 288 | Formyltetrahydrofolate deformylase; structural gen | 97.63 | |
| 3obi_A | 288 | Formyltetrahydrofolate deformylase; structural gen | 97.61 | |
| 3nrb_A | 287 | Formyltetrahydrofolate deformylase; N-terminal ACT | 97.59 | |
| 2re1_A | 167 | Aspartokinase, alpha and beta subunits; structural | 97.57 | |
| 3o1l_A | 302 | Formyltetrahydrofolate deformylase; structural gen | 97.56 | |
| 3n0v_A | 286 | Formyltetrahydrofolate deformylase; formyl transfe | 97.52 | |
| 3o1l_A | 302 | Formyltetrahydrofolate deformylase; structural gen | 97.51 | |
| 3lou_A | 292 | Formyltetrahydrofolate deformylase; structural gen | 97.48 | |
| 3lou_A | 292 | Formyltetrahydrofolate deformylase; structural gen | 97.47 | |
| 2dt9_A | 167 | Aspartokinase; protein-ligand complex, regulatory | 97.39 | |
| 2dtj_A | 178 | Aspartokinase; protein-ligand complex, regulatory | 97.34 | |
| 2f1f_A | 164 | Acetolactate synthase isozyme III small subunit; f | 97.21 | |
| 2f1f_A | 164 | Acetolactate synthase isozyme III small subunit; f | 97.13 | |
| 3l76_A | 600 | Aspartokinase; allostery, ACT domains, kinase tran | 97.08 | |
| 3l76_A | 600 | Aspartokinase; allostery, ACT domains, kinase tran | 97.02 | |
| 2pc6_A | 165 | Probable acetolactate synthase isozyme III (small; | 96.99 | |
| 2pc6_A | 165 | Probable acetolactate synthase isozyme III (small; | 96.94 | |
| 2dtj_A | 178 | Aspartokinase; protein-ligand complex, regulatory | 96.85 | |
| 2dt9_A | 167 | Aspartokinase; protein-ligand complex, regulatory | 96.8 | |
| 3s1t_A | 181 | Aspartokinase; ACT domain, threonine binding, regu | 96.74 | |
| 3s1t_A | 181 | Aspartokinase; ACT domain, threonine binding, regu | 96.53 | |
| 2fgc_A | 193 | Acetolactate synthase, small subunit; regulatory s | 96.45 | |
| 2fgc_A | 193 | Acetolactate synthase, small subunit; regulatory s | 96.41 | |
| 2jhe_A | 190 | Transcription regulator TYRR; aromatic hydrocarbon | 96.37 | |
| 4go7_X | 200 | Aspartokinase; transferase; 2.00A {Mycobacterium t | 96.36 | |
| 1y7p_A | 223 | Hypothetical protein AF1403; structural genomics, | 96.16 | |
| 4go7_X | 200 | Aspartokinase; transferase; 2.00A {Mycobacterium t | 96.02 | |
| 3ab4_A | 421 | Aspartokinase; aspartate kinase, concerted inhibit | 95.97 | |
| 1y7p_A | 223 | Hypothetical protein AF1403; structural genomics, | 95.91 | |
| 3ab4_A | 421 | Aspartokinase; aspartate kinase, concerted inhibit | 95.5 | |
| 2jhe_A | 190 | Transcription regulator TYRR; aromatic hydrocarbon | 95.3 | |
| 3c1m_A | 473 | Probable aspartokinase; allosteric inhibition, thr | 94.92 | |
| 1ygy_A | 529 | PGDH, D-3-phosphoglycerate dehydrogenase; oxidored | 93.48 | |
| 3tvi_A | 446 | Aspartokinase; structural genomics, ACT domains, r | 92.56 | |
| 1ygy_A | 529 | PGDH, D-3-phosphoglycerate dehydrogenase; oxidored | 92.0 | |
| 1sc6_A | 404 | PGDH, D-3-phosphoglycerate dehydrogenase; alloster | 91.9 | |
| 3c1m_A | 473 | Probable aspartokinase; allosteric inhibition, thr | 91.89 | |
| 1sc6_A | 404 | PGDH, D-3-phosphoglycerate dehydrogenase; alloster | 91.77 | |
| 3tvi_A | 446 | Aspartokinase; structural genomics, ACT domains, r | 91.72 | |
| 3k5p_A | 416 | D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, | 91.62 | |
| 2qmx_A | 283 | Prephenate dehydratase; APC86053, L-Phe inhibition | 91.14 | |
| 2qmx_A | 283 | Prephenate dehydratase; APC86053, L-Phe inhibition | 90.15 | |
| 3mwb_A | 313 | Prephenate dehydratase; L-Phe, PSI, MCSG, structur | 90.12 | |
| 3luy_A | 329 | Probable chorismate mutase; structural genomics, A | 89.84 | |
| 2qmw_A | 267 | PDT, prephenate dehydratase; APC85812, prephenate | 89.82 | |
| 3luy_A | 329 | Probable chorismate mutase; structural genomics, A | 89.31 | |
| 3mah_A | 157 | Aspartokinase; aspartate kinase, structural genomi | 88.93 | |
| 2cdq_A | 510 | Aspartokinase; aspartate kinase, amino acid metabo | 88.58 | |
| 2cdq_A | 510 | Aspartokinase; aspartate kinase, amino acid metabo | 88.57 | |
| 3mwb_A | 313 | Prephenate dehydratase; L-Phe, PSI, MCSG, structur | 87.95 | |
| 2qmw_A | 267 | PDT, prephenate dehydratase; APC85812, prephenate | 87.81 | |
| 3mah_A | 157 | Aspartokinase; aspartate kinase, structural genomi | 87.46 | |
| 3k5p_A | 416 | D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, | 85.17 | |
| 3mtj_A | 444 | Homoserine dehydrogenase; rossmann-fold, PSI, MCSG | 84.69 |
| >2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} | Back alignment and structure |
|---|
Probab=99.75 E-value=6.2e-18 Score=149.42 Aligned_cols=153 Identities=15% Similarity=0.118 Sum_probs=106.3
Q ss_pred CeEEEEEEECCcccHHHHHHHHHHhCCeeEEEEEEEEeecCCEEEEEEEEecCCCCCCChHHHHHHHHHHHHHHcCCcce
Q 019269 175 GHTLVQIVCQDHKGLLYDIMRTLKDYNIQVSYGRFSRRQRGNCEIDLFIMQADGKKIVDPSKQNGLSSRLWMELLQPLRV 254 (343)
Q Consensus 175 ~~t~i~V~~~DrpGLl~~i~~~L~~~glnI~~A~i~t~t~g~~~~d~F~v~~~g~~i~~~~~~~~l~~~L~~~L~~~~~~ 254 (343)
..++|+|+|+|||||+++|+++|+++|+||.+|++++ ..|+.++ .|.+..... ..+.+++.|++.|...+.+ ...
T Consensus 4 ~~~~ltv~~~DrpGiva~vs~~La~~g~NI~da~q~~-~~~~f~m-~~~v~~~~~--~~~~~~~~l~~~L~~~~~~-~~~ 78 (195)
T 2nyi_A 4 QSFVVSVAGSDRVGIVHDFSWALKNISANVESSRMAC-LGGDFAM-IVLVSLNAK--DGKLIQSALESALPGFQIS-TRR 78 (195)
T ss_dssp EEEEEEEEEECCTTHHHHHHHHHHHTTCEEEEEEEEE-ETTEEEE-EEEEEESSS--SSHHHHHHHHHHSTTCEEE-EEE
T ss_pred eEEEEEEEeCCCCcHHHHHHHHHHHCCCCEEEEEeEE-ECCeEEE-EEEEEecCc--cchhHHHHHHHHHHHHHHh-cCC
Confidence 3579999999999999999999999999999999996 4554444 677763221 2233556666665433221 111
Q ss_pred e--eecCCCCceeeeeeeEEEEeCCCccHHHHHHHHHHhCCceEEEEEeeccccC--ceEeeeeEEEEEcCCCCCCCchH
Q 019269 255 T--VVSRGPDTELLVANPVELSGKGRPLVFHDITLALKMLDICIFSAEIGRHMIG--DREWEVYRVLLDEGDGLSVPRNK 330 (343)
Q Consensus 255 ~--~~~~~~~~~v~~~~~ieV~~~DrpGLL~~I~~~l~~~gi~I~~AkI~~~T~g--~~~~dv~~F~v~~~~g~~l~~~~ 330 (343)
. +.. .....-.-.+.|+|.|+|||||+++|+++|+++|+||..+++. |.+ ++..|. ||++..-+.+ +..
T Consensus 79 ~~~~~~-~~~~~~~~~~iltv~g~DrpGiva~Vt~~La~~g~nI~~~~~~--t~~~~~~~~~~--F~m~~~~~~~--~~~ 151 (195)
T 2nyi_A 79 ASSVAE-RHVSPDTREYELYVEGPDSEGIVEAVTAVLAKKGANIVELETE--TLPAPFAGFTL--FRMGSRVAFP--FPL 151 (195)
T ss_dssp CCCC-----CCTTEEEEEEEEEEECCTTHHHHHHHHHHHTTCEEEEEEEE--EEECSSTTCEE--EEEEEEEEEE--GGG
T ss_pred eEEEEe-CCcCCCCcEEEEEEEeCCCcCHHHHHHHHHHHcCCCEEEceee--ecccccCCCCe--EEEEEEEEcC--CCc
Confidence 1 111 0000011235899999999999999999999999999999999 888 788899 9997754433 222
Q ss_pred HHHHHHHHHc
Q 019269 331 IEEGVWKLLM 340 (343)
Q Consensus 331 ~~~~l~~~L~ 340 (343)
. ++|+++|.
T Consensus 152 ~-~~l~~~l~ 160 (195)
T 2nyi_A 152 Y-QEVVTALS 160 (195)
T ss_dssp H-HHHHHHHH
T ss_pred c-HHHHHHHH
Confidence 3 55555553
|
| >2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} | Back alignment and structure |
|---|
| >1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 | Back alignment and structure |
|---|
| >1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11 | Back alignment and structure |
|---|
| >1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 | Back alignment and structure |
|---|
| >1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 | Back alignment and structure |
|---|
| >2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11 | Back alignment and structure |
|---|
| >2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A | Back alignment and structure |
|---|
| >2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A | Back alignment and structure |
|---|
| >2re1_A Aspartokinase, alpha and beta subunits; structural genomics, protein structure initiative, midwest center for structural genomics; 2.75A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2re1_A Aspartokinase, alpha and beta subunits; structural genomics, protein structure initiative, midwest center for structural genomics; 2.75A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} | Back alignment and structure |
|---|
| >3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} | Back alignment and structure |
|---|
| >2dt9_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; 2.15A {Thermus thermophilus} PDB: 2zho_A | Back alignment and structure |
|---|
| >2dtj_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; HET: CIT; 1.58A {Corynebacterium glutamicum} PDB: 3aaw_B* 3ab2_B 3ab4_B* | Back alignment and structure |
|---|
| >2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} | Back alignment and structure |
|---|
| >3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} | Back alignment and structure |
|---|
| >2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >2dtj_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; HET: CIT; 1.58A {Corynebacterium glutamicum} PDB: 3aaw_B* 3ab2_B 3ab4_B* | Back alignment and structure |
|---|
| >2dt9_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; 2.15A {Thermus thermophilus} PDB: 2zho_A | Back alignment and structure |
|---|
| >3s1t_A Aspartokinase; ACT domain, threonine binding, regulatory domain of aspartok transferase; 1.63A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3s1t_A Aspartokinase; ACT domain, threonine binding, regulatory domain of aspartok transferase; 1.63A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >4go7_X Aspartokinase; transferase; 2.00A {Mycobacterium tuberculosis} PDB: 4go5_X | Back alignment and structure |
|---|
| >1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 | Back alignment and structure |
|---|
| >4go7_X Aspartokinase; transferase; 2.00A {Mycobacterium tuberculosis} PDB: 4go5_X | Back alignment and structure |
|---|
| >3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A | Back alignment and structure |
|---|
| >1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 | Back alignment and structure |
|---|
| >3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A | Back alignment and structure |
|---|
| >2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* | Back alignment and structure |
|---|
| >3tvi_A Aspartokinase; structural genomics, ACT domains, regulatory domains, kinase transferase, PSI-2, protein structure initiative; HET: LYS; 3.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* | Back alignment and structure |
|---|
| >1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* | Back alignment and structure |
|---|
| >1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* | Back alignment and structure |
|---|
| >3tvi_A Aspartokinase; structural genomics, ACT domains, regulatory domains, kinase transferase, PSI-2, protein structure initiative; HET: LYS; 3.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >2qmx_A Prephenate dehydratase; APC86053, L-Phe inhibition, PDT, CHL tepidum TLS, structural genomics, PSI-2, protein structure initiative; HET: PHE; 2.30A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >2qmx_A Prephenate dehydratase; APC86053, L-Phe inhibition, PDT, CHL tepidum TLS, structural genomics, PSI-2, protein structure initiative; HET: PHE; 2.30A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >3mwb_A Prephenate dehydratase; L-Phe, PSI, MCSG, structural genomics, midwest center for ST genomics, protein structure initiative, lyase; HET: MSE PHE; 2.00A {Arthrobacter aurescens} | Back alignment and structure |
|---|
| >3luy_A Probable chorismate mutase; structural genomics, APC38059, 3-phenylp PSI-2, protein structure initiative; HET: PPY; 2.00A {Bifidobacterium adolescentis} | Back alignment and structure |
|---|
| >2qmw_A PDT, prephenate dehydratase; APC85812, prephenate dehydratase (PDT), staphylococcus aureu aureus MU50, structural genomics, PSI-2; 2.30A {Staphylococcus aureus subsp} SCOP: c.94.1.1 d.58.18.3 | Back alignment and structure |
|---|
| >3luy_A Probable chorismate mutase; structural genomics, APC38059, 3-phenylp PSI-2, protein structure initiative; HET: PPY; 2.00A {Bifidobacterium adolescentis} | Back alignment and structure |
|---|
| >3mah_A Aspartokinase; aspartate kinase, structural genomics, MCSG, transferase, PSI-2; 2.31A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2cdq_A Aspartokinase; aspartate kinase, amino acid metabolism, ACT domain, alloste S-adenosylmethionine, lysine, allosteric effector, plant; HET: TAR SAM LYS; 2.85A {Arabidopsis thaliana} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 | Back alignment and structure |
|---|
| >2cdq_A Aspartokinase; aspartate kinase, amino acid metabolism, ACT domain, alloste S-adenosylmethionine, lysine, allosteric effector, plant; HET: TAR SAM LYS; 2.85A {Arabidopsis thaliana} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 | Back alignment and structure |
|---|
| >3mwb_A Prephenate dehydratase; L-Phe, PSI, MCSG, structural genomics, midwest center for ST genomics, protein structure initiative, lyase; HET: MSE PHE; 2.00A {Arthrobacter aurescens} | Back alignment and structure |
|---|
| >2qmw_A PDT, prephenate dehydratase; APC85812, prephenate dehydratase (PDT), staphylococcus aureu aureus MU50, structural genomics, PSI-2; 2.30A {Staphylococcus aureus subsp} SCOP: c.94.1.1 d.58.18.3 | Back alignment and structure |
|---|
| >3mah_A Aspartokinase; aspartate kinase, structural genomics, MCSG, transferase, PSI-2; 2.31A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 343 | |||
| d1u8sa1 | 86 | putative transcriptional repressor VC2159 {Vibrio | 98.81 | |
| d1u8sa1 | 86 | putative transcriptional repressor VC2159 {Vibrio | 98.7 | |
| d1zpva1 | 83 | UPF0237 protein SP0238 {Streptococcus pneumoniae [ | 98.53 | |
| d1zpva1 | 83 | UPF0237 protein SP0238 {Streptococcus pneumoniae [ | 98.53 | |
| d1u8sa2 | 93 | putative transcriptional repressor VC2159 {Vibrio | 98.1 | |
| d1u8sa2 | 93 | putative transcriptional repressor VC2159 {Vibrio | 97.98 | |
| d1ygya3 | 78 | Phosphoglycerate dehydrogenase, regulatory (C-term | 97.83 | |
| d1ygya3 | 78 | Phosphoglycerate dehydrogenase, regulatory (C-term | 97.82 | |
| d1y7pa2 | 77 | Hypothetical protein AF1403, N-terminal domain {Ar | 97.79 | |
| d2f06a1 | 71 | Hypothetical protein BT0572 {Bacteroides thetaiota | 97.54 | |
| d1y7pa2 | 77 | Hypothetical protein AF1403, N-terminal domain {Ar | 97.4 | |
| d2f06a1 | 71 | Hypothetical protein BT0572 {Bacteroides thetaiota | 97.36 | |
| d2fgca2 | 78 | Acetolactate synthase small subunit, IlvH {Thermot | 97.33 | |
| d2pc6a2 | 77 | Acetolactate synthase small subunit, IlvH {Nitroso | 97.32 | |
| d2f06a2 | 70 | Hypothetical protein BT0572 {Bacteroides thetaiota | 97.31 | |
| d2f1fa1 | 76 | Acetolactate synthase small subunit, IlvH {Escheri | 97.26 | |
| d2f1fa1 | 76 | Acetolactate synthase small subunit, IlvH {Escheri | 97.23 | |
| d2pc6a2 | 77 | Acetolactate synthase small subunit, IlvH {Nitroso | 97.23 | |
| d2fgca2 | 78 | Acetolactate synthase small subunit, IlvH {Thermot | 97.21 | |
| d2f06a2 | 70 | Hypothetical protein BT0572 {Bacteroides thetaiota | 97.2 | |
| d1sc6a3 | 84 | Phosphoglycerate dehydrogenase, regulatory (C-term | 97.04 | |
| d1sc6a3 | 84 | Phosphoglycerate dehydrogenase, regulatory (C-term | 96.73 | |
| d2qmwa2 | 80 | Prephenate dehydratase C-terminal domain {Staphylo | 95.72 | |
| d1phza1 | 97 | Phenylalanine hydroxylase N-terminal domain {Rat ( | 95.48 | |
| d2qmwa2 | 80 | Prephenate dehydratase C-terminal domain {Staphylo | 94.95 | |
| d1phza1 | 97 | Phenylalanine hydroxylase N-terminal domain {Rat ( | 94.37 | |
| d2cdqa2 | 91 | Aspartokinase {Thale cress (Arabidopsis thaliana) | 86.82 | |
| d2cdqa2 | 91 | Aspartokinase {Thale cress (Arabidopsis thaliana) | 86.44 | |
| d2hmfa2 | 67 | Aspartokinase {Methanococcus jannaschii [TaxId: 21 | 85.7 | |
| d2hmfa2 | 67 | Aspartokinase {Methanococcus jannaschii [TaxId: 21 | 83.85 | |
| d2hmfa3 | 100 | Aspartokinase {Methanococcus jannaschii [TaxId: 21 | 83.29 | |
| d2hmfa3 | 100 | Aspartokinase {Methanococcus jannaschii [TaxId: 21 | 83.2 |
| >d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: ACT-like family: Glycine cleavage system transcriptional repressor domain: putative transcriptional repressor VC2159 species: Vibrio cholerae [TaxId: 666]
Probab=98.81 E-value=2e-08 Score=74.71 Aligned_cols=66 Identities=12% Similarity=0.167 Sum_probs=55.3
Q ss_pred CCCEEEEEEEEcCCCcHHHHHHHHHHhCCCeEEEEEEEecCCCEEEEEEEEecCCCcccchhHHHHHHHHHHH
Q 019269 38 PSDVFLLKLSCYDRKGLLYDVTAVLCELELTIEKVKISTTPDGKVMDLFFVTDTRELLHTRKRKEDTYEHLKT 110 (343)
Q Consensus 38 ~~~~~~I~V~~~Dr~GLl~~i~~~L~~~glnI~~A~i~T~~~g~~~d~f~V~~~~g~~~~~~~~~~l~~~L~~ 110 (343)
...+++|+++|+||||++++++++|+.+||||.+++.++. +|.+.-.+.|.- ++..++++++.|..
T Consensus 2 m~~~~vitv~G~DrpGiva~vt~~l~~~g~NI~d~~~~~~-~~~~~~~~~v~~------~~~~~~~l~~~L~~ 67 (86)
T d1u8sa1 2 LTQHLVITAVGTDRPGICNEVVRLVTQAGCNIIDSRIAMF-GKEFTLLMLISG------SPSNITRVETTLPL 67 (86)
T ss_dssp CCEEEEEEEEEECCTTHHHHHHHHHHHTTCEEEEEEEEEE-TTEEEEEEEEEE------CHHHHHHHHHHHHH
T ss_pred CccEEEEEEEeCCCChHHHHHHHHHHHCCCeEEEeEeEEE-CCeeEEEEEEEc------CcccHHHHHHHHHH
Confidence 4568899999999999999999999999999999999997 666666666653 35567888888877
|
| >d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cdqa2 d.58.18.10 (A:329-419) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2cdqa2 d.58.18.10 (A:329-419) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2hmfa2 d.58.18.10 (A:404-470) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2hmfa2 d.58.18.10 (A:404-470) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2hmfa3 d.58.18.10 (A:304-403) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2hmfa3 d.58.18.10 (A:304-403) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|