Citrus Sinensis ID: 019274
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 343 | ||||||
| 255560501 | 530 | Phytoene dehydrogenase, putative [Ricinu | 0.991 | 0.641 | 0.739 | 1e-152 | |
| 359474834 | 530 | PREDICTED: phytoene dehydrogenase-like [ | 0.991 | 0.641 | 0.727 | 1e-148 | |
| 449458684 | 533 | PREDICTED: phytoene dehydrogenase-like [ | 0.991 | 0.637 | 0.662 | 1e-140 | |
| 297744581 | 531 | unnamed protein product [Vitis vinifera] | 0.991 | 0.640 | 0.690 | 1e-140 | |
| 148910773 | 574 | unknown [Picea sitchensis] | 0.991 | 0.592 | 0.636 | 1e-136 | |
| 168030354 | 532 | predicted protein [Physcomitrella patens | 0.991 | 0.639 | 0.545 | 1e-119 | |
| 38345844 | 529 | OSJNBa0084K11.8 [Oryza sativa Japonica G | 0.988 | 0.640 | 0.567 | 1e-118 | |
| 116311132 | 529 | B0103C08-B0602B01.15 [Oryza sativa Indic | 0.988 | 0.640 | 0.567 | 1e-118 | |
| 302804622 | 527 | hypothetical protein SELMODRAFT_180688 [ | 0.956 | 0.622 | 0.565 | 1e-115 | |
| 302753308 | 530 | hypothetical protein SELMODRAFT_74261 [S | 0.962 | 0.622 | 0.558 | 1e-115 |
| >gi|255560501|ref|XP_002521265.1| Phytoene dehydrogenase, putative [Ricinus communis] gi|223539533|gb|EEF41121.1| Phytoene dehydrogenase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 544 bits (1401), Expect = e-152, Method: Compositional matrix adjust.
Identities = 252/341 (73%), Positives = 292/341 (85%), Gaps = 1/341 (0%)
Query: 3 QFGCSERLYRNVIGPLVQVGLFAPAEQCSAAATLGILYFIILAHQKNFDLVWCRGTLREK 62
QFGCSE+LYRNV GPL+QVGLFAPAEQCSAAATLGILY+I LAHQK+FD+VWCRGT+REK
Sbjct: 190 QFGCSEKLYRNVFGPLLQVGLFAPAEQCSAAATLGILYYISLAHQKDFDMVWCRGTIREK 249
Query: 63 IFEPWMDSMRTRGCEFLDGRRVTDFIYDEERCCISDVVCGKETYSAGAVVLAVGISTLQE 122
IF PWMDS+RT+GC FLDG +V DFI +EE CI +VVC ET +A AV+LAVGIS +QE
Sbjct: 250 IFSPWMDSLRTKGCRFLDGEKVIDFIINEETSCIEEVVCSNETINADAVILAVGISKVQE 309
Query: 123 LIKNSI-LCNREEFLKVLNLASIDVVSVKLWFDKKVTVPNVSNACSGFGDSLAWTFFDLN 181
L+KNS L REEFLKVLNLA ID+++ KL D+KV + + SNACSGF DS +WTFFDLN
Sbjct: 310 LVKNSAALSTREEFLKVLNLAGIDILTCKLQLDRKVNLAHASNACSGFDDSFSWTFFDLN 369
Query: 182 KIYDEHKDDSATVIQADFYHANELMPLKDDQVVAKAVSYLSKCIKDFSTATVMDHKIRRF 241
++DEHKD+ T +QADFYHANEL+PL D+ VV K +SYLSKCIKDF A V+D +I RF
Sbjct: 370 ALHDEHKDNQVTTLQADFYHANELLPLTDELVVTKTMSYLSKCIKDFENAVVIDKEISRF 429
Query: 242 PKSLTHFFPGSYKYMMRGFTSFPNLFMAGDWITTRHGSWSQERSYVTGLEAANRVVDYLG 301
PKSLTHFFPGSYK+MMRG TSFPNLFMAGDWI TRHGSWSQE+SYVTGLEAANRVVD+L
Sbjct: 430 PKSLTHFFPGSYKHMMRGSTSFPNLFMAGDWIITRHGSWSQEKSYVTGLEAANRVVDFLE 489
Query: 302 DGSFSKIIPVEEDEPHIEALRTVNRRFNEIRAQLPLSDYFL 342
+GSF+KII VEEDEPH++ALR+VNRRFNEI Q+PL YFL
Sbjct: 490 EGSFAKIIAVEEDEPHVQALRSVNRRFNEISDQIPLFGYFL 530
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359474834|ref|XP_002278046.2| PREDICTED: phytoene dehydrogenase-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449458684|ref|XP_004147077.1| PREDICTED: phytoene dehydrogenase-like [Cucumis sativus] gi|449518113|ref|XP_004166088.1| PREDICTED: phytoene dehydrogenase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297744581|emb|CBI37843.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|148910773|gb|ABR18453.1| unknown [Picea sitchensis] | Back alignment and taxonomy information |
|---|
| >gi|168030354|ref|XP_001767688.1| predicted protein [Physcomitrella patens subsp. patens] gi|162681008|gb|EDQ67439.1| predicted protein [Physcomitrella patens subsp. patens] | Back alignment and taxonomy information |
|---|
| >gi|38345844|emb|CAE01845.2| OSJNBa0084K11.8 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|116311132|emb|CAH68058.1| B0103C08-B0602B01.15 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
| >gi|302804622|ref|XP_002984063.1| hypothetical protein SELMODRAFT_180688 [Selaginella moellendorffii] gi|300148415|gb|EFJ15075.1| hypothetical protein SELMODRAFT_180688 [Selaginella moellendorffii] | Back alignment and taxonomy information |
|---|
| >gi|302753308|ref|XP_002960078.1| hypothetical protein SELMODRAFT_74261 [Selaginella moellendorffii] gi|300171017|gb|EFJ37617.1| hypothetical protein SELMODRAFT_74261 [Selaginella moellendorffii] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 343 | ||||||
| TAIR|locus:2129515 | 566 | PDS3 "phytoene desaturase 3" [ | 0.845 | 0.512 | 0.196 | 5.1e-05 |
| TAIR|locus:2129515 PDS3 "phytoene desaturase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 127 (49.8 bits), Expect = 5.1e-05, P = 5.1e-05
Identities = 59/301 (19%), Positives = 123/301 (40%)
Query: 5 GCSERLYRNVIGPLVQVGLFAPAEQCSAAATLGILYFIILAHQKNFDLVWCRGTLREKIF 64
G ER+ V + + F ++ S L I L + + + G E++
Sbjct: 252 GVPERVTDEVFIAMSKALNFINPDELSMQCIL-IALNRFLQEKHGSKMAFLDGNPPERLC 310
Query: 65 EPWMDSMRTRGCEFLDGRRVTDFIYDEERCCISDVVCGKETYSAGAVVLAVGISTLQELI 124
P +D +R+ G E R+ +++ S ++ T A V A + L+ L+
Sbjct: 311 MPVVDHIRSLGGEVQLNSRIKKIELNDDGTVKSFLLTNGSTVEGDAYVFAAPVDILKLLL 370
Query: 125 KNSILCNREEFLKVLNLASIDVVSVKLWFDKKVTVPNVSNACSGFGDSLAWTFFDLNKIY 184
+ F K+ L + V++V +WFD+K+ N + +L + D++
Sbjct: 371 PDPWK-EIPYFKKLDKLVGVPVINVHIWFDRKLK--NTYDHLLFSRSNLLSVYADMSLTC 427
Query: 185 DEHKDDSATVIQADFYHANELMPLKDDQVVAKAVSYLSKCIKDF-----STATVMDHKIR 239
E+ D + ++++ F A E + D ++ + L K D S A ++ + +
Sbjct: 428 KEYYDPNRSMLELVFAPAEEWISRTDSDIIDATMKELEKLFPDEISADQSKAKILKYHVV 487
Query: 240 RFPKSLTHFFPGSYKYMMRGFTSFPNLFMAGDWITTRHGSWSQERSYVTGLEAANRVV-D 298
+ P+S+ P + ++AGD+ ++ + S E + ++G + +V D
Sbjct: 488 KTPRSVYKTIPNCEPCRPLQRSPIEGFYLAGDYTKQKYLA-SMEGAVLSGKFCSQSIVQD 546
Query: 299 Y 299
Y
Sbjct: 547 Y 547
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.324 0.138 0.427 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 343 343 0.00096 116 3 11 22 0.47 33
33 0.45 37
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 1
No. of states in DFA: 618 (66 KB)
Total size of DFA: 253 KB (2136 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 24
Search cpu time: 28.28u 0.08s 28.36t Elapsed: 00:00:02
Total cpu time: 28.28u 0.08s 28.36t Elapsed: 00:00:02
Start: Sat May 11 06:55:19 2013 End: Sat May 11 06:55:21 2013
|
|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 343 | |||
| COG3349 | 485 | COG3349, COG3349, Uncharacterized conserved protei | 3e-53 | |
| TIGR03467 | 411 | TIGR03467, HpnE, squalene-associated FAD-dependent | 3e-10 | |
| pfam01593 | 444 | pfam01593, Amino_oxidase, Flavin containing amine | 7e-10 | |
| TIGR02731 | 453 | TIGR02731, phytoene_desat, phytoene desaturase | 2e-08 | |
| PLN02487 | 569 | PLN02487, PLN02487, zeta-carotene desaturase | 2e-04 | |
| PLN02612 | 567 | PLN02612, PLN02612, phytoene desaturase | 0.002 |
| >gnl|CDD|225885 COG3349, COG3349, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
Score = 181 bits (462), Expect = 3e-53
Identities = 74/334 (22%), Positives = 121/334 (36%), Gaps = 16/334 (4%)
Query: 1 MIQFGCSERLYRNVIGPLVQVGLFAPAEQCSAAATLGILYFIILAHQKNFDLVWCRGTLR 60
+ + G E Y+ P+ F E CSA L IL ++ + L RG+
Sbjct: 155 LKEKGAREGAYKAAFAPIALALTFIDPEGCSARFFLTILNLFLIVTLEASILRNLRGSPD 214
Query: 61 EKIFEPWMDSMRTRGCEFLDGRRVTDFIYDEERCCIS--DVVCGKETYSAGAVVLAVGIS 118
E + +PW + + RG + V + D R A + V
Sbjct: 215 EVLLQPWTEYIPERGRKVHADYPVKELDLDGARGLAKVTGGDVTGPEQEQQAALAVVDAF 274
Query: 119 TLQELIKN--SILCNREEFLKVLNLASIDVVSVKLWFDKKVTVPNVSNACSGFGDSLAWT 176
+Q ++ S F + L + V+++ L FD VT N G D+L W+
Sbjct: 275 AVQRFKRDLPSEWPKWSNFDGLYGLRLVPVITLHLRFDGWVTELTDRNQQFGI-DNLLWS 333
Query: 177 FFDLNKIY--------DEHKDDSATVIQADFYHANELMPLKDDQVVAKAVSYLSKCIKDF 228
L + D + + ++ + D+ +VA L + +
Sbjct: 334 DDTLGGVVADLALTSPDYVEPGAGCYLEKVLAPGWPFLFESDEAIVATFEKELYELVPSL 393
Query: 229 STATVMDHKIRRFPKSLTHFFPGSYKYMMRGFTSFPNLFMAGDWITTRHGSWSQERSYVT 288
+ A + + +SL PGSY Y T PNL +AGD+ S E + ++
Sbjct: 394 AEAKLKSSVLVN-QQSLYGLAPGSYHYRPEQKTPIPNLLLAGDYTKQP-YLGSMEGATLS 451
Query: 289 GLEAANRVVDYLGDGSFSKIIPVEEDEPHIEALR 322
GL AAN ++D LG + D LR
Sbjct: 452 GLLAANAILDNLGHHAPL-DRRDLSDPAPFGVLR 484
|
Length = 485 |
| >gnl|CDD|234221 TIGR03467, HpnE, squalene-associated FAD-dependent desaturase | Back alignment and domain information |
|---|
| >gnl|CDD|216593 pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|131778 TIGR02731, phytoene_desat, phytoene desaturase | Back alignment and domain information |
|---|
| >gnl|CDD|215268 PLN02487, PLN02487, zeta-carotene desaturase | Back alignment and domain information |
|---|
| >gnl|CDD|215330 PLN02612, PLN02612, phytoene desaturase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 343 | |||
| PLN02487 | 569 | zeta-carotene desaturase | 100.0 | |
| TIGR02732 | 474 | zeta_caro_desat carotene 7,8-desaturase. Carotene | 100.0 | |
| PLN02612 | 567 | phytoene desaturase | 100.0 | |
| TIGR03467 | 419 | HpnE squalene-associated FAD-dependent desaturase. | 100.0 | |
| TIGR02731 | 453 | phytoene_desat phytoene desaturase. Plants and cya | 99.98 | |
| PRK07233 | 434 | hypothetical protein; Provisional | 99.96 | |
| PRK07208 | 479 | hypothetical protein; Provisional | 99.93 | |
| COG1232 | 444 | HemY Protoporphyrinogen oxidase [Coenzyme metaboli | 99.93 | |
| TIGR00562 | 462 | proto_IX_ox protoporphyrinogen oxidase. This prote | 99.92 | |
| PRK12416 | 463 | protoporphyrinogen oxidase; Provisional | 99.92 | |
| TIGR02733 | 492 | desat_CrtD C-3',4' desaturase CrtD. Members of thi | 99.91 | |
| PLN02576 | 496 | protoporphyrinogen oxidase | 99.91 | |
| PRK11883 | 451 | protoporphyrinogen oxidase; Reviewed | 99.91 | |
| TIGR02734 | 502 | crtI_fam phytoene desaturase. Phytoene is converte | 99.89 | |
| TIGR02730 | 493 | carot_isom carotene isomerase. Members of this fam | 99.88 | |
| PLN02268 | 435 | probable polyamine oxidase | 99.86 | |
| PLN03000 | 881 | amine oxidase | 99.85 | |
| COG3349 | 485 | Uncharacterized conserved protein [Function unknow | 99.85 | |
| PF01593 | 450 | Amino_oxidase: Flavin containing amine oxidoreduct | 99.85 | |
| PLN02529 | 738 | lysine-specific histone demethylase 1 | 99.84 | |
| PLN02676 | 487 | polyamine oxidase | 99.82 | |
| KOG4254 | 561 | consensus Phytoene desaturase [Coenzyme transport | 99.82 | |
| PLN02328 | 808 | lysine-specific histone demethylase 1 homolog | 99.81 | |
| PLN02568 | 539 | polyamine oxidase | 99.81 | |
| PLN02976 | 1713 | amine oxidase | 99.81 | |
| COG1231 | 450 | Monoamine oxidase [Amino acid transport and metabo | 99.77 | |
| KOG1276 | 491 | consensus Protoporphyrinogen oxidase [Coenzyme tra | 99.75 | |
| COG1233 | 487 | Phytoene dehydrogenase and related proteins [Secon | 99.64 | |
| KOG0029 | 501 | consensus Amine oxidase [Secondary metabolites bio | 99.62 | |
| COG3380 | 331 | Predicted NAD/FAD-dependent oxidoreductase [Genera | 99.6 | |
| KOG0685 | 498 | consensus Flavin-containing amine oxidase [Coenzym | 99.53 | |
| COG2907 | 447 | Predicted NAD/FAD-binding protein [General functio | 99.23 | |
| PRK13977 | 576 | myosin-cross-reactive antigen; Provisional | 99.18 | |
| TIGR02352 | 337 | thiamin_ThiO glycine oxidase ThiO. This family con | 98.67 | |
| PF01266 | 358 | DAO: FAD dependent oxidoreductase; InterPro: IPR00 | 98.65 | |
| PTZ00363 | 443 | rab-GDP dissociation inhibitor; Provisional | 98.64 | |
| PRK00711 | 416 | D-amino acid dehydrogenase small subunit; Validate | 98.57 | |
| PF06100 | 500 | Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross | 98.44 | |
| TIGR01373 | 407 | soxB sarcosine oxidase, beta subunit family, heter | 98.27 | |
| TIGR03329 | 460 | Phn_aa_oxid putative aminophosphonate oxidoreducta | 98.23 | |
| TIGR03197 | 381 | MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri | 98.19 | |
| TIGR01377 | 380 | soxA_mon sarcosine oxidase, monomeric form. Sarcos | 98.16 | |
| PF07156 | 368 | Prenylcys_lyase: Prenylcysteine lyase; InterPro: I | 98.1 | |
| PRK12409 | 410 | D-amino acid dehydrogenase small subunit; Provisio | 98.09 | |
| PF00996 | 438 | GDI: GDP dissociation inhibitor; InterPro: IPR0182 | 97.99 | |
| PRK11259 | 376 | solA N-methyltryptophan oxidase; Provisional | 97.95 | |
| KOG2820 | 399 | consensus FAD-dependent oxidoreductase [General fu | 97.95 | |
| TIGR03377 | 516 | glycerol3P_GlpA glycerol-3-phosphate dehydrogenase | 97.78 | |
| TIGR02032 | 295 | GG-red-SF geranylgeranyl reductase family. This mo | 97.74 | |
| PRK01747 | 662 | mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans | 97.72 | |
| COG0665 | 387 | DadA Glycine/D-amino acid oxidases (deaminating) [ | 97.66 | |
| PRK11101 | 546 | glpA sn-glycerol-3-phosphate dehydrogenase subunit | 97.52 | |
| PF03486 | 409 | HI0933_like: HI0933-like protein; InterPro: IPR004 | 97.49 | |
| PRK10015 | 429 | oxidoreductase; Provisional | 97.39 | |
| PLN02464 | 627 | glycerol-3-phosphate dehydrogenase | 97.31 | |
| COG0644 | 396 | FixC Dehydrogenases (flavoproteins) [Energy produc | 97.3 | |
| COG0578 | 532 | GlpA Glycerol-3-phosphate dehydrogenase [Energy pr | 97.25 | |
| PRK06847 | 375 | hypothetical protein; Provisional | 97.19 | |
| TIGR03378 | 419 | glycerol3P_GlpB glycerol-3-phosphate dehydrogenase | 97.16 | |
| PRK06185 | 407 | hypothetical protein; Provisional | 97.12 | |
| KOG2844 | 856 | consensus Dimethylglycine dehydrogenase precursor | 97.08 | |
| COG2509 | 486 | Uncharacterized FAD-dependent dehydrogenases [Gene | 97.03 | |
| PRK08773 | 392 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 96.95 | |
| TIGR03862 | 376 | flavo_PP4765 uncharacterized flavoprotein, PP_4765 | 96.84 | |
| PRK12266 | 508 | glpD glycerol-3-phosphate dehydrogenase; Reviewed | 96.82 | |
| COG2081 | 408 | Predicted flavoproteins [General function predicti | 96.82 | |
| TIGR02485 | 432 | CobZ_N-term precorrin 3B synthase CobZ. CobZ is es | 96.8 | |
| PTZ00383 | 497 | malate:quinone oxidoreductase; Provisional | 96.75 | |
| PRK07333 | 403 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio | 96.65 | |
| TIGR01984 | 382 | UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T | 96.56 | |
| PRK08274 | 466 | tricarballylate dehydrogenase; Validated | 96.52 | |
| PRK13369 | 502 | glycerol-3-phosphate dehydrogenase; Provisional | 96.5 | |
| KOG2852 | 380 | consensus Possible oxidoreductase [General functio | 96.49 | |
| PRK07045 | 388 | putative monooxygenase; Reviewed | 96.46 | |
| PF01494 | 356 | FAD_binding_3: FAD binding domain; InterPro: IPR00 | 96.41 | |
| TIGR01988 | 385 | Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub | 96.4 | |
| PRK07190 | 487 | hypothetical protein; Provisional | 96.39 | |
| COG0654 | 387 | UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and | 96.39 | |
| PRK05714 | 405 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 96.38 | |
| COG0579 | 429 | Predicted dehydrogenase [General function predicti | 96.36 | |
| PF13738 | 203 | Pyr_redox_3: Pyridine nucleotide-disulphide oxidor | 96.35 | |
| PF00890 | 417 | FAD_binding_2: FAD binding domain of the Pfam fami | 96.27 | |
| PRK11728 | 393 | hydroxyglutarate oxidase; Provisional | 96.19 | |
| PRK06134 | 581 | putative FAD-binding dehydrogenase; Reviewed | 96.16 | |
| PRK07494 | 388 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio | 96.06 | |
| TIGR00275 | 400 | flavoprotein, HI0933 family. The model when search | 96.03 | |
| PRK07588 | 391 | hypothetical protein; Provisional | 96.01 | |
| PRK12845 | 564 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 95.97 | |
| TIGR01790 | 388 | carotene-cycl lycopene cyclase family protein. Thi | 95.96 | |
| PRK07121 | 492 | hypothetical protein; Validated | 95.93 | |
| TIGR01816 | 565 | sdhA_forward succinate dehydrogenase, flavoprotein | 95.92 | |
| PRK08244 | 493 | hypothetical protein; Provisional | 95.91 | |
| PLN02697 | 529 | lycopene epsilon cyclase | 95.9 | |
| PRK12843 | 578 | putative FAD-binding dehydrogenase; Reviewed | 95.89 | |
| KOG1439 | 440 | consensus RAB proteins geranylgeranyltransferase c | 95.85 | |
| PRK10157 | 428 | putative oxidoreductase FixC; Provisional | 95.84 | |
| PRK06834 | 488 | hypothetical protein; Provisional | 95.84 | |
| TIGR00031 | 377 | UDP-GALP_mutase UDP-galactopyranose mutase. The ge | 95.74 | |
| PRK08850 | 405 | 2-octaprenyl-6-methoxyphenol hydroxylase; Validate | 95.73 | |
| TIGR01813 | 439 | flavo_cyto_c flavocytochrome c. This model describ | 95.7 | |
| PRK07608 | 388 | ubiquinone biosynthesis hydroxylase family protein | 95.68 | |
| PRK04176 | 257 | ribulose-1,5-biphosphate synthetase; Provisional | 95.65 | |
| PRK12835 | 584 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 95.65 | |
| PRK07364 | 415 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 95.59 | |
| PRK12844 | 557 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 95.58 | |
| PRK05732 | 395 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 95.56 | |
| PRK06183 | 538 | mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va | 95.55 | |
| PRK05675 | 570 | sdhA succinate dehydrogenase flavoprotein subunit; | 95.5 | |
| TIGR01320 | 483 | mal_quin_oxido malate:quinone-oxidoreductase. This | 95.49 | |
| PRK06481 | 506 | fumarate reductase flavoprotein subunit; Validated | 95.47 | |
| PF06039 | 488 | Mqo: Malate:quinone oxidoreductase (Mqo); InterPro | 95.43 | |
| PRK09126 | 392 | hypothetical protein; Provisional | 95.43 | |
| PLN02463 | 447 | lycopene beta cyclase | 95.41 | |
| PRK06175 | 433 | L-aspartate oxidase; Provisional | 95.37 | |
| PRK08020 | 391 | ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin | 95.35 | |
| PRK09078 | 598 | sdhA succinate dehydrogenase flavoprotein subunit; | 95.34 | |
| PRK05329 | 422 | anaerobic glycerol-3-phosphate dehydrogenase subun | 95.32 | |
| PRK08401 | 466 | L-aspartate oxidase; Provisional | 95.3 | |
| PRK07843 | 557 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 95.24 | |
| PRK08958 | 588 | sdhA succinate dehydrogenase flavoprotein subunit; | 95.15 | |
| TIGR01812 | 566 | sdhA_frdA_Gneg succinate dehydrogenase or fumarate | 95.02 | |
| PRK05945 | 575 | sdhA succinate dehydrogenase flavoprotein subunit; | 94.96 | |
| PRK12842 | 574 | putative succinate dehydrogenase; Reviewed | 94.95 | |
| PRK07573 | 640 | sdhA succinate dehydrogenase flavoprotein subunit; | 94.84 | |
| PRK05257 | 494 | malate:quinone oxidoreductase; Validated | 94.8 | |
| PRK12839 | 572 | hypothetical protein; Provisional | 94.72 | |
| TIGR01811 | 603 | sdhA_Bsu succinate dehydrogenase or fumarate reduc | 94.62 | |
| TIGR00292 | 254 | thiazole biosynthesis enzyme. This enzyme is invol | 94.62 | |
| PRK08013 | 400 | oxidoreductase; Provisional | 94.61 | |
| TIGR00551 | 488 | nadB L-aspartate oxidase. L-aspartate oxidase is t | 94.59 | |
| PTZ00139 | 617 | Succinate dehydrogenase [ubiquinone] flavoprotein | 94.57 | |
| PF00732 | 296 | GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 | 94.54 | |
| PF01134 | 392 | GIDA: Glucose inhibited division protein A; InterP | 94.53 | |
| PRK06452 | 566 | sdhA succinate dehydrogenase flavoprotein subunit; | 94.52 | |
| PLN00128 | 635 | Succinate dehydrogenase [ubiquinone] flavoprotein | 94.5 | |
| PRK06996 | 398 | hypothetical protein; Provisional | 94.49 | |
| PRK12834 | 549 | putative FAD-binding dehydrogenase; Reviewed | 94.48 | |
| PRK08626 | 657 | fumarate reductase flavoprotein subunit; Provision | 94.45 | |
| PRK07057 | 591 | sdhA succinate dehydrogenase flavoprotein subunit; | 94.44 | |
| PRK08243 | 392 | 4-hydroxybenzoate 3-monooxygenase; Validated | 94.4 | |
| PRK06126 | 545 | hypothetical protein; Provisional | 94.35 | |
| TIGR03364 | 365 | HpnW_proposed FAD dependent oxidoreductase TIGR033 | 94.32 | |
| PRK07512 | 513 | L-aspartate oxidase; Provisional | 94.3 | |
| PRK09564 | 444 | coenzyme A disulfide reductase; Reviewed | 94.23 | |
| PRK13339 | 497 | malate:quinone oxidoreductase; Reviewed | 94.16 | |
| PRK06263 | 543 | sdhA succinate dehydrogenase flavoprotein subunit; | 94.15 | |
| PRK12837 | 513 | 3-ketosteroid-delta-1-dehydrogenase; Provisional | 93.94 | |
| PRK08275 | 554 | putative oxidoreductase; Provisional | 93.91 | |
| COG1252 | 405 | Ndh NADH dehydrogenase, FAD-containing subunit [En | 93.8 | |
| PRK08205 | 583 | sdhA succinate dehydrogenase flavoprotein subunit; | 93.79 | |
| PRK06116 | 450 | glutathione reductase; Validated | 93.73 | |
| PRK07804 | 541 | L-aspartate oxidase; Provisional | 93.68 | |
| PRK08132 | 547 | FAD-dependent oxidoreductase; Provisional | 93.62 | |
| PRK07395 | 553 | L-aspartate oxidase; Provisional | 93.42 | |
| PRK08071 | 510 | L-aspartate oxidase; Provisional | 93.23 | |
| PRK06854 | 608 | adenylylsulfate reductase subunit alpha; Validated | 93.09 | |
| KOG1336 | 478 | consensus Monodehydroascorbate/ferredoxin reductas | 93.07 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 92.92 | |
| PRK07251 | 438 | pyridine nucleotide-disulfide oxidoreductase; Prov | 92.82 | |
| PRK08010 | 441 | pyridine nucleotide-disulfide oxidoreductase; Prov | 92.71 | |
| PRK06416 | 462 | dihydrolipoamide dehydrogenase; Reviewed | 92.63 | |
| TIGR01423 | 486 | trypano_reduc trypanothione-disulfide reductase. T | 92.62 | |
| PRK04965 | 377 | NADH:flavorubredoxin oxidoreductase; Provisional | 92.6 | |
| PRK06069 | 577 | sdhA succinate dehydrogenase flavoprotein subunit; | 92.58 | |
| PLN02985 | 514 | squalene monooxygenase | 92.56 | |
| PLN02507 | 499 | glutathione reductase | 92.5 | |
| PRK05249 | 461 | soluble pyridine nucleotide transhydrogenase; Prov | 92.44 | |
| PRK14694 | 468 | putative mercuric reductase; Provisional | 92.35 | |
| PRK07803 | 626 | sdhA succinate dehydrogenase flavoprotein subunit; | 92.34 | |
| TIGR01350 | 461 | lipoamide_DH dihydrolipoamide dehydrogenase. The m | 92.19 | |
| TIGR01424 | 446 | gluta_reduc_2 glutathione-disulfide reductase, pla | 91.84 | |
| PRK06184 | 502 | hypothetical protein; Provisional | 91.78 | |
| PRK14727 | 479 | putative mercuric reductase; Provisional | 91.77 | |
| TIGR01810 | 532 | betA choline dehydrogenase. This enzyme is a membe | 91.75 | |
| PRK14989 | 847 | nitrite reductase subunit NirD; Provisional | 91.68 | |
| PF13454 | 156 | NAD_binding_9: FAD-NAD(P)-binding | 91.6 | |
| PRK06753 | 373 | hypothetical protein; Provisional | 91.45 | |
| PRK07845 | 466 | flavoprotein disulfide reductase; Reviewed | 91.44 | |
| TIGR01421 | 450 | gluta_reduc_1 glutathione-disulfide reductase, ani | 91.38 | |
| TIGR01176 | 580 | fum_red_Fp fumarate reductase, flavoprotein subuni | 91.3 | |
| PTZ00306 | 1167 | NADH-dependent fumarate reductase; Provisional | 91.27 | |
| PLN02927 | 668 | antheraxanthin epoxidase/zeaxanthin epoxidase | 91.18 | |
| PRK09754 | 396 | phenylpropionate dioxygenase ferredoxin reductase | 91.17 | |
| PLN02172 | 461 | flavin-containing monooxygenase FMO GS-OX | 91.1 | |
| PRK08163 | 396 | salicylate hydroxylase; Provisional | 91.04 | |
| PRK07818 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 90.93 | |
| COG5044 | 434 | MRS6 RAB proteins geranylgeranyltransferase compon | 90.88 | |
| PRK13748 | 561 | putative mercuric reductase; Provisional | 90.85 | |
| PRK05192 | 618 | tRNA uridine 5-carboxymethylaminomethyl modificati | 90.73 | |
| PLN02815 | 594 | L-aspartate oxidase | 90.7 | |
| PRK08641 | 589 | sdhA succinate dehydrogenase flavoprotein subunit; | 90.62 | |
| PF04820 | 454 | Trp_halogenase: Tryptophan halogenase; InterPro: I | 90.61 | |
| PRK09231 | 582 | fumarate reductase flavoprotein subunit; Validated | 90.51 | |
| PRK06370 | 463 | mercuric reductase; Validated | 90.32 | |
| PRK09897 | 534 | hypothetical protein; Provisional | 90.29 | |
| TIGR01292 | 300 | TRX_reduct thioredoxin-disulfide reductase. This m | 90.26 | |
| PRK06912 | 458 | acoL dihydrolipoamide dehydrogenase; Validated | 90.17 | |
| PRK06327 | 475 | dihydrolipoamide dehydrogenase; Validated | 90.13 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 90.01 | |
| TIGR02462 | 544 | pyranose_ox pyranose oxidase. Pyranose oxidase (al | 89.78 | |
| TIGR02053 | 463 | MerA mercuric reductase. This model represents the | 89.77 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 89.76 | |
| KOG2404 | 477 | consensus Fumarate reductase, flavoprotein subunit | 89.72 | |
| COG4716 | 587 | Myosin-crossreactive antigen [Function unknown] | 89.7 | |
| TIGR00136 | 617 | gidA glucose-inhibited division protein A. GidA, t | 89.66 | |
| KOG1335 | 506 | consensus Dihydrolipoamide dehydrogenase [Energy p | 89.51 | |
| TIGR03385 | 427 | CoA_CoA_reduc CoA-disulfide reductase. Members of | 89.3 | |
| PRK09077 | 536 | L-aspartate oxidase; Provisional | 89.2 | |
| COG1249 | 454 | Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, | 89.15 | |
| PTZ00052 | 499 | thioredoxin reductase; Provisional | 89.13 | |
| TIGR02374 | 785 | nitri_red_nirB nitrite reductase [NAD(P)H], large | 89.11 | |
| PRK10262 | 321 | thioredoxin reductase; Provisional | 89.11 | |
| PRK07538 | 413 | hypothetical protein; Provisional | 89.03 | |
| PTZ00058 | 561 | glutathione reductase; Provisional | 89.02 | |
| PRK05976 | 472 | dihydrolipoamide dehydrogenase; Validated | 88.97 | |
| KOG2853 | 509 | consensus Possible oxidoreductase [General functio | 88.95 | |
| PTZ00318 | 424 | NADH dehydrogenase-like protein; Provisional | 88.94 | |
| PLN02661 | 357 | Putative thiazole synthesis | 88.8 | |
| TIGR02061 | 614 | aprA adenosine phosphosulphate reductase, alpha su | 88.74 | |
| PRK02106 | 560 | choline dehydrogenase; Validated | 88.67 | |
| COG2509 | 486 | Uncharacterized FAD-dependent dehydrogenases [Gene | 88.58 | |
| TIGR02023 | 388 | BchP-ChlP geranylgeranyl reductase. This model rep | 88.27 | |
| TIGR01438 | 484 | TGR thioredoxin and glutathione reductase selenopr | 88.24 | |
| PRK04965 | 377 | NADH:flavorubredoxin oxidoreductase; Provisional | 88.22 | |
| PRK06115 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 88.14 | |
| KOG0404 | 322 | consensus Thioredoxin reductase [Posttranslational | 88.14 | |
| PF05834 | 374 | Lycopene_cycl: Lycopene cyclase protein; InterPro: | 87.99 | |
| PF12831 | 428 | FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 | 87.65 | |
| PLN02546 | 558 | glutathione reductase | 87.36 | |
| TIGR01316 | 449 | gltA glutamate synthase (NADPH), homotetrameric. T | 86.7 | |
| PRK12810 | 471 | gltD glutamate synthase subunit beta; Reviewed | 86.41 | |
| COG0492 | 305 | TrxB Thioredoxin reductase [Posttranslational modi | 86.38 | |
| TIGR03169 | 364 | Nterm_to_SelD pyridine nucleotide-disulfide oxidor | 86.1 | |
| PF00743 | 531 | FMO-like: Flavin-binding monooxygenase-like; Inter | 85.18 | |
| PRK05335 | 436 | tRNA (uracil-5-)-methyltransferase Gid; Reviewed | 85.06 | |
| PRK06617 | 374 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 84.93 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 84.73 | |
| PRK08294 | 634 | phenol 2-monooxygenase; Provisional | 84.59 | |
| PRK11749 | 457 | dihydropyrimidine dehydrogenase subunit A; Provisi | 84.37 | |
| TIGR01318 | 467 | gltD_gamma_fam glutamate synthase small subunit fa | 84.1 | |
| TIGR02028 | 398 | ChlP geranylgeranyl reductase. This model represen | 84.03 | |
| PLN00093 | 450 | geranylgeranyl diphosphate reductase; Provisional | 83.99 | |
| PRK11445 | 351 | putative oxidoreductase; Provisional | 83.4 | |
| PRK07846 | 451 | mycothione reductase; Reviewed | 83.27 | |
| PF01134 | 392 | GIDA: Glucose inhibited division protein A; InterP | 82.83 | |
| PRK12831 | 464 | putative oxidoreductase; Provisional | 82.8 | |
| TIGR03219 | 414 | salicylate_mono salicylate 1-monooxygenase. Member | 82.66 | |
| PRK08849 | 384 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 81.72 | |
| PRK13800 | 897 | putative oxidoreductase/HEAT repeat-containing pro | 81.56 | |
| TIGR03452 | 452 | mycothione_red mycothione reductase. Mycothiol, a | 81.49 | |
| PF13434 | 341 | K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi | 81.47 | |
| PRK12769 | 654 | putative oxidoreductase Fe-S binding subunit; Revi | 81.3 | |
| PRK13512 | 438 | coenzyme A disulfide reductase; Provisional | 81.23 | |
| TIGR02374 | 785 | nitri_red_nirB nitrite reductase [NAD(P)H], large | 80.85 | |
| PRK09754 | 396 | phenylpropionate dioxygenase ferredoxin reductase | 80.63 | |
| PF01946 | 230 | Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. | 80.14 | |
| COG1251 | 793 | NirB NAD(P)H-nitrite reductase [Energy production | 80.06 |
| >PLN02487 zeta-carotene desaturase | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.7e-36 Score=287.00 Aligned_cols=297 Identities=20% Similarity=0.260 Sum_probs=237.7
Q ss_pred ccCCCCHHHHHHhHHHHHHhhhcCCcccccHHHHHHHHHHHHHhcCCCceeEeecCCCchhhhHHHHHHHHHcCCeEEcc
Q 019274 2 IQFGCSERLYRNVIGPLVQVGLFAPAEQCSAAATLGILYFIILAHQKNFDLVWCRGTLREKIFEPWMDSMRTRGCEFLDG 81 (343)
Q Consensus 2 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~sa~~~~~~l~~~~~~~~~~~~~~~~~gG~~~~l~~~l~~~l~~~G~~i~~~ 81 (343)
++++.+++++++||+|++.++++++++++|+++++.+|..+. ....++++.|++||+.+.|+++++++|+++|++|+++
T Consensus 237 ~r~~g~~~~~~~l~dPll~~~~~~~~d~~SA~~~~~vl~~~~-~~~~~~~l~~~~Gg~~~~l~~pl~~~L~~~Gg~V~l~ 315 (569)
T PLN02487 237 TSHGGTRMSIKRMWDPIAYALGFIDCDNISARCMLTIFSLFA-TKTEASLLRMLKGSPDVRLSGPIAKYITDRGGRFHLR 315 (569)
T ss_pred HHhCCCHHHHHHHHHHHHHHhhCCCHHHHHHHHHHHHHHHHh-hcCCcceeeecCCCchHHHHHHHHHHHHHcCCEEEeC
Confidence 456667789999999999999999999999999999986532 2445677899999987679999999999999999999
Q ss_pred eeeeEEEecCC-CC--eEEEEEE--C--CeEEecCEEEEeeChhhHHHhhhhhcccCchhHHhhccCcccceEEEEEEec
Q 019274 82 RRVTDFIYDEE-RC--CISDVVC--G--KETYSAGAVVLAVGISTLQELIKNSILCNREEFLKVLNLASIDVVSVKLWFD 154 (343)
Q Consensus 82 ~~V~~I~~~~~-~g--~v~~V~~--~--g~~~~ad~VV~a~p~~~~~~Ll~~~~~~~~~~~~~~~~l~~~~~~~v~l~~~ 154 (343)
++|++|..+++ +| +|++|++ + ++++.||.||+|+|++.+.+|+++.. +..+.+..+.++.+.++++++|+|+
T Consensus 316 ~~V~~I~~~~~~~g~~~v~gv~~~~~~~~~~~~aD~VV~A~p~~~~~~Llp~~~-~~~~~~~~l~~L~~~pi~tv~L~~d 394 (569)
T PLN02487 316 WGCREILYDKSPDGETYVTGLKVSKATEKEIVKADAYVAACDVPGIKRLLPEQW-REYEFFDNIYKLVGVPVVTVQLRYN 394 (569)
T ss_pred CceEEEEEecCCCCceeEEEEEEecCCCceEEECCEEEECCCHHHHHHhCCchh-hccHHHhHHhcCCCeeEEEEEEEec
Confidence 99999999742 13 4788888 3 34689999999999999999998753 2234577888898999999999999
Q ss_pred cCCCCCCCcc------eeecCCC-----Cccce-Eeeccccc-ccc-CCCCCeEEEEEeeCCCCCCCCCHHHHHHHHHHH
Q 019274 155 KKVTVPNVSN------ACSGFGD-----SLAWT-FFDLNKIY-DEH-KDDSATVIQADFYHANELMPLKDDQVVAKAVSY 220 (343)
Q Consensus 155 ~~~~~~~~~~------~~~~~~~-----~~~~~-~~d~~~~~-~~~-~~~~~~~i~~~~~~~~~~~~~~~~e~~~~~~~~ 220 (343)
+++..+.+-+ .+.+++. ...|. +++..... ..| ....++++.+++++++++..++++++++.++++
T Consensus 395 ~~v~~~~~~~~~r~l~~~~g~~~~~~~~~~~~~f~~di~l~~~~~~~~~~~g~~l~~vis~a~~~~~~~~~ei~~~~~~~ 474 (569)
T PLN02487 395 GWVTEMQDLELSRQLRRAAGLDNLLYSADADFSCFADLALTSPEDYYKEGEGSLIQAVLTPGDPYMPLSNDKIVEKVHKQ 474 (569)
T ss_pred ccccccccccccccccccccccccccccCCCcceEeeeecCCHHHHcccCCceEEEEEEcCCccccCCCHHHHHHHHHHH
Confidence 8765432110 1223321 11232 23422111 123 223457888888888888899999999999999
Q ss_pred HhhhcccCCCCceeeeEEEecCCCccccCCCCCCCCCCCCCCCCCeEEeeccccCCCCCccchHHHHHHHHHHHHHHHHh
Q 019274 221 LSKCIKDFSTATVMDHKIRRFPKSLTHFFPGSYKYMMRGFTSFPNLFMAGDWITTRHGSWSQERSYVTGLEAANRVVDYL 300 (343)
Q Consensus 221 L~~~~p~~~~~~~~~~~~~r~~~~~~~~~~g~~~~~p~~~~~~~~L~laGd~~~~g~~~~~~ega~~Sg~~aA~~il~~~ 300 (343)
|.++||.+.+.++.+..+.+.+++++...||+...||.+.|+++|||+||||+.++|| ++||||+.||..||+.|++.-
T Consensus 475 L~~~~p~~~~~~v~~~~vv~~~~at~~~~pg~~~~RP~~~T~~~nl~LAGD~t~~~yP-at~EgAv~SG~~AA~~i~~~~ 553 (569)
T PLN02487 475 VLELFPSSRGLEVTWSSVVKIGQSLYREAPGMDPFRPDQKTPISNFFLAGSYTKQDYI-DSMEGATLSGRQAAAYICEAG 553 (569)
T ss_pred HHHhCcccccCceEEEEEEEccCceeccCCCccccCCCCCCCCCCEEEeCcccccCCc-chHHHHHHHHHHHHHHHHHHh
Confidence 9999999876567888889999999999999988889999999999999999999999 799999999999999998865
Q ss_pred C
Q 019274 301 G 301 (343)
Q Consensus 301 ~ 301 (343)
+
T Consensus 554 ~ 554 (569)
T PLN02487 554 E 554 (569)
T ss_pred h
Confidence 4
|
|
| >TIGR02732 zeta_caro_desat carotene 7,8-desaturase | Back alignment and domain information |
|---|
| >PLN02612 phytoene desaturase | Back alignment and domain information |
|---|
| >TIGR03467 HpnE squalene-associated FAD-dependent desaturase | Back alignment and domain information |
|---|
| >TIGR02731 phytoene_desat phytoene desaturase | Back alignment and domain information |
|---|
| >PRK07233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07208 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR00562 proto_IX_ox protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >PRK12416 protoporphyrinogen oxidase; Provisional | Back alignment and domain information |
|---|
| >TIGR02733 desat_CrtD C-3',4' desaturase CrtD | Back alignment and domain information |
|---|
| >PLN02576 protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >PRK11883 protoporphyrinogen oxidase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02734 crtI_fam phytoene desaturase | Back alignment and domain information |
|---|
| >TIGR02730 carot_isom carotene isomerase | Back alignment and domain information |
|---|
| >PLN02268 probable polyamine oxidase | Back alignment and domain information |
|---|
| >PLN03000 amine oxidase | Back alignment and domain information |
|---|
| >COG3349 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) | Back alignment and domain information |
|---|
| >PLN02529 lysine-specific histone demethylase 1 | Back alignment and domain information |
|---|
| >PLN02676 polyamine oxidase | Back alignment and domain information |
|---|
| >KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02328 lysine-specific histone demethylase 1 homolog | Back alignment and domain information |
|---|
| >PLN02568 polyamine oxidase | Back alignment and domain information |
|---|
| >PLN02976 amine oxidase | Back alignment and domain information |
|---|
| >COG1231 Monoamine oxidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >COG2907 Predicted NAD/FAD-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13977 myosin-cross-reactive antigen; Provisional | Back alignment and domain information |
|---|
| >TIGR02352 thiamin_ThiO glycine oxidase ThiO | Back alignment and domain information |
|---|
| >PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 | Back alignment and domain information |
|---|
| >PTZ00363 rab-GDP dissociation inhibitor; Provisional | Back alignment and domain information |
|---|
| >PRK00711 D-amino acid dehydrogenase small subunit; Validated | Back alignment and domain information |
|---|
| >PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] | Back alignment and domain information |
|---|
| >TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase | Back alignment and domain information |
|---|
| >TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain | Back alignment and domain information |
|---|
| >TIGR01377 soxA_mon sarcosine oxidase, monomeric form | Back alignment and domain information |
|---|
| >PF07156 Prenylcys_lyase: Prenylcysteine lyase; InterPro: IPR010795 This entry represents a conserved region found in a group of prenylcysteine lyases (1 | Back alignment and domain information |
|---|
| >PRK12409 D-amino acid dehydrogenase small subunit; Provisional | Back alignment and domain information |
|---|
| >PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function | Back alignment and domain information |
|---|
| >PRK11259 solA N-methyltryptophan oxidase; Provisional | Back alignment and domain information |
|---|
| >KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit | Back alignment and domain information |
|---|
| >TIGR02032 GG-red-SF geranylgeranyl reductase family | Back alignment and domain information |
|---|
| >PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases | Back alignment and domain information |
|---|
| >PRK10015 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PLN02464 glycerol-3-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK06847 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit | Back alignment and domain information |
|---|
| >PRK06185 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated | Back alignment and domain information |
|---|
| >TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family | Back alignment and domain information |
|---|
| >PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG2081 Predicted flavoproteins [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02485 CobZ_N-term precorrin 3B synthase CobZ | Back alignment and domain information |
|---|
| >PTZ00383 malate:quinone oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase | Back alignment and domain information |
|---|
| >PRK08274 tricarballylate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK13369 glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG2852 consensus Possible oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07045 putative monooxygenase; Reviewed | Back alignment and domain information |
|---|
| >PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways | Back alignment and domain information |
|---|
| >TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family | Back alignment and domain information |
|---|
| >PRK07190 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >COG0579 Predicted dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A | Back alignment and domain information |
|---|
| >PF00890 FAD_binding_2: FAD binding domain of the Pfam family | Back alignment and domain information |
|---|
| >PRK11728 hydroxyglutarate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK06134 putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >TIGR00275 flavoprotein, HI0933 family | Back alignment and domain information |
|---|
| >PRK07588 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01790 carotene-cycl lycopene cyclase family protein | Back alignment and domain information |
|---|
| >PRK07121 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E | Back alignment and domain information |
|---|
| >PRK08244 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02697 lycopene epsilon cyclase | Back alignment and domain information |
|---|
| >PRK12843 putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >KOG1439 consensus RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10157 putative oxidoreductase FixC; Provisional | Back alignment and domain information |
|---|
| >PRK06834 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase | Back alignment and domain information |
|---|
| >PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated | Back alignment and domain information |
|---|
| >TIGR01813 flavo_cyto_c flavocytochrome c | Back alignment and domain information |
|---|
| >PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional | Back alignment and domain information |
|---|
| >PRK04176 ribulose-1,5-biphosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase | Back alignment and domain information |
|---|
| >PRK06481 fumarate reductase flavoprotein subunit; Validated | Back alignment and domain information |
|---|
| >PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle | Back alignment and domain information |
|---|
| >PRK09126 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02463 lycopene beta cyclase | Back alignment and domain information |
|---|
| >PRK06175 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated | Back alignment and domain information |
|---|
| >PRK08401 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup | Back alignment and domain information |
|---|
| >PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12842 putative succinate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK05257 malate:quinone oxidoreductase; Validated | Back alignment and domain information |
|---|
| >PRK12839 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup | Back alignment and domain information |
|---|
| >TIGR00292 thiazole biosynthesis enzyme | Back alignment and domain information |
|---|
| >PRK08013 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR00551 nadB L-aspartate oxidase | Back alignment and domain information |
|---|
| >PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional | Back alignment and domain information |
|---|
| >PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] | Back alignment and domain information |
|---|
| >PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria | Back alignment and domain information |
|---|
| >PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit | Back alignment and domain information |
|---|
| >PRK06996 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12834 putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK08626 fumarate reductase flavoprotein subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated | Back alignment and domain information |
|---|
| >PRK06126 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 | Back alignment and domain information |
|---|
| >PRK07512 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK09564 coenzyme A disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK13339 malate:quinone oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08275 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK06116 glutathione reductase; Validated | Back alignment and domain information |
|---|
| >PRK07804 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK08132 FAD-dependent oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07395 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK08071 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK06854 adenylylsulfate reductase subunit alpha; Validated | Back alignment and domain information |
|---|
| >KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06416 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01423 trypano_reduc trypanothione-disulfide reductase | Back alignment and domain information |
|---|
| >PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PLN02985 squalene monooxygenase | Back alignment and domain information |
|---|
| >PLN02507 glutathione reductase | Back alignment and domain information |
|---|
| >PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14694 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant | Back alignment and domain information |
|---|
| >PRK06184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14727 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01810 betA choline dehydrogenase | Back alignment and domain information |
|---|
| >PRK14989 nitrite reductase subunit NirD; Provisional | Back alignment and domain information |
|---|
| >PF13454 NAD_binding_9: FAD-NAD(P)-binding | Back alignment and domain information |
|---|
| >PRK06753 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07845 flavoprotein disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial | Back alignment and domain information |
|---|
| >TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit | Back alignment and domain information |
|---|
| >PTZ00306 NADH-dependent fumarate reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase | Back alignment and domain information |
|---|
| >PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional | Back alignment and domain information |
|---|
| >PLN02172 flavin-containing monooxygenase FMO GS-OX | Back alignment and domain information |
|---|
| >PRK08163 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK07818 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13748 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated | Back alignment and domain information |
|---|
| >PLN02815 L-aspartate oxidase | Back alignment and domain information |
|---|
| >PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan | Back alignment and domain information |
|---|
| >PRK09231 fumarate reductase flavoprotein subunit; Validated | Back alignment and domain information |
|---|
| >PRK06370 mercuric reductase; Validated | Back alignment and domain information |
|---|
| >PRK09897 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01292 TRX_reduct thioredoxin-disulfide reductase | Back alignment and domain information |
|---|
| >PRK06912 acoL dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06327 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >TIGR02462 pyranose_ox pyranose oxidase | Back alignment and domain information |
|---|
| >TIGR02053 MerA mercuric reductase | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG4716 Myosin-crossreactive antigen [Function unknown] | Back alignment and domain information |
|---|
| >TIGR00136 gidA glucose-inhibited division protein A | Back alignment and domain information |
|---|
| >KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03385 CoA_CoA_reduc CoA-disulfide reductase | Back alignment and domain information |
|---|
| >PRK09077 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >PTZ00052 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit | Back alignment and domain information |
|---|
| >PRK10262 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07538 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00058 glutathione reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05976 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG2853 consensus Possible oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00318 NADH dehydrogenase-like protein; Provisional | Back alignment and domain information |
|---|
| >PLN02661 Putative thiazole synthesis | Back alignment and domain information |
|---|
| >TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit | Back alignment and domain information |
|---|
| >PRK02106 choline dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02023 BchP-ChlP geranylgeranyl reductase | Back alignment and domain information |
|---|
| >TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein | Back alignment and domain information |
|---|
| >PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06115 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins | Back alignment and domain information |
|---|
| >PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A | Back alignment and domain information |
|---|
| >PLN02546 glutathione reductase | Back alignment and domain information |
|---|
| >TIGR01316 gltA glutamate synthase (NADPH), homotetrameric | Back alignment and domain information |
|---|
| >PRK12810 gltD glutamate synthase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein | Back alignment and domain information |
|---|
| >PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] | Back alignment and domain information |
|---|
| >PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed | Back alignment and domain information |
|---|
| >PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >PRK08294 phenol 2-monooxygenase; Provisional | Back alignment and domain information |
|---|
| >PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial | Back alignment and domain information |
|---|
| >TIGR02028 ChlP geranylgeranyl reductase | Back alignment and domain information |
|---|
| >PLN00093 geranylgeranyl diphosphate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK11445 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07846 mycothione reductase; Reviewed | Back alignment and domain information |
|---|
| >PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria | Back alignment and domain information |
|---|
| >PRK12831 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03219 salicylate_mono salicylate 1-monooxygenase | Back alignment and domain information |
|---|
| >PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03452 mycothione_red mycothione reductase | Back alignment and domain information |
|---|
| >PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B | Back alignment and domain information |
|---|
| >PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK13512 coenzyme A disulfide reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit | Back alignment and domain information |
|---|
| >PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional | Back alignment and domain information |
|---|
| >PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K | Back alignment and domain information |
|---|
| >COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 343 | |||
| 4dsg_A | 484 | UDP-galactopyranose mutase; rossmann fold, flavin | 3e-11 | |
| 3i6d_A | 470 | Protoporphyrinogen oxidase; protein-inhibitor comp | 6e-11 | |
| 2ivd_A | 478 | PPO, PPOX, protoporphyrinogen oxidase; porphyrin b | 3e-08 | |
| 3utf_A | 513 | UDP-galactopyranose mutase; nucleotide binding, fl | 3e-06 | |
| 1sez_A | 504 | Protoporphyrinogen oxidase, mitochondrial; FAD-bin | 5e-06 | |
| 1s3e_A | 520 | Amine oxidase [flavin-containing] B; human monoami | 2e-05 | |
| 2jae_A | 489 | L-amino acid oxidase; oxidoreductase, dimerisation | 4e-05 | |
| 2e1m_C | 181 | L-glutamate oxidase; L-amino acid oxidase, FAD, L- | 6e-05 | |
| 3lov_A | 475 | Protoporphyrinogen oxidase; structural genomics, J | 7e-05 | |
| 2xag_A | 852 | Lysine-specific histone demethylase 1; amine oxida | 2e-04 |
| >4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Length = 484 | Back alignment and structure |
|---|
Score = 63.3 bits (153), Expect = 3e-11
Identities = 35/321 (10%), Positives = 89/321 (27%), Gaps = 30/321 (9%)
Query: 3 QFGCSERLYRNVIGPLVQVGLFAPAEQCSAAATLGILYFIILAHQKNFDLVW-------- 54
QFG E + + P P S + + L +
Sbjct: 146 QFG--EGIADIFMRPYNFKVWAVPPCLMSTEWVEERVAPVDLERIRRNIQENRDDLGWGP 203
Query: 55 ------CRGTLREKIFEPWMDSMRTRGCEFLDGRRVTDFIYDEERCCISDVVCGKETYSA 108
+ I++ + + + F G + D + S+ E S
Sbjct: 204 NATFRFPQRGGTGIIYQAIKEKLPSEKLTFNSGFQAIAIDADAKTITFSN----GEVVSY 259
Query: 109 GAVVLAVGISTLQELIKNSILCNREEFLKVLN-LASIDVVSVKLWFDKKVTVPNVSNACS 167
++ V L + K + +E+ + + + + + +
Sbjct: 260 DYLISTVPFDNLLRMTKGTGFKGYDEWPAIADKMVYSSTNVIGIGVKGTPPPHLKTACWL 319
Query: 168 GFGDS----LAWTFFDLNKIYDEHKDDSATVIQADFYHANELMPLKDDQVVAKAVSYLSK 223
F + T F + + + + + + + P+ ++ +
Sbjct: 320 YFPEDTSPFYRATVF--SNYSKYNVPEGHWSLMLEVSES-KYKPVNHSTLIEDCIVGCLA 376
Query: 224 CIKDFSTATVMDHKIRRFPKSLTHFFPGSYKYM--MRGFTSFPNLFMAGDWITTRHGSWS 281
++ R K F G + + ++ G + R+ +
Sbjct: 377 SNLLLPEDLLVSKWHYRIEKGYPTPFIGRNNLLEKAQPELMSRCIYSRGRFGAWRYEVGN 436
Query: 282 QERSYVTGLEAANRVVDYLGD 302
Q+ S++ G+EA + V+ +
Sbjct: 437 QDHSFMQGVEAIDHVLGLATE 457
|
| >3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Length = 470 | Back alignment and structure |
|---|
| >2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Length = 478 | Back alignment and structure |
|---|
| >3utf_A UDP-galactopyranose mutase; nucleotide binding, flavin adenine dinucleotide BIND isomerase; HET: FDA; 2.25A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Length = 513 | Back alignment and structure |
|---|
| >1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504 | Back alignment and structure |
|---|
| >1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Length = 520 | Back alignment and structure |
|---|
| >2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Length = 489 | Back alignment and structure |
|---|
| >2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 181 | Back alignment and structure |
|---|
| >3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Length = 475 | Back alignment and structure |
|---|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 343 | |||
| 3ka7_A | 425 | Oxidoreductase; structural genomics, PSI-2, protei | 99.97 | |
| 3nrn_A | 421 | Uncharacterized protein PF1083; alpha-beta protein | 99.95 | |
| 1s3e_A | 520 | Amine oxidase [flavin-containing] B; human monoami | 99.94 | |
| 3nks_A | 477 | Protoporphyrinogen oxidase; FAD containing protein | 99.94 | |
| 4dgk_A | 501 | Phytoene dehydrogenase; the FAD/NAD(P)-binding ros | 99.93 | |
| 2yg5_A | 453 | Putrescine oxidase; oxidoreductase, flavin; HET: F | 99.91 | |
| 2ivd_A | 478 | PPO, PPOX, protoporphyrinogen oxidase; porphyrin b | 99.91 | |
| 3i6d_A | 470 | Protoporphyrinogen oxidase; protein-inhibitor comp | 99.9 | |
| 3lov_A | 475 | Protoporphyrinogen oxidase; structural genomics, J | 99.9 | |
| 2vvm_A | 495 | Monoamine oxidase N; FAD, peroxisome, flavoprotein | 99.89 | |
| 1sez_A | 504 | Protoporphyrinogen oxidase, mitochondrial; FAD-bin | 99.89 | |
| 1b37_A | 472 | Protein (polyamine oxidase); flavin-dependent amin | 99.88 | |
| 3qj4_A | 342 | Renalase; FAD/NAD(P)-binding rossmann fold superfa | 99.87 | |
| 4gde_A | 513 | UDP-galactopyranose mutase; flavin adenine dinucle | 99.84 | |
| 4dsg_A | 484 | UDP-galactopyranose mutase; rossmann fold, flavin | 99.83 | |
| 2jae_A | 489 | L-amino acid oxidase; oxidoreductase, dimerisation | 99.8 | |
| 2xag_A | 852 | Lysine-specific histone demethylase 1; amine oxida | 99.79 | |
| 2z3y_A | 662 | Lysine-specific histone demethylase 1; chromatin, | 99.78 | |
| 2iid_A | 498 | L-amino-acid oxidase; flavoenzyme, FAD binding dom | 99.77 | |
| 3k7m_X | 431 | 6-hydroxy-L-nicotine oxidase; enantiomeric substra | 99.76 | |
| 4gut_A | 776 | Lysine-specific histone demethylase 1B; histone de | 99.71 | |
| 1rsg_A | 516 | FMS1 protein; FAD binding motif, oxidoreductase; H | 99.66 | |
| 2b9w_A | 424 | Putative aminooxidase; isomerase, conjugated linol | 99.63 | |
| 3ayj_A | 721 | Pro-enzyme of L-phenylalanine oxidase; amino acid | 99.61 | |
| 1yvv_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 99.59 | |
| 2bcg_G | 453 | Secretory pathway GDP dissociation inhibitor; RABG | 99.26 | |
| 1d5t_A | 433 | Guanine nucleotide dissociation inhibitor; ultra-h | 99.15 | |
| 1i8t_A | 367 | UDP-galactopyranose mutase; rossman fold, FAD, con | 99.12 | |
| 2bi7_A | 384 | UDP-galactopyranose mutase; FAD, flavoprotein, iso | 99.1 | |
| 1v0j_A | 399 | UDP-galactopyranose mutase; flavoprotein, isomeras | 99.08 | |
| 3p1w_A | 475 | Rabgdi protein; GDI RAB, malaria, structural genom | 99.03 | |
| 2e1m_C | 181 | L-glutamate oxidase; L-amino acid oxidase, FAD, L- | 98.8 | |
| 1vg0_A | 650 | RAB proteins geranylgeranyltransferase component A | 98.66 | |
| 3hdq_A | 397 | UDP-galactopyranose mutase; substrate and inhibito | 98.55 | |
| 3dje_A | 438 | Fructosyl amine: oxygen oxidoreductase; fructosyl- | 98.52 | |
| 1y56_B | 382 | Sarcosine oxidase; dehydrogenase, protein-protein | 98.46 | |
| 1ryi_A | 382 | Glycine oxidase; flavoprotein, protein-inhibitor c | 98.43 | |
| 3nyc_A | 381 | D-arginine dehydrogenase; FAD, imino-arginine, oxi | 98.42 | |
| 3dme_A | 369 | Conserved exported protein; structural genomics, P | 98.41 | |
| 2gag_B | 405 | Heterotetrameric sarcosine oxidase beta-subunit; f | 98.38 | |
| 3axb_A | 448 | Putative oxidoreductase; dinucleotide-binding fold | 98.29 | |
| 2gf3_A | 389 | MSOX, monomeric sarcosine oxidase; flavoprotein ox | 98.11 | |
| 3ps9_A | 676 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 98.08 | |
| 3pvc_A | 689 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 98.07 | |
| 2oln_A | 397 | NIKD protein; flavoprotein, rossmann fold, oxidore | 98.01 | |
| 3da1_A | 561 | Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 | 98.0 | |
| 2rgh_A | 571 | Alpha-glycerophosphate oxidase; flavoprotein oxida | 97.95 | |
| 3cgv_A | 397 | Geranylgeranyl reductase related protein; NP_39399 | 97.82 | |
| 3atr_A | 453 | Conserved archaeal protein; saturating double bond | 97.73 | |
| 3oz2_A | 397 | Digeranylgeranylglycerophospholipid reductase; str | 97.68 | |
| 2qcu_A | 501 | Aerobic glycerol-3-phosphate dehydrogenase; glycer | 97.65 | |
| 2gmh_A | 584 | Electron transfer flavoprotein-ubiquinone oxidored | 97.36 | |
| 3nix_A | 421 | Flavoprotein/dehydrogenase; structural genomics, P | 97.35 | |
| 3kkj_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 97.32 | |
| 3ihg_A | 535 | RDME; flavoenzyme, anthracycline, polyketide biosy | 97.19 | |
| 2e1m_B | 130 | L-glutamate oxidase; L-amino acid oxidase, FAD, L- | 97.13 | |
| 3rp8_A | 407 | Flavoprotein monooxygenase; FAD-binding protein, o | 97.09 | |
| 2i0z_A | 447 | NAD(FAD)-utilizing dehydrogenases; structural geno | 97.05 | |
| 3e1t_A | 512 | Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro | 97.02 | |
| 1k0i_A | 394 | P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h | 97.0 | |
| 3g3e_A | 351 | D-amino-acid oxidase; FAD, flavoprotein, oxidoredu | 96.95 | |
| 3i3l_A | 591 | Alkylhalidase CMLS; flavin-dependent halogenase, c | 96.86 | |
| 1pj5_A | 830 | N,N-dimethylglycine oxidase; channelling, FAD bind | 96.86 | |
| 3nlc_A | 549 | Uncharacterized protein VP0956; FAD-binding protei | 96.76 | |
| 3lxd_A | 415 | FAD-dependent pyridine nucleotide-disulphide oxido | 96.67 | |
| 3fg2_P | 404 | Putative rubredoxin reductase; ferredoxin reductas | 96.67 | |
| 2uzz_A | 372 | N-methyl-L-tryptophan oxidase; N-methyltryptophan | 96.64 | |
| 3v76_A | 417 | Flavoprotein; structural genomics, PSI-biology, NE | 96.55 | |
| 4at0_A | 510 | 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore | 96.54 | |
| 1y0p_A | 571 | Fumarate reductase flavoprotein subunit; flavocyto | 96.5 | |
| 1qo8_A | 566 | Flavocytochrome C3 fumarate reductase; oxidoreduct | 96.37 | |
| 2qa2_A | 499 | CABE, polyketide oxygenase CABE; FAD, angucycline, | 96.29 | |
| 1c0p_A | 363 | D-amino acid oxidase; alpha-beta-alpha motif, flav | 96.29 | |
| 1d4d_A | 572 | Flavocytochrome C fumarate reductase; oxidoreducta | 96.26 | |
| 2qa1_A | 500 | PGAE, polyketide oxygenase PGAE; FAD, angucycline, | 96.25 | |
| 2cdu_A | 452 | NADPH oxidase; flavoenzyme, oxidoreductase; HET: F | 96.23 | |
| 3fmw_A | 570 | Oxygenase; mithramycin, baeyer-villiger, flavin bi | 96.05 | |
| 2gqf_A | 401 | Hypothetical protein HI0933; structural genomics, | 96.04 | |
| 2cul_A | 232 | Glucose-inhibited division protein A-related PROT | 95.91 | |
| 3c4n_A | 405 | Uncharacterized protein DR_0571; alpha-beta protei | 95.9 | |
| 2dkh_A | 639 | 3-hydroxybenzoate hydroxylase; flavoprotein, monoo | 95.88 | |
| 3oc4_A | 452 | Oxidoreductase, pyridine nucleotide-disulfide FAM; | 95.8 | |
| 1q1r_A | 431 | Putidaredoxin reductase; glutathione reductase fol | 95.65 | |
| 3iwa_A | 472 | FAD-dependent pyridine nucleotide-disulphide oxido | 95.59 | |
| 1n4w_A | 504 | CHOD, cholesterol oxidase; flavoenzyme, steroid me | 95.49 | |
| 2wdq_A | 588 | Succinate dehydrogenase flavoprotein subunit; succ | 95.49 | |
| 2bs2_A | 660 | Quinol-fumarate reductase flavoprotein subunit A; | 95.46 | |
| 1mo9_A | 523 | ORF3; nucleotide binding motifs, nucleotide bindin | 95.39 | |
| 1trb_A | 320 | Thioredoxin reductase; oxidoreductase(flavoenzyme) | 95.39 | |
| 2ywl_A | 180 | Thioredoxin reductase related protein; uncharacter | 95.39 | |
| 2e4g_A | 550 | Tryptophan halogenase; flavin-binding, rebeccamyci | 95.39 | |
| 2h88_A | 621 | Succinate dehydrogenase flavoprotein subunit; comp | 95.38 | |
| 2weu_A | 511 | Tryptophan 5-halogenase; regioselectivity, antifun | 95.24 | |
| 1coy_A | 507 | Cholesterol oxidase; oxidoreductase(oxygen recepto | 95.18 | |
| 1rp0_A | 284 | ARA6, thiazole biosynthetic enzyme; protein ligand | 95.14 | |
| 3ef6_A | 410 | Toluene 1,2-dioxygenase system ferredoxin--NAD(+) | 95.13 | |
| 4a9w_A | 357 | Monooxygenase; baeyer-villiger, FAD, oxidoreductas | 95.09 | |
| 2x3n_A | 399 | Probable FAD-dependent monooxygenase; oxidoreducta | 95.05 | |
| 4dna_A | 463 | Probable glutathione reductase; structural genomic | 95.0 | |
| 2wpf_A | 495 | Trypanothione reductase; oxidoreductase, trypanoso | 95.0 | |
| 2bc0_A | 490 | NADH oxidase; flavoprotein, pyridine nucleotide di | 94.99 | |
| 1zk7_A | 467 | HGII, reductase, mercuric reductase; mercuric ION | 94.96 | |
| 1fec_A | 490 | Trypanothione reductase; redox-active center, oxid | 94.95 | |
| 2hqm_A | 479 | GR, grase, glutathione reductase; glutathione redu | 94.92 | |
| 1xdi_A | 499 | RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun | 94.92 | |
| 1m6i_A | 493 | Programmed cell death protein 8; apoptosis, AIF, o | 94.87 | |
| 2v3a_A | 384 | Rubredoxin reductase; alkane degradation, NADH oxi | 94.72 | |
| 3o0h_A | 484 | Glutathione reductase; ssgcid, structur genomics, | 94.68 | |
| 2aqj_A | 538 | Tryptophan halogenase, pRNA; flavin-dependent halo | 94.65 | |
| 2e5v_A | 472 | L-aspartate oxidase; archaea, oxidoreductase; HET: | 94.6 | |
| 3cgb_A | 480 | Pyridine nucleotide-disulfide oxidoreductase, CLA; | 94.56 | |
| 2zxi_A | 637 | TRNA uridine 5-carboxymethylaminomethyl modificat | 94.52 | |
| 1ges_A | 450 | Glutathione reductase; oxidoreductase(flavoenzyme) | 94.5 | |
| 1kf6_A | 602 | Fumarate reductase flavoprotein; respiration, fuma | 94.47 | |
| 3ces_A | 651 | MNMG, tRNA uridine 5-carboxymethylaminomethyl modi | 94.26 | |
| 3itj_A | 338 | Thioredoxin reductase 1; disulfide B flavoprotein, | 94.22 | |
| 3ab1_A | 360 | Ferredoxin--NADP reductase; oxidoreductase, electr | 94.2 | |
| 2yqu_A | 455 | 2-oxoglutarate dehydrogenase E3 component; lipoami | 94.13 | |
| 1nhp_A | 447 | NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA | 94.13 | |
| 1chu_A | 540 | Protein (L-aspartate oxidase); flavoenzyme, NAD bi | 94.03 | |
| 2pyx_A | 526 | Tryptophan halogenase; structural genomics, JOI fo | 93.97 | |
| 3cty_A | 319 | Thioredoxin reductase; FAD, oxidoreductase, flavin | 93.95 | |
| 3d1c_A | 369 | Flavin-containing putative monooxygenase; NP_37310 | 93.92 | |
| 1onf_A | 500 | GR, grase, glutathione reductase; oxidoreductase; | 93.81 | |
| 2r9z_A | 463 | Glutathione amide reductase; NAD, FAD, substrate s | 93.71 | |
| 2e1m_A | 376 | L-glutamate oxidase; L-amino acid oxidase, FAD, L- | 93.55 | |
| 3alj_A | 379 | 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; | 93.55 | |
| 3lad_A | 476 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 93.48 | |
| 1jnr_A | 643 | Adenylylsulfate reductase; oxidoreductase; HET: FA | 93.47 | |
| 3lzw_A | 332 | Ferredoxin--NADP reductase 2; ferredoxin reductase | 93.47 | |
| 1zmd_A | 474 | Dihydrolipoyl dehydrogenase; lipoamide dehydrogena | 93.44 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 93.27 | |
| 2gqw_A | 408 | Ferredoxin reductase; flavoprotein, oxidoreductase | 93.21 | |
| 3r9u_A | 315 | Thioredoxin reductase; structural genomics, center | 93.21 | |
| 3nlc_A | 549 | Uncharacterized protein VP0956; FAD-binding protei | 93.19 | |
| 2bry_A | 497 | NEDD9 interacting protein with calponin homology a | 93.15 | |
| 3dk9_A | 478 | Grase, GR, glutathione reductase; flavoenzyme, nic | 93.13 | |
| 2zbw_A | 335 | Thioredoxin reductase; redox protein, oxidoreducta | 93.08 | |
| 2eq6_A | 464 | Pyruvate dehydrogenase complex, dihydrolipoamide d | 93.04 | |
| 2qae_A | 468 | Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin | 92.9 | |
| 2a8x_A | 464 | Dihydrolipoyl dehydrogenase, E3 component of alpha | 92.63 | |
| 3gwf_A | 540 | Cyclohexanone monooxygenase; flavoprotein biocatal | 92.61 | |
| 4ap3_A | 549 | Steroid monooxygenase; oxidoreductase, baeyer-vill | 92.52 | |
| 1ebd_A | 455 | E3BD, dihydrolipoamide dehydrogenase; redox-active | 92.47 | |
| 3gyx_A | 662 | Adenylylsulfate reductase; oxidoreductase; HET: FA | 92.25 | |
| 1ojt_A | 482 | Surface protein; redox-active center, glycolysis, | 92.17 | |
| 3cp8_A | 641 | TRNA uridine 5-carboxymethylaminomethyl modificati | 92.15 | |
| 3dgh_A | 483 | TRXR-1, thioredoxin reductase 1, mitochondrial; ox | 92.12 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 92.09 | |
| 2xve_A | 464 | Flavin-containing monooxygenase; oxidoreductase; H | 92.01 | |
| 3ab1_A | 360 | Ferredoxin--NADP reductase; oxidoreductase, electr | 92.01 | |
| 3urh_A | 491 | Dihydrolipoyl dehydrogenase; PSI-biology, structur | 92.0 | |
| 1v59_A | 478 | Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog | 91.93 | |
| 1fl2_A | 310 | Alkyl hydroperoxide reductase subunit F; reactive | 91.92 | |
| 1fl2_A | 310 | Alkyl hydroperoxide reductase subunit F; reactive | 91.75 | |
| 1kdg_A | 546 | CDH, cellobiose dehydrogenase; GMC oxidoreductase, | 91.65 | |
| 2zbw_A | 335 | Thioredoxin reductase; redox protein, oxidoreducta | 91.57 | |
| 3k30_A | 690 | Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi | 91.54 | |
| 1dxl_A | 470 | Dihydrolipoamide dehydrogenase; oxidoreductase, mu | 91.51 | |
| 4g6h_A | 502 | Rotenone-insensitive NADH-ubiquinone oxidoreducta | 91.17 | |
| 3uox_A | 545 | Otemo; baeyer-villiger monooxygenase, oxidoreducta | 90.97 | |
| 1vdc_A | 333 | NTR, NADPH dependent thioredoxin reductase; hypoth | 90.96 | |
| 3jsk_A | 344 | Cypbp37 protein; octameric thiazole synthase, bios | 90.75 | |
| 4b1b_A | 542 | TRXR, thioredoxin reductase; oxidoreductase, FAD, | 90.68 | |
| 2jbv_A | 546 | Choline oxidase; alcohol oxidation, flavoenyzme ox | 90.48 | |
| 3h8l_A | 409 | NADH oxidase; membrane protein, complete form, ros | 90.33 | |
| 2q0l_A | 311 | TRXR, thioredoxin reductase; bacterial thiredoxin | 90.13 | |
| 3lzw_A | 332 | Ferredoxin--NADP reductase 2; ferredoxin reductase | 90.01 | |
| 1y56_A | 493 | Hypothetical protein PH1363; dehydrogenase, protei | 89.81 | |
| 2vou_A | 397 | 2,6-dihydroxypyridine hydroxylase; oxidoreductase, | 89.73 | |
| 3h28_A | 430 | Sulfide-quinone reductase; monotopic membrane prot | 89.69 | |
| 1w4x_A | 542 | Phenylacetone monooxygenase; baeyer-villiger, FAD; | 89.59 | |
| 2gv8_A | 447 | Monooxygenase; FMO, FAD, NADPH, cofactor complex, | 89.53 | |
| 3fpz_A | 326 | Thiazole biosynthetic enzyme; FAD, mitochondrion, | 89.44 | |
| 2gjc_A | 326 | Thiazole biosynthetic enzyme, mitochondrial; gluta | 89.42 | |
| 3dgz_A | 488 | Thioredoxin reductase 2; oxidoreductase, rossmann, | 89.35 | |
| 3f8d_A | 323 | Thioredoxin reductase (TRXB-3); redox protein, nuc | 89.3 | |
| 1vdc_A | 333 | NTR, NADPH dependent thioredoxin reductase; hypoth | 89.1 | |
| 3kd9_A | 449 | Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o | 89.03 | |
| 3ic9_A | 492 | Dihydrolipoamide dehydrogenase; APC62701, colwelli | 89.02 | |
| 3klj_A | 385 | NAD(FAD)-dependent dehydrogenase, NIRB-family (N- | 88.97 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 88.69 | |
| 1pn0_A | 665 | Phenol 2-monooxygenase; two dimers, TLS refinement | 88.61 | |
| 3s5w_A | 463 | L-ornithine 5-monooxygenase; class B flavin depend | 88.29 | |
| 3s5w_A | 463 | L-ornithine 5-monooxygenase; class B flavin depend | 87.86 | |
| 2q0l_A | 311 | TRXR, thioredoxin reductase; bacterial thiredoxin | 87.73 | |
| 2q7v_A | 325 | Thioredoxin reductase; rossman fold, FAD, flavopro | 87.67 | |
| 3c96_A | 410 | Flavin-containing monooxygenase; FAD, oxidoreducta | 87.58 | |
| 3itj_A | 338 | Thioredoxin reductase 1; disulfide B flavoprotein, | 87.5 | |
| 4eqs_A | 437 | Coenzyme A disulfide reductase; oxidoreductase; HE | 87.42 | |
| 3f8d_A | 323 | Thioredoxin reductase (TRXB-3); redox protein, nuc | 87.37 | |
| 1xhc_A | 367 | NADH oxidase /nitrite reductase; southe collaborat | 87.37 | |
| 1lvl_A | 458 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 86.86 | |
| 3cty_A | 319 | Thioredoxin reductase; FAD, oxidoreductase, flavin | 86.67 | |
| 3qvp_A | 583 | Glucose oxidase; oxidoreductase; HET: NAG BMA MAN | 86.01 | |
| 3pl8_A | 623 | Pyranose 2-oxidase; substrate complex, H167A mutan | 85.92 | |
| 1ju2_A | 536 | HydroxynitrIle lyase; flavin, GMC oxidoreductase, | 85.63 | |
| 3hyw_A | 430 | Sulfide-quinone reductase; monotopic membrane prot | 85.23 | |
| 2xdo_A | 398 | TETX2 protein; tetracycline degradation, tigecycli | 85.04 | |
| 3sx6_A | 437 | Sulfide-quinone reductase, putative; sulfide:quino | 84.71 | |
| 3d1c_A | 369 | Flavin-containing putative monooxygenase; NP_37310 | 84.53 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 84.5 | |
| 1trb_A | 320 | Thioredoxin reductase; oxidoreductase(flavoenzyme) | 84.15 | |
| 4gcm_A | 312 | TRXR, thioredoxin reductase; FAD/NAD-linked reduct | 83.99 | |
| 1cjc_A | 460 | Protein (adrenodoxin reductase); flavoenzyme, MAD | 83.89 | |
| 3q9t_A | 577 | Choline dehydrogenase and related flavoproteins; g | 83.1 | |
| 3fim_B | 566 | ARYL-alcohol oxidase; AAO, lignin degradation, oxi | 82.12 | |
| 2q7v_A | 325 | Thioredoxin reductase; rossman fold, FAD, flavopro | 82.03 | |
| 2a87_A | 335 | TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL | 81.53 | |
| 3fbs_A | 297 | Oxidoreductase; structural genomics, PSI2, MCSG, p | 81.41 | |
| 2r0c_A | 549 | REBC; flavin adenine dinucleotide, monooxygenase, | 81.09 | |
| 2gag_A | 965 | Heterotetrameric sarcosine oxidase alpha-subunit; | 81.04 | |
| 1xhc_A | 367 | NADH oxidase /nitrite reductase; southe collaborat | 80.83 | |
| 2cul_A | 232 | Glucose-inhibited division protein A-related PROT | 80.66 | |
| 1gpe_A | 587 | Protein (glucose oxidase); oxidoreductase(flavopro | 80.38 |
| >3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} | Back alignment and structure |
|---|
Probab=99.97 E-value=2e-29 Score=237.84 Aligned_cols=278 Identities=12% Similarity=0.069 Sum_probs=210.6
Q ss_pred CCHHHHHHhHHHHHHhhhcCCcccccHHHHHHHHHHHHHhcCCCceeEeecCCCchhhhHHHHHHHHHcCCeEEcceeee
Q 019274 6 CSERLYRNVIGPLVQVGLFAPAEQCSAAATLGILYFIILAHQKNFDLVWCRGTLREKIFEPWMDSMRTRGCEFLDGRRVT 85 (343)
Q Consensus 6 ~~~~~~~~~~~~~~~~~~~~~~~~~sa~~~~~~l~~~~~~~~~~~~~~~~~gG~~~~l~~~l~~~l~~~G~~i~~~~~V~ 85 (343)
++++.++.++++++...++.+++++|+..++..+...... . ...+++||+ +.|+++|++.++++|++|+++++|+
T Consensus 146 ~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~--~--~~~~~~gG~-~~l~~~l~~~~~~~G~~i~~~~~V~ 220 (425)
T 3ka7_A 146 VSDEWLIKFADSFCGWALSLKSDEVPVEEVFEIIENMYRF--G--GTGIPEGGC-KGIIDALETVISANGGKIHTGQEVS 220 (425)
T ss_dssp CCCHHHHHHHHHHHHHHHSSCGGGSBHHHHHHHHHHHHHH--C--SCEEETTSH-HHHHHHHHHHHHHTTCEEECSCCEE
T ss_pred cCCHHHHHHHHHHHHHHhCCCcccchHHHHHHHHHHHHhc--C--CccccCCCH-HHHHHHHHHHHHHcCCEEEECCcee
Confidence 5788899999999999999999999999888887765311 1 235789995 6799999999999999999999999
Q ss_pred EEEecCCCCeEEEEEECCeEEecCEEEEeeChhhHHHhhhhhc-cc-CchhHHhhccCcccceEEEEEEeccCCCCCCCc
Q 019274 86 DFIYDEERCCISDVVCGKETYSAGAVVLAVGISTLQELIKNSI-LC-NREEFLKVLNLASIDVVSVKLWFDKKVTVPNVS 163 (343)
Q Consensus 86 ~I~~~~~~g~v~~V~~~g~~~~ad~VV~a~p~~~~~~Ll~~~~-~~-~~~~~~~~~~l~~~~~~~v~l~~~~~~~~~~~~ 163 (343)
+|..++ +++++|+++|++++||.||+|+|++.+.+|+++.. ++ +..+.+.+.++.+.+.+++++++++++. . .+
T Consensus 221 ~i~~~~--~~~~gv~~~g~~~~ad~VV~a~~~~~~~~ll~~~~~~~~~~~~~~~~~~~~~~~~~~v~l~~~~~~~-~-~~ 296 (425)
T 3ka7_A 221 KILIEN--GKAAGIIADDRIHDADLVISNLGHAATAVLCSEALSKEADAAYFKMVGTLQPSAGIKICLAADEPLV-G-HT 296 (425)
T ss_dssp EEEEET--TEEEEEEETTEEEECSEEEECSCHHHHHHHTTTTCCTTTTHHHHHHHHHCCCBEEEEEEEEESSCSS-C-SS
T ss_pred EEEEEC--CEEEEEEECCEEEECCEEEECCCHHHHHHhcCCcccccCCHHHHHHhhCcCCCceEEEEeecCCCcc-C-cC
Confidence 999987 78888999888999999999999999999987532 10 2345567778888888899999998864 2 34
Q ss_pred ceeecCCCCccceEeeccccccccCCCCCeEEEEEeeCCCCCCCCCHHHHHHHHHHHHhhhcccCCCCceeeeEEEecCC
Q 019274 164 NACSGFGDSLAWTFFDLNKIYDEHKDDSATVIQADFYHANELMPLKDDQVVAKAVSYLSKCIKDFSTATVMDHKIRRFPK 243 (343)
Q Consensus 164 ~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~e~~~~~~~~L~~~~p~~~~~~~~~~~~~r~~~ 243 (343)
+.+++.+......+...+...+.+++++.+++.+.++...+..+. .++.++.++++|++++|+.. .....+.+|+.
T Consensus 297 ~~~~~~~~~~~~~~~~~s~~~p~~ap~G~~~l~~~~~~~~~~~~~-~~~~~~~~~~~l~~~~p~~~---~~~~~v~~~~~ 372 (425)
T 3ka7_A 297 GVLLTPYTRRINGVNEVTQADPELAPPGKHLTMCHQYVAPENVKN-LESEIEMGLEDLKEIFPGKR---YEVLLIQSYHD 372 (425)
T ss_dssp SEEECCSSSSEEEEECGGGTCGGGSCTTCEEEEEEEEECGGGGGG-HHHHHHHHHHHHHHHSTTCC---EEEEEEEEEBT
T ss_pred EEEECCChhhcceEEeccCCCCCcCCCCCeEEEEEeccccccccc-hHHHHHHHHHHHHHhCCCCc---eEEEEEEEECC
Confidence 555543322111233344455666656777776654432222222 34667999999999999843 33346788999
Q ss_pred CccccCCCCCCCCCCCCCCCCCeEEeeccccCCCCCccchHHHHHHHHHHHHHHH
Q 019274 244 SLTHFFPGSYKYMMRGFTSFPNLFMAGDWITTRHGSWSQERSYVTGLEAANRVVD 298 (343)
Q Consensus 244 ~~~~~~~g~~~~~p~~~~~~~~L~laGd~~~~g~~~~~~ega~~Sg~~aA~~il~ 298 (343)
++|.+.+++. .++...+|++|||+||||+.+.+| .+|++|+.||+.||++|+.
T Consensus 373 ~~P~~~~~~~-~~~~~~~p~~gL~laG~~~~~~gg-~gv~~~~~s~~~~~~~i~~ 425 (425)
T 3ka7_A 373 EWPVNRAASG-TDPGNETPFSGLYVVGDGAKGKGG-IEVEGVALGVMSVMEKVLG 425 (425)
T ss_dssp TBCSBSSCTT-CCCCSBCSSBTEEECSTTSCCTTC-CHHHHHHHHHHHHHHC---
T ss_pred CccccccccC-CCCCCCCCcCCeEEeCCccCCCCC-CccHHHHHHHHHHHHHhhC
Confidence 9999998853 457777899999999999987666 5999999999999999874
|
| >3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... | Back alignment and structure |
|---|
| >3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} | Back alignment and structure |
|---|
| >2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* | Back alignment and structure |
|---|
| >2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* | Back alignment and structure |
|---|
| >3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* | Back alignment and structure |
|---|
| >1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 | Back alignment and structure |
|---|
| >1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* | Back alignment and structure |
|---|
| >3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* | Back alignment and structure |
|---|
| >4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* | Back alignment and structure |
|---|
| >2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* | Back alignment and structure |
|---|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A | Back alignment and structure |
|---|
| >2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A | Back alignment and structure |
|---|
| >2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* | Back alignment and structure |
|---|
| >3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* | Back alignment and structure |
|---|
| >4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* | Back alignment and structure |
|---|
| >1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* | Back alignment and structure |
|---|
| >2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* | Back alignment and structure |
|---|
| >3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* | Back alignment and structure |
|---|
| >2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* | Back alignment and structure |
|---|
| >1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A | Back alignment and structure |
|---|
| >1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 | Back alignment and structure |
|---|
| >2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* | Back alignment and structure |
|---|
| >1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} | Back alignment and structure |
|---|
| >1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* | Back alignment and structure |
|---|
| >3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* | Back alignment and structure |
|---|
| >3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* | Back alignment and structure |
|---|
| >1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* | Back alignment and structure |
|---|
| >3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* | Back alignment and structure |
|---|
| >3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} | Back alignment and structure |
|---|
| >2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* | Back alignment and structure |
|---|
| >3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* | Back alignment and structure |
|---|
| >2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* | Back alignment and structure |
|---|
| >3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* | Back alignment and structure |
|---|
| >3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* | Back alignment and structure |
|---|
| >2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* | Back alignment and structure |
|---|
| >3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* | Back alignment and structure |
|---|
| >3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* | Back alignment and structure |
|---|
| >3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* | Back alignment and structure |
|---|
| >2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* | Back alignment and structure |
|---|
| >3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} | Back alignment and structure |
|---|
| >2e1m_B L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} | Back alignment and structure |
|---|
| >3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* | Back alignment and structure |
|---|
| >2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 | Back alignment and structure |
|---|
| >3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} | Back alignment and structure |
|---|
| >1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... | Back alignment and structure |
|---|
| >3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* | Back alignment and structure |
|---|
| >3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* | Back alignment and structure |
|---|
| >3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} | Back alignment and structure |
|---|
| >3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* | Back alignment and structure |
|---|
| >1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* | Back alignment and structure |
|---|
| >1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 | Back alignment and structure |
|---|
| >2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} | Back alignment and structure |
|---|
| >1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* | Back alignment and structure |
|---|
| >1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* | Back alignment and structure |
|---|
| >2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} | Back alignment and structure |
|---|
| >2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} | Back alignment and structure |
|---|
| >3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} | Back alignment and structure |
|---|
| >2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 | Back alignment and structure |
|---|
| >2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 | Back alignment and structure |
|---|
| >3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* | Back alignment and structure |
|---|
| >3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* | Back alignment and structure |
|---|
| >3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} | Back alignment and structure |
|---|
| >1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* | Back alignment and structure |
|---|
| >2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* | Back alignment and structure |
|---|
| >2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* | Back alignment and structure |
|---|
| >1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* | Back alignment and structure |
|---|
| >1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* | Back alignment and structure |
|---|
| >2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* | Back alignment and structure |
|---|
| >2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A | Back alignment and structure |
|---|
| >2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... | Back alignment and structure |
|---|
| >2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* | Back alignment and structure |
|---|
| >1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* | Back alignment and structure |
|---|
| >1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 | Back alignment and structure |
|---|
| >3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* | Back alignment and structure |
|---|
| >4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* | Back alignment and structure |
|---|
| >2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* | Back alignment and structure |
|---|
| >1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* | Back alignment and structure |
|---|
| >1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* | Back alignment and structure |
|---|
| >2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* | Back alignment and structure |
|---|
| >2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* | Back alignment and structure |
|---|
| >3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} | Back alignment and structure |
|---|
| >2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* | Back alignment and structure |
|---|
| >2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* | Back alignment and structure |
|---|
| >2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* | Back alignment and structure |
|---|
| >1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* | Back alignment and structure |
|---|
| >1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* | Back alignment and structure |
|---|
| >3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A | Back alignment and structure |
|---|
| >3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* | Back alignment and structure |
|---|
| >3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* | Back alignment and structure |
|---|
| >1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* | Back alignment and structure |
|---|
| >1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* | Back alignment and structure |
|---|
| >2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} | Back alignment and structure |
|---|
| >3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* | Back alignment and structure |
|---|
| >2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} | Back alignment and structure |
|---|
| >3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* | Back alignment and structure |
|---|
| >3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* | Back alignment and structure |
|---|
| >1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* | Back alignment and structure |
|---|
| >3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* | Back alignment and structure |
|---|
| >1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* | Back alignment and structure |
|---|
| >2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* | Back alignment and structure |
|---|
| >3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* | Back alignment and structure |
|---|
| >3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... | Back alignment and structure |
|---|
| >2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* | Back alignment and structure |
|---|
| >2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* | Back alignment and structure |
|---|
| >3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* | Back alignment and structure |
|---|
| >4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* | Back alignment and structure |
|---|
| >1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} | Back alignment and structure |
|---|
| >1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* | Back alignment and structure |
|---|
| >3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} | Back alignment and structure |
|---|
| >3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* | Back alignment and structure |
|---|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* | Back alignment and structure |
|---|
| >2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* | Back alignment and structure |
|---|
| >3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* | Back alignment and structure |
|---|
| >1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 | Back alignment and structure |
|---|
| >1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 | Back alignment and structure |
|---|
| >1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* | Back alignment and structure |
|---|
| >2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} | Back alignment and structure |
|---|
| >1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* | Back alignment and structure |
|---|
| >3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* | Back alignment and structure |
|---|
| >1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* | Back alignment and structure |
|---|
| >3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} | Back alignment and structure |
|---|
| >4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* | Back alignment and structure |
|---|
| >3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* | Back alignment and structure |
|---|
| >2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* | Back alignment and structure |
|---|
| >3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* | Back alignment and structure |
|---|
| >1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 | Back alignment and structure |
|---|
| >1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* | Back alignment and structure |
|---|
| >2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* | Back alignment and structure |
|---|
| >3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* | Back alignment and structure |
|---|
| >3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* | Back alignment and structure |
|---|
| >3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* | Back alignment and structure |
|---|
| >1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* | Back alignment and structure |
|---|
| >3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* | Back alignment and structure |
|---|
| >3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* | Back alignment and structure |
|---|
| >3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* | Back alignment and structure |
|---|
| >2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* | Back alignment and structure |
|---|
| >2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* | Back alignment and structure |
|---|
| >3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* | Back alignment and structure |
|---|
| >4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* | Back alignment and structure |
|---|
| >3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* | Back alignment and structure |
|---|
| >1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* | Back alignment and structure |
|---|
| >3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... | Back alignment and structure |
|---|
| >1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* | Back alignment and structure |
|---|
| >3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* | Back alignment and structure |
|---|
| >2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* | Back alignment and structure |
|---|
| >3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* | Back alignment and structure |
|---|
| >3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* | Back alignment and structure |
|---|
| >4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* | Back alignment and structure |
|---|
| >3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} | Back alignment and structure |
|---|
| >3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} | Back alignment and structure |
|---|
| >2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* | Back alignment and structure |
|---|
| >2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* | Back alignment and structure |
|---|
| >1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 | Back alignment and structure |
|---|
| >1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 343 | ||||
| d2dw4a2 | 449 | c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist | 1e-04 |
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: FAD/NAD(P)-binding domain superfamily: FAD/NAD(P)-binding domain family: FAD-linked reductases, N-terminal domain domain: Lysine-specific histone demethylase 1, LSD1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 41.5 bits (95), Expect = 1e-04
Identities = 12/53 (22%), Positives = 21/53 (39%), Gaps = 2/53 (3%)
Query: 250 PGSYKYMMRGFTSFPNLFMAGDWITTRHGSWSQERSYVTGLEAANRVVD-YLG 301
+ P LF AG+ + + + ++GL A R+ D +LG
Sbjct: 398 ITPGPSIPGAPQPIPRLFFAGEHTIRNYPAT-VHGALLSGLREAGRIADQFLG 449
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 343 | |||
| d2bcgg1 | 297 | Guanine nucleotide dissociation inhibitor, GDI {Ba | 98.96 | |
| d2v5za1 | 383 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 98.7 | |
| d1d5ta1 | 336 | Guanine nucleotide dissociation inhibitor, GDI {Co | 98.52 | |
| d2ivda1 | 347 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 98.42 | |
| d2dw4a2 | 449 | Lysine-specific histone demethylase 1, LSD1 {Human | 98.23 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 98.03 | |
| d1vg0a1 | 491 | Rab escort protein 1 {Rat (Rattus norvegicus) [Tax | 97.96 | |
| d2ivda2 | 108 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 97.84 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 97.77 | |
| d2i0za1 | 251 | Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] | 97.76 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 97.72 | |
| d2gf3a1 | 281 | Sarcosine oxidase {Bacillus sp., strain b0618 [Tax | 97.69 | |
| d1feca2 | 117 | Trypanothione reductase {Crithidia fasciculata [Ta | 97.66 | |
| d1ryia1 | 276 | Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | 97.61 | |
| d1aoga2 | 117 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 97.6 | |
| d1m6ia2 | 137 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 97.51 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 97.47 | |
| d1seza2 | 112 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 97.4 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 97.34 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 97.27 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 97.2 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 97.17 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 97.14 | |
| d2gqfa1 | 253 | Hypothetical protein HI0933 {Haemophilus influenza | 97.06 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 97.01 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 96.93 | |
| d1y0pa2 | 308 | Flavocytochrome c3 (respiratory fumarate reductase | 96.9 | |
| d2iida2 | 113 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 96.88 | |
| d1d4ca2 | 322 | Flavocytochrome c3 (respiratory fumarate reductase | 96.84 | |
| d2dw4a3 | 109 | Lysine-specific histone demethylase 1, LSD1 {Human | 96.71 | |
| d2v5za2 | 112 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 96.69 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 96.62 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 96.59 | |
| d1qo8a2 | 317 | Flavocytochrome c3 (respiratory fumarate reductase | 96.56 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 96.56 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 96.51 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 96.51 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 96.46 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 96.43 | |
| d1b5qa2 | 112 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 96.39 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 95.84 | |
| d3coxa1 | 370 | Cholesterol oxidase of GMC family {Brevibacterium | 94.97 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 94.9 | |
| d2bs2a2 | 336 | Fumarate reductase {Wolinella succinogenes [TaxId: | 94.86 | |
| d1w4xa1 | 298 | Phenylacetone monooxygenase {Thermobifida fusca [T | 94.78 | |
| d1n4wa1 | 367 | Cholesterol oxidase of GMC family {Streptomyces sp | 94.46 | |
| d2gv8a1 | 335 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 93.9 | |
| d1kf6a2 | 311 | Fumarate reductase {Escherichia coli [TaxId: 562]} | 93.88 | |
| d1m6ia1 | 213 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 92.24 | |
| d2cula1 | 230 | GidA-related protein TTHA1897 {Thermus thermophilu | 91.79 | |
| d2bi7a1 | 314 | UDP-galactopyranose mutase, N-terminal domain {Kle | 91.35 | |
| d1kdga1 | 360 | Flavoprotein domain of flavocytochrome cellobiose | 90.85 | |
| d1ps9a2 | 162 | 2,4-dienoyl-CoA reductase, C-terminal domain {Esch | 90.85 | |
| d2f5va1 | 379 | Pyranose 2-oxidase {White-rot fungus (Peniophora s | 90.6 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 89.86 | |
| d1nhpa1 | 198 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 89.67 | |
| d1cf3a1 | 385 | Glucose oxidase {Aspergillus niger [TaxId: 5061]} | 88.76 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 88.63 | |
| d1fl2a2 | 126 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 87.62 | |
| d1xhca1 | 167 | NADH oxidase /nitrite reductase {Pyrococcus furios | 86.93 | |
| d1trba2 | 126 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 86.29 | |
| d1neka2 | 330 | Succinate dehydogenase {Escherichia coli [TaxId: 5 | 85.68 | |
| d1gpea1 | 391 | Glucose oxidase {Penicillium amagasakiense [TaxId: | 85.08 | |
| d2gjca1 | 311 | Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( | 83.9 | |
| d1djqa2 | 156 | Trimethylamine dehydrogenase, C-terminal domain {M | 83.37 | |
| d1h6va1 | 235 | Mammalian thioredoxin reductase {Rat (Rattus norve | 82.68 | |
| d1chua2 | 305 | L-aspartate oxidase {Escherichia coli [TaxId: 562] | 82.21 |
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: FAD/NAD(P)-binding domain superfamily: FAD/NAD(P)-binding domain family: GDI-like N domain domain: Guanine nucleotide dissociation inhibitor, GDI species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=98.96 E-value=2.1e-09 Score=90.51 Aligned_cols=64 Identities=11% Similarity=0.139 Sum_probs=56.4
Q ss_pred ceeEeecCCCchhhhHHHHHHHHHcCCeEEcceeeeEEEecCCCCeEEEEEECCeEEecCEEEEe
Q 019274 50 FDLVWCRGTLREKIFEPWMDSMRTRGCEFLDGRRVTDFIYDEERCCISDVVCGKETYSAGAVVLA 114 (343)
Q Consensus 50 ~~~~~~~gG~~~~l~~~l~~~l~~~G~~i~~~~~V~~I~~~~~~g~v~~V~~~g~~~~ad~VV~a 114 (343)
..+.+|+||+ +.|+++|++.++++|++|++|++|++|..++++++|.+|+.+|++++||+||++
T Consensus 226 ~~~~~~~gG~-~~l~~~l~~~~~~~G~~i~~~~~V~~I~~~~~~~~v~~v~~~g~~~~ad~VI~~ 289 (297)
T d2bcgg1 226 SPYLYPMYGL-GELPQGFARLSAIYGGTYMLDTPIDEVLYKKDTGKFEGVKTKLGTFKAPLVIAD 289 (297)
T ss_dssp CSEEEETTCT-THHHHHHHHHHHHTTCEEECSCCCCEEEEETTTTEEEEEEETTEEEECSCEEEC
T ss_pred CcceeccCcH-HHHHHHHHHHHHhcCCEEEeCCEeeEEEEECCCCEEEEEEcCCEEEECCEEEEC
Confidence 4567899996 569999999999999999999999999887553788888888999999999987
|
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ivda2 d.16.1.5 (A:307-414) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1seza2 d.16.1.5 (A:330-441) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d2iida2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} | Back information, alignment and structure |
|---|
| >d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2v5za2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1b5qa2 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} | Back information, alignment and structure |
|---|
| >d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} | Back information, alignment and structure |
|---|
| >d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|