Citrus Sinensis ID: 019335

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340--
MAVTVTKLLKPLIPASVLSRCSNPASLLFNHKPSFRSSAAAKMATTSTSEADIKPTPSKVKIIDSHLHVWASPEEAADKFPYFPGQEPTLPGHVDFLLQCMEEASVDGALIVQPINHKFDHSLVTSVLKKYPSKFVGCCLANPAEDVIGIKQLEQLILKDGFRAVRFNPYLWPSGQQMTNEVGKAMFSKAGELGVPVGFMCMKGLNLHISEIEELCTEFPSTTVLLDHLAFCKPPSNDEESLAFSNLLKLSRFPQVYVKFSALFRVSRMPFPYQDLSSPLSQVVSSFGANRVMWGSDFPYVVPECGYKGGREAASLIANEVPLSPSELEWIMGGTIMQLFQD
ccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccEEEccccccccccccccccccccccccccccHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHccccEEEEEEEcccccHHHHHHHHHHHccccEEEEEEccccccccccccHHHHHHHHHHHHHcccEEEEEEEccccccHHHHHHHHHHcccccEEEEccccccccccccccHHHHHHHHHHccccEEEEcccccccccccccccccHHHHHHHHHHHccccEEEcccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHccc
cccccccccccccccHHccccccHHHHHHcccccHHHHHcccccccccccccccccccccccEcccEEEccccccccccccccccccccccccHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHccccEEEEEEEcccccHHHHHHHHHHHHHcccEEEEEEEEcccccccccccccHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHccccEEEEEccccccccccccccHHHHHHHHHHHcccEEEEEEccccccccccccHHHHHHHHHHHHHHccccEEEccccccccccccccccHHHHHHHHHHccccHHHHHHHHcccHHHHHcc
MAVTVTKllkplipasvlsrcsnpasllfnhkpsfrssaaakmattstseadikptpskvkiidshlhvwaspeeaadkfpyfpgqeptlpghVDFLLQCMEEASVDgalivqpinhkfdhSLVTSVLkkypskfvgcclanpaedvIGIKQLEQLILKDGfravrfnpylwpsgqqmTNEVGKAMFSkagelgvpvgFMCMKGLNLHISEIEElctefpsttVLLDhlafckppsndeesLAFSNllklsrfpqvyVKFSALFRvsrmpfpyqdlssplsqvvssfganrvmwgsdfpyvvpecgykggrEAASLIanevplspselewimggtimqlfqd
mavtvtkllkplipasvlsrCSNPASLLFNHKPSFRSSAAAKMAttstseadikptpskVKIIDSHLHVWASPEEAADKFPYFPGQEPTLPGHVDFLLQCMEEASVDGALIVQPINHKFDHSLVTSVLKKYPSKFVGCCLANPAEDVIGIKQLEQLILKDGFRAVRFNPYLWPSGQQMTNEVGKAMFSKAGELGVPVGFMCMKGLNLHISEIEELCTEFPSTTVLLDHLAFCKPPSNDEESLAFSNLLKLSRFPQVYVKFSALFRVSRMPFPYQDLSSPLSQVVSSFGANRVMWGSDFPYVVPECGYKGGREAASLIANEVPLSPSELEWIMGGTIMQLFQD
MAVTVTKLLKPLIPASVLSRCSNPASLLFNHKPSFRssaaakmattstsEADIKPTPSKVKIIDSHLHVWASPEEAADKFPYFPGQEPTLPGHVDFLLQCMEEASVDGALIVQPINHKFDHSLVTSVLKKYPSKFVGCCLANPAEDVIGIKQLEQLILKDGFRAVRFNPYLWPSGQQMTNEVGKAMFSKAGELGVPVGFMCMKGLNLHISEIEELCTEFPSTTVLLDHLAFCKPPSNDEESLAFSNLLKLSRFPQVYVKFSALFRVSRMPFPYQDLSSPLSQVVSSFGANRVMWGSDFPYVVPECGYKGGREAASLIANEVPLSPSELEWIMGGTIMQLFQD
*****TKLLKPLIPASVLSRC**************************************VKIIDSHLHVWASPEEAADKFPYFPGQEPTLPGHVDFLLQCMEEASVDGALIVQPINHKFDHSLVTSVLKKYPSKFVGCCLANPAEDVIGIKQLEQLILKDGFRAVRFNPYLWPSGQQMTNEVGKAMFSKAGELGVPVGFMCMKGLNLHISEIEELCTEFPSTTVLLDHLAFCKP******SLAFSNLLKLSRFPQVYVKFSALFRVSRMPFPYQDLSSPLSQVVSSFGANRVMWGSDFPYVVPECGYKGGREAASLIANEVPLSPSELEWIMGGTIMQL***
********LKPLIP***********************************************IIDSHLHVWASPEEAADKFPYFPGQEPTLPGHVDFLLQCMEEASVDGALIVQPINHKFDHSLVTSVLKKYPSKFVGCCLANPAEDVIGIKQLEQLILKDGFRAVRFNPYLWPSGQQMTNEVGKAMFSKAGELGVPVGFMCMKGLNLHISEIEELCTEFPSTTVLLDHLAFCKPPSNDEESLAFSNLLKLSRFPQVYVKFSALFRVSRMPFPYQDLSSPLSQVVSSFGANRVMWGSDFPYVVPECGYKGGREAASLIANEVPLSPSELEWIMGGTIMQLFQD
MAVTVTKLLKPLIPASVLSRCSNPASLLFNHKPSFR****************IKPTPSKVKIIDSHLHVWASPEEAADKFPYFPGQEPTLPGHVDFLLQCMEEASVDGALIVQPINHKFDHSLVTSVLKKYPSKFVGCCLANPAEDVIGIKQLEQLILKDGFRAVRFNPYLWPSGQQMTNEVGKAMFSKAGELGVPVGFMCMKGLNLHISEIEELCTEFPSTTVLLDHLAFCKPPSNDEESLAFSNLLKLSRFPQVYVKFSALFRVSRMPFPYQDLSSPLSQVVSSFGANRVMWGSDFPYVVPECGYKGGREAASLIANEVPLSPSELEWIMGGTIMQLFQD
*****TKLLKPLIPASVLSRCSNPASLLFNHKPSFRSSAAAKMATTSTSEADIKPTPSKVKIIDSHLHVWASPEEAADKFPYFPGQEPTLPGHVDFLLQCMEEASVDGALIVQPINHKFDHSLVTSVLKKYPSKFVGCCLANPAEDVIGIKQLEQLILKDGFRAVRFNPYLWPSGQQMTNEVGKAMFSKAGELGVPVGFMCMKGLNLHISEIEELCTEFPSTTVLLDHLAFCKPPSNDEESLAFSNLLKLSRFPQVYVKFSALFRVSRMPFPYQDLSSPLSQVVSSFGANRVMWGSDFPYVVPECGYKGGREAASLIANEVPLSPSELEWIMGGTIMQLFQD
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVTVTKLLKPLIPASVLSRCSNPASLLFNHKPSFRSSAAAKMATTSTSEADIKPTPSKVKIIDSHLHVWASPEEAADKFPYFPGQEPTLPGHVDFLLQCMEEASVDGALIVQPINHKFDHSLVTSVLKKYPSKFVGCCLANPAEDVIGIKQLEQLILKDGFRAVRFNPYLWPSGQQMTNEVGKAMFSKAGELGVPVGFMCMKGLNLHISEIEELCTEFPSTTVLLDHLAFCKPPSNDEESLAFSNLLKLSRFPQVYVKFSALFRVSRMPFPYQDLSSPLSQVVSSFGANRVMWGSDFPYVVPECGYKGGREAASLIANEVPLSPSELEWIMGGTIMQLFQD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query342
359473791340 PREDICTED: uncharacterized protein LOC10 0.959 0.964 0.797 1e-154
296088704301 unnamed protein product [Vitis vinifera] 0.830 0.943 0.869 1e-147
224075525300 predicted protein [Populus trichocarpa] 0.862 0.983 0.832 1e-145
255547632343 aminocarboxymuconate-semialdehyde decarb 0.976 0.973 0.700 1e-141
357502939341 hypothetical protein MTR_7g022480 [Medic 0.909 0.912 0.738 1e-136
388521475328 unknown [Lotus japonicus] 0.909 0.948 0.75 1e-135
388504214303 unknown [Medicago truncatula] 0.856 0.966 0.755 1e-131
449469188343 PREDICTED: uncharacterized protein LOC10 0.888 0.886 0.725 1e-130
297827029302 At2g35450 [Arabidopsis lyrata subsp. lyr 0.859 0.973 0.728 1e-128
357163131351 PREDICTED: uncharacterized protein LOC10 0.961 0.937 0.639 1e-127
>gi|359473791|ref|XP_002266409.2| PREDICTED: uncharacterized protein LOC100255676 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  550 bits (1417), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 267/335 (79%), Positives = 293/335 (87%), Gaps = 7/335 (2%)

Query: 9   LKPLIPASVLSRCSNPASLLF--NHKPSFRSSAAAKMATTSTSEADIKPTPSKVKIIDSH 66
           LKPL+P SV+   SNP++L F  + K  F++SAA   A    S+A      S  KIIDSH
Sbjct: 5   LKPLLPLSVVPHNSNPSNLFFPFSKKSHFQASAAKMAANEVQSKAS-----SNAKIIDSH 59

Query: 67  LHVWASPEEAADKFPYFPGQEPTLPGHVDFLLQCMEEASVDGALIVQPINHKFDHSLVTS 126
           LHVWAS EEAADK+PYFPGQEPTLPGH+ FLLQCMEEA VDGALIVQPINHKFDHSLVTS
Sbjct: 60  LHVWASAEEAADKYPYFPGQEPTLPGHLQFLLQCMEEAHVDGALIVQPINHKFDHSLVTS 119

Query: 127 VLKKYPSKFVGCCLANPAEDVIGIKQLEQLILKDGFRAVRFNPYLWPSGQQMTNEVGKAM 186
           VLKK+PSKFVGCCLANPAED  G+KQLE L+LKDG+RAVRFNPYLWPSGQQMTNE+GKAM
Sbjct: 120 VLKKHPSKFVGCCLANPAEDGSGVKQLEHLVLKDGYRAVRFNPYLWPSGQQMTNEIGKAM 179

Query: 187 FSKAGELGVPVGFMCMKGLNLHISEIEELCTEFPSTTVLLDHLAFCKPPSNDEESLAFSN 246
           FSKAGELGVPV FMCMKGLNLHISEIE+LC EFPST VLLDHLAFCKPP+NDEE+ AFSN
Sbjct: 180 FSKAGELGVPVAFMCMKGLNLHISEIEKLCKEFPSTVVLLDHLAFCKPPTNDEENQAFSN 239

Query: 247 LLKLSRFPQVYVKFSALFRVSRMPFPYQDLSSPLSQVVSSFGANRVMWGSDFPYVVPECG 306
           LLKLSRFPQVYVKFSALFRVSR+P PYQDL+  LSQVVSSFGANRVMWGSDFP+VVPECG
Sbjct: 240 LLKLSRFPQVYVKFSALFRVSRLPPPYQDLAPLLSQVVSSFGANRVMWGSDFPFVVPECG 299

Query: 307 YKGGREAASLIANEVPLSPSELEWIMGGTIMQLFQ 341
           YKG +E+ SLIANE+PLS SELEWIMG T+M+LFQ
Sbjct: 300 YKGAKESVSLIANEIPLSSSELEWIMGRTVMELFQ 334

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296088704|emb|CBI38154.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224075525|ref|XP_002304666.1| predicted protein [Populus trichocarpa] gi|118487518|gb|ABK95586.1| unknown [Populus trichocarpa] gi|222842098|gb|EEE79645.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255547632|ref|XP_002514873.1| aminocarboxymuconate-semialdehyde decarboxylase, putative [Ricinus communis] gi|223545924|gb|EEF47427.1| aminocarboxymuconate-semialdehyde decarboxylase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357502939|ref|XP_003621758.1| hypothetical protein MTR_7g022480 [Medicago truncatula] gi|355496773|gb|AES77976.1| hypothetical protein MTR_7g022480 [Medicago truncatula] Back     alignment and taxonomy information
>gi|388521475|gb|AFK48799.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|388504214|gb|AFK40173.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|449469188|ref|XP_004152303.1| PREDICTED: uncharacterized protein LOC101220161 [Cucumis sativus] gi|449484841|ref|XP_004156995.1| PREDICTED: uncharacterized LOC101220161 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297827029|ref|XP_002881397.1| At2g35450 [Arabidopsis lyrata subsp. lyrata] gi|297327236|gb|EFH57656.1| At2g35450 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357163131|ref|XP_003579633.1| PREDICTED: uncharacterized protein LOC100842192 [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query342
TAIR|locus:2062425346 AT2G35450 [Arabidopsis thalian 0.845 0.835 0.744 6.2e-117
TAIR|locus:2062425 AT2G35450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1152 (410.6 bits), Expect = 6.2e-117, P = 6.2e-117
 Identities = 216/290 (74%), Positives = 247/290 (85%)

Query:    51 ADIKPTPSKVKIIDSHLHVWASPEEAADKFPYFPGQEPTLPGHVDFLLQCMEEASVDGAL 110
             +D + T S  ++IDSHLH+WASP+EA + +PYFPGQEPTL G V+FLL+ MEEA VDGAL
Sbjct:    51 SDSETTSSTSRVIDSHLHIWASPQEA-ETYPYFPGQEPTLTGDVNFLLKNMEEARVDGAL 109

Query:   111 IVQPINHKFDHSLVTSVLKKYPSKFVGCCLANPAEDVIGIKQLEQLILKDGFRAVRFNPY 170
             IVQPINHKFDHSLVTSVLK+YPSKFVGCCLANPAED  GI  LE L+L+  +RAVRFNPY
Sbjct:   110 IVQPINHKFDHSLVTSVLKRYPSKFVGCCLANPAEDGSGITHLENLVLESNYRAVRFNPY 169

Query:   171 LWPSGQQMTNEVGKAMFSKAGELGVPVGFMCMKGLNLHISEIEELCTEFPSTTVLLDHLA 230
             LWPSGQ+MTN VGKA+FSKAGEL VPVGFMCMKGL+LHI+EIEELCTEFP TTVLLDH  
Sbjct:   170 LWPSGQKMTNAVGKALFSKAGELCVPVGFMCMKGLDLHIAEIEELCTEFPKTTVLLDHAG 229

Query:   231 FCKPPSNDEESLAFSNLLKLSRFPQVYVKFSALFRVSRMPFPYQDLSSPLSQVVSSFGAN 290
             FCK P + E  LA+S L+KLSRFPQVYVKFSALFR+SR  FPYQDLS  LSQ+VS FGAN
Sbjct:   230 FCKVPESGEAKLAYSQLMKLSRFPQVYVKFSALFRISRTGFPYQDLSPLLSQLVSHFGAN 289

Query:   291 RVMWGSDFPYVVPECGYKGGREAASLIANEVPLSPSELEWIMGGTIMQLF 340
             RVMWGSDFP+VV ECGYK  +EA ++IA E  LS SE++WI+G T+MQLF
Sbjct:   290 RVMWGSDFPFVVLECGYKEAKEAVTIIAKEASLSSSEMDWILGKTLMQLF 339


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.320   0.137   0.418    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      342       329   0.00089  116 3  11 22  0.38    34
                                                     33  0.45    37


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  613 (65 KB)
  Total size of DFA:  233 KB (2126 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  25.66u 0.10s 25.76t   Elapsed:  00:00:01
  Total cpu time:  25.66u 0.10s 25.76t   Elapsed:  00:00:01
  Start:  Sat May 11 10:24:47 2013   End:  Sat May 11 10:24:48 2013
GO:0003824 "catalytic activity" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016787 "hydrolase activity" evidence=ISS

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer4.1.1.45LOW CONFIDENCE prediction!
3rd Layer3.5.2LOW CONFIDENCE prediction!
3rd Layer3.5.2.3LOW CONFIDENCE prediction!
3rd Layer4.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00006982001
SubName- Full=Chromosome chr1 scaffold_180, whole genome shotgun sequence; (340 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query342
pfam04909272 pfam04909, Amidohydro_2, Amidohydrolase 3e-35
COG3618279 COG3618, COG3618, Predicted metal-dependent hydrol 2e-19
cd01311263 cd01311, PDC_hydrolase, 2-pyrone-4,6-dicarboxylic 1e-17
COG2159293 COG2159, COG2159, Predicted metal-dependent hydrol 2e-09
>gnl|CDD|218322 pfam04909, Amidohydro_2, Amidohydrolase Back     alignment and domain information 
 Score =  129 bits (325), Expect = 3e-35
 Identities = 69/285 (24%), Positives = 107/285 (37%), Gaps = 22/285 (7%)

Query: 63  IDSHLHVWASPEEAADKFPYFPGQEPTLPGH-VDFLLQCMEEASVDGALIVQPINHKFDH 121
           ID+H H+         + P    +         +  L       V  A+IV       ++
Sbjct: 1   IDAHAHLPG-GSIPDPRLPLMDRRGYDPRDASPEDYLVLGAALGVARAVIVAASCRGANN 59

Query: 122 SLVTSVLKKYPSKFVGCCLANPAEDVIGIKQLEQLILKDGFRAVRFNPYLWPSGQQMTNE 181
            ++   LK+      G  L  P  +     +LE+ + + GFR VR NP+           
Sbjct: 60  RVLAEALKRPGRFVGGAALPPPDPED-AAAELERRLAELGFRGVRLNPHPGGGPLL-DPR 117

Query: 182 VGKAMFSKAGELGVPV------GFMCMKGLNLHISEIEELCTEFPSTTVLLDHLAFCKPP 235
           +   +F    ELG+PV      G             +  L   FP   ++LDH      P
Sbjct: 118 LDDPIFEALAELGLPVDLHTGFGDAGEDLDAAQPLLLSGLARRFPDLKIVLDHGGGPWIP 177

Query: 236 SNDEESLAFSNLLKLSRFPQVYVKFSALFRVSRMPFPYQDLSSPLSQVVSSFGANRVMWG 295
                      L  L+R P VYVK S L R S            L++++ +FG +R+++G
Sbjct: 178 -------EGLRLALLARRPNVYVKLSGLGRRSG-FDSPAADPPALAELIEAFGPDRILFG 229

Query: 296 SDFPYVVPECGYKGGREAASLIANEVPLSPSELEWIMGGTIMQLF 340
           SD+P+   E           L A    LS  E E I+GG   +L+
Sbjct: 230 SDYPHPPLERPLAALDLLDLLDA----LSEEEREKILGGNAARLY 270

These proteins are amidohydrolases that are related to pfam01979. Length = 272
>gnl|CDD|226145 COG3618, COG3618, Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>gnl|CDD|238636 cd01311, PDC_hydrolase, 2-pyrone-4,6-dicarboxylic acid (PDC) hydrolase hydrolyzes PDC to yield 4-oxalomesaconic acid (OMA) or its tautomer, 4-carboxy-2-hydroxymuconic acid (CHM) Back     alignment and domain information
>gnl|CDD|225070 COG2159, COG2159, Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 342
cd01311263 PDC_hydrolase 2-pyrone-4,6-dicarboxylic acid (PDC) 100.0
COG3618279 Predicted metal-dependent hydrolase of the TIM-bar 100.0
PF04909273 Amidohydro_2: Amidohydrolase; InterPro: IPR006992 100.0
COG2159293 Predicted metal-dependent hydrolase of the TIM-bar 100.0
cd01310251 TatD_DNAse TatD like proteins; E.coli TatD is a cy 99.95
TIGR00010252 hydrolase, TatD family. Several genomes have multi 99.92
COG0084256 TatD Mg-dependent DNase [DNA replication, recombin 99.92
KOG4245297 consensus Predicted metal-dependent hydrolase of t 99.92
PRK10812265 putative DNAse; Provisional 99.89
PRK11449258 putative deoxyribonuclease YjjV; Provisional 99.89
PRK10425258 DNase TatD; Provisional 99.87
PF01026255 TatD_DNase: TatD related DNase The Pfam entry find 99.84
cd01294335 DHOase Dihydroorotase (DHOase) catalyzes the rever 99.68
cd00530293 PTE Phosphotriesterase (PTE) catalyzes the hydroly 99.59
KOG3020296 consensus TatD-related DNase [Replication, recombi 99.48
PRK05451345 dihydroorotase; Provisional 99.45
cd01292275 metallo-dependent_hydrolases Superfamily of metall 99.44
COG1099254 Predicted metal-dependent hydrolases with the TIM- 99.44
COG0418344 PyrC Dihydroorotase [Nucleotide transport and meta 99.4
TIGR00856341 pyrC_dimer dihydroorotase, homodimeric type. This 99.37
cd01295 422 AdeC Adenine deaminase (AdeC) directly deaminates 99.16
PRK09875292 putative hydrolase; Provisional 99.05
PLN02599364 dihydroorotase 98.98
KOG2902344 consensus Dihydroorotase [Nucleotide transport and 98.91
cd01307338 Met_dep_hydrolase_B Metallo-dependent hydrolases, 98.7
cd01302337 Cyclic_amidohydrolases Cyclic amidohydrolases, inc 98.69
TIGR03583365 EF_0837 probable amidohydrolase EF_0837/AHA_3915. 98.63
COG1831285 Predicted metal-dependent hydrolase (urease superf 98.59
PF01244320 Peptidase_M19: Membrane dipeptidase (Peptidase fam 98.57
PRK07583438 cytosine deaminase-like protein; Validated 98.44
PRK07369418 dihydroorotase; Provisional 98.41
PRK07627425 dihydroorotase; Provisional 98.29
TIGR01975389 isoAsp_dipep isoaspartyl dipeptidase IadA. The L-i 98.28
COG2355313 Zn-dependent dipeptidase, microsomal dipeptidase h 98.27
TIGR00857411 pyrC_multi dihydroorotase, multifunctional complex 98.26
cd01297415 D-aminoacylase D-aminoacylases (N-acyl-D-Amino aci 98.26
cd01317374 DHOase_IIa Dihydroorotase (DHOase), subgroup IIa; 98.24
PRK08417386 dihydroorotase; Provisional 98.21
PLN02795505 allantoinase 98.19
PRK09059429 dihydroorotase; Validated 98.17
cd01301309 rDP_like renal dipeptidase (rDP), best studied in 98.15
cd01299342 Met_dep_hydrolase_A Metallo-dependent hydrolases, 98.13
TIGR01178 552 ade adenine deaminase. The family described by thi 98.12
cd01318361 DHOase_IIb Dihydroorotase (DHOase), subgroup IIb; 98.1
PF02126308 PTE: Phosphotriesterase family; InterPro: IPR00155 98.09
PLN02942 486 dihydropyrimidinase 98.09
PRK09357423 pyrC dihydroorotase; Validated 98.07
PRK10657388 isoaspartyl dipeptidase; Provisional 98.06
PRK12394379 putative metallo-dependent hydrolase; Provisional 98.06
cd01315447 L-HYD_ALN L-Hydantoinases (L-HYDs) and Allantoinas 98.05
TIGR03178443 allantoinase allantoinase. This enzyme carries out 98.02
COG3964386 Predicted amidohydrolase [General function predict 98.02
PRK09237380 dihydroorotase; Provisional 98.01
PRK13404477 dihydropyrimidinase; Provisional 97.98
TIGR02967401 guan_deamin guanine deaminase. This model describe 97.93
PRK08203451 hydroxydechloroatrazine ethylaminohydrolase; Revie 97.89
cd01298411 ATZ_TRZ_like TRZ/ATZ family contains enzymes from 97.88
PRK02382443 dihydroorotase; Provisional 97.88
cd01308387 Isoaspartyl-dipeptidase Isoaspartyl dipeptidase hy 97.83
cd01320325 ADA Adenosine deaminase (ADA) is a monomeric zinc 97.73
cd01303429 GDEase Guanine deaminase (GDEase). Guanine deamina 97.69
PRK13985 568 ureB urease subunit beta; Provisional 97.65
PRK13206 573 ureC urease subunit alpha; Reviewed 97.57
PRK08044449 allantoinase; Provisional 97.55
PRK13308 569 ureC urease subunit alpha; Reviewed 97.52
cd01316344 CAD_DHOase The eukaryotic CAD protein is a trifunc 97.51
PRK06189451 allantoinase; Provisional 97.51
cd01314 447 D-HYD D-hydantoinases (D-HYD) also called dihydrop 97.48
COG1735316 Php Predicted metal-dependent hydrolase with the T 97.47
PRK06687419 chlorohydrolase; Validated 97.46
cd00375 567 Urease_alpha Urease alpha-subunit; Urease is a nic 97.46
PRK13309 572 ureC urease subunit alpha; Reviewed 97.44
cd01293398 Bact_CD Bacterial cytosine deaminase and related m 97.43
TIGR01430324 aden_deam adenosine deaminase. This family include 97.41
PRK08393424 N-ethylammeline chlorohydrolase; Provisional 97.36
PRK05985391 cytosine deaminase; Provisional 97.35
PRK12393457 amidohydrolase; Provisional 97.35
PRK15493435 5-methylthioadenosine/S-adenosylhomocysteine deami 97.32
COG0044430 PyrC Dihydroorotase and related cyclic amidohydrol 97.28
PRK09060444 dihydroorotase; Validated 97.25
PRK07213375 chlorohydrolase; Provisional 97.21
PRK08204449 hypothetical protein; Provisional 97.19
cd01309359 Met_dep_hydrolase_C Metallo-dependent hydrolases, 97.19
PRK08323 459 phenylhydantoinase; Validated 97.13
PRK09236444 dihydroorotase; Reviewed 97.12
PRK09358340 adenosine deaminase; Provisional 97.11
PRK13207 568 ureC urease subunit alpha; Reviewed 97.06
PRK06846410 putative deaminase; Validated 96.96
PRK06038430 N-ethylammeline chlorohydrolase; Provisional 96.94
TIGR01792 567 urease_alph urease, alpha subunit. This model desc 96.94
PRK07228445 N-ethylammeline chlorohydrolase; Provisional 96.91
PRK07203442 putative chlorohydrolase/aminohydrolase; Validated 96.73
PRK00369392 pyrC dihydroorotase; Provisional 96.72
TIGR02033 454 D-hydantoinase D-hydantoinase. This model represen 96.63
PRK14085382 imidazolonepropionase; Provisional 96.62
PRK10027 588 cryptic adenine deaminase; Provisional 96.56
cd00854374 NagA N-acetylglucosamine-6-phosphate deacetylase, 96.52
PRK09061 509 D-glutamate deacylase; Validated 96.43
PRK07575438 dihydroorotase; Provisional 96.36
PRK01211409 dihydroorotase; Provisional 96.23
PRK03620303 5-dehydro-4-deoxyglucarate dehydratase; Provisiona 96.21
PRK06380418 metal-dependent hydrolase; Provisional 96.19
PRK06886329 hypothetical protein; Validated 96.12
PRK09228433 guanine deaminase; Provisional 96.11
PRK07572426 cytosine deaminase; Validated 96.08
cd00951289 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also 96.0
PRK08392215 hypothetical protein; Provisional 95.99
PLN02303 837 urease 95.95
TIGR03249296 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-deh 95.95
cd01304541 FMDH_A Formylmethanofuran dehydrogenase (FMDH) sub 95.88
TIGR02313294 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac 95.83
PTZ00124362 adenosine deaminase; Provisional 95.67
cd00953279 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolas 95.54
cd01300479 YtcJ_like YtcJ_like metal dependent amidohydrolase 95.48
cd01296371 Imidazolone-5PH Imidazolonepropionase/imidazolone- 95.35
TIGR02318376 phosphono_phnM phosphonate metabolism protein PhnM 95.23
COG0804 568 UreC Urea amidohydrolase (urease) alpha subunit [A 95.08
cd00408281 DHDPS-like Dihydrodipicolinate synthase family. A 94.92
PRK09045443 N-ethylammeline chlorohydrolase; Provisional 94.89
cd00443305 ADA_AMPD Adenosine/AMP deaminase. Adenosine deamin 94.83
PF00701289 DHDPS: Dihydrodipicolinate synthetase family; Inte 94.81
KOG2584 522 consensus Dihydroorotase and related enzymes [Nucl 94.76
PLN02417280 dihydrodipicolinate synthase 94.71
cd00952309 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate 94.62
cd00950284 DHDPS Dihydrodipicolinate synthase (DHDPS) is a ke 94.44
PRK09230426 cytosine deaminase; Provisional 94.38
TIGR01224377 hutI imidazolonepropionase. This enzyme catalyzes 94.35
PRK15446383 phosphonate metabolism protein PhnM; Provisional 94.19
COG1001 584 AdeC Adenine deaminase [Nucleotide transport and m 94.17
PRK03170292 dihydrodipicolinate synthase; Provisional 94.16
PRK04147293 N-acetylneuraminate lyase; Provisional 93.97
cd00954288 NAL N-Acetylneuraminic acid aldolase, also called 93.96
TIGR00674285 dapA dihydrodipicolinate synthase. Dihydrodipicoli 93.85
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 93.72
KOG4127419 consensus Renal dipeptidase [Posttranslational mod 93.15
TIGR03234254 OH-pyruv-isom hydroxypyruvate isomerase. This enzy 93.12
TIGR00221380 nagA N-acetylglucosamine-6-phosphate deacetylase. 93.11
PRK15108345 biotin synthase; Provisional 92.7
cd01313418 Met_dep_hydrolase_E Metallo-dependent hydrolases, 92.7
COG1574535 Predicted metal-dependent hydrolase with the TIM-b 92.69
PRK00912237 ribonuclease P protein component 3; Provisional 92.6
COG0329299 DapA Dihydrodipicolinate synthase/N-acetylneuramin 92.46
PRK07328269 histidinol-phosphatase; Provisional 92.21
TIGR00683290 nanA N-acetylneuraminate lyase. N-acetylneuraminat 92.19
cd01305263 archeal_chlorohydrolases Predicted chlorohydrolase 92.18
PF02614462 UxaC: Glucuronate isomerase; InterPro: IPR003766 U 91.12
TIGR00683290 nanA N-acetylneuraminate lyase. N-acetylneuraminat 90.83
PF10566273 Glyco_hydro_97: Glycoside hydrolase 97 ; InterPro: 90.78
PRK06151 488 N-ethylammeline chlorohydrolase; Provisional 90.57
PRK08609570 hypothetical protein; Provisional 89.31
cd00954288 NAL N-Acetylneuraminic acid aldolase, also called 89.23
PRK04250398 dihydroorotase; Provisional 89.18
TIGR03121 556 one_C_dehyd_A formylmethanofuran dehydrogenase sub 88.81
PRK11170382 nagA N-acetylglucosamine-6-phosphate deacetylase; 88.81
cd01312381 Met_dep_hydrolase_D Metallo-dependent hydrolases, 87.97
cd00952309 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate 87.67
PRK09356406 imidazolonepropionase; Validated 87.44
cd01306325 PhnM PhnM is believed to be a subunit of the membr 87.36
PF09370268 TIM-br_sig_trns: TIM-barrel signal transduction pr 87.31
TIGR02313294 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac 87.01
PRK07945335 hypothetical protein; Provisional 86.25
PRK09997258 hydroxypyruvate isomerase; Provisional 86.04
cd00408281 DHDPS-like Dihydrodipicolinate synthase family. A 86.0
cd01321345 ADGF Adenosine deaminase-related growth factors (A 85.92
PF03102241 NeuB: NeuB family; InterPro: IPR013132 NeuB is the 85.17
PRK08418408 chlorohydrolase; Provisional 83.83
PRK13209283 L-xylulose 5-phosphate 3-epimerase; Reviewed 83.69
TIGR03569329 NeuB_NnaB N-acetylneuraminate synthase. This famil 83.25
PRK12330 499 oxaloacetate decarboxylase; Provisional 83.17
PRK09989258 hypothetical protein; Provisional 82.97
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 82.36
PRK09229456 N-formimino-L-glutamate deiminase; Validated 81.21
>cd01311 PDC_hydrolase 2-pyrone-4,6-dicarboxylic acid (PDC) hydrolase hydrolyzes PDC to yield 4-oxalomesaconic acid (OMA) or its tautomer, 4-carboxy-2-hydroxymuconic acid (CHM) Back     alignment and domain information 
Probab=100.00  E-value=3.1e-42  Score=314.75  Aligned_cols=258  Identities=22%  Similarity=0.313  Sum_probs=205.3

Q ss_pred             eeeeeeeccCCCCccCCCCCCCCCCCC--CCCCChHHHHHHhHHCCCceEEEeCCCCCccchHHHHHHHHhCCCcEEEEE
Q 019335           62 IIDSHLHVWASPEEAADKFPYFPGQEP--TLPGHVDFLLQCMEEASVDGALIVQPINHKFDHSLVTSVLKKYPSKFVGCC  139 (342)
Q Consensus        62 iID~H~Hl~~~~~~~~~~~p~~~~~~~--~~~~~~~~ll~~md~~GI~~~v~~~~~~~~~~N~~~~~~~~~~p~r~~g~~  139 (342)
                      +||+|+|+|++      .+||..+...  ....++++|++.|+..||+++|+++++.++.+|+++++.++. ++||+|++
T Consensus         2 ~iD~H~H~~~~------~~~~~~~~~~~~~~~~~~e~l~~~m~~~gV~~aV~vq~~~~~~~n~~~~~~~~~-~~r~~g~~   74 (263)
T cd01311           2 AVDAHMHVFDP------GYPFPPAPEKFTPYDPGIDDLRALRSTLGIDRVVIVQASIYGADNSNLLDALAS-NGKARGGA   74 (263)
T ss_pred             CEEeeeeeeCC------CCCCCCCCCCCCCCCCCHHHHHHHHHHhCCCcEEEeCccccCCchHHHHHHHhh-CCCeEEEE
Confidence            69999999974      5788765432  235789999999999999999999988788899999999985 48999999


Q ss_pred             EcCCCCcchHHHHHHHHHhcCCceEEEecCCCCCCCCcCCcHHHHHHHHHHhhhCCeEEEEeccCCCCCHHHHHHHHHhC
Q 019335          140 LANPAEDVIGIKQLEQLILKDGFRAVRFNPYLWPSGQQMTNEVGKAMFSKAGELGVPVGFMCMKGLNLHISEIEELCTEF  219 (342)
Q Consensus       140 ~i~p~~~~~~~~eler~~~~~g~~Gvk~~~~~~~~g~~l~~~~~~~~~~~a~e~~lpv~iH~~~~~~~~~~~l~~l~~~~  219 (342)
                      +++|...  ..++|+++ .+.|++|||+++...  +.. +++.+.++|++|+++|++|.+|++   +.++..+..++++|
T Consensus        75 ~~~p~~~--~~~~l~~~-~~~g~rGvRl~~~~~--~~~-~~~~~~~~~~~~~~~gl~v~~~~~---~~~l~~l~~l~~~~  145 (263)
T cd01311          75 TVDPRTT--TDAELKEM-HDAGVRGVRFNFLFG--GVD-NKDELDEIAKRAAELGWHVQVYFD---AVDLPALLPFLQKL  145 (263)
T ss_pred             EECCCCC--CHHHHHHH-HHCCCeEEEEecccC--CCC-CHHHHHHHHHHHHHcCCEEEEEeC---HhhHHHHHHHHHHC
Confidence            9988653  35899998 678999999997532  333 888999999999999999999997   35778899999999


Q ss_pred             CCCcEEecccCCCCCCCCchhhHhHHHHhcccCCCcEEEecCcccccccCCCCCCCchhHHHHHHHhcCCCcEEEccCCC
Q 019335          220 PSTTVLLDHLAFCKPPSNDEESLAFSNLLKLSRFPQVYVKFSALFRVSRMPFPYQDLSSPLSQVVSSFGANRVMWGSDFP  299 (342)
Q Consensus       220 P~lk~vl~H~G~~~p~~~~~~~~~~~~~~~l~~~~Nvy~~~S~~~~~~~~~~~~~~~~~~l~~~i~~~G~dRilfGSD~P  299 (342)
                       +++||++|+|.+++. .+.....|+++++++++||||+|+|+++..+...|++.+..+.++.+++. |+||||||||||
T Consensus       146 -~l~ivldH~G~p~~~-~~~~~~~~~~~l~~l~~pNV~~k~Sg~~~~~~~~~~~~~~~~~~~~~~~~-g~dRlmfGSD~P  222 (263)
T cd01311         146 -PVAVVIDHFGRPDVT-KGVDGAEFAALLKLIEEGNVWVKVSGPYRLSVKQEAYADVIAFARQIVAA-APDRLVWGTDWP  222 (263)
T ss_pred             -CCCEEEECCCCCCCC-CCCCCHhHHHHHHHHhcCCEEEEecchhhcCCCCCCHHHHHHHHHHHHHh-CCCcEEEeCCCC
Confidence             999999999985432 11223578887765589999999999876655667778888889888877 999999999999


Q ss_pred             CCCCC--CChHhHHHHHHHHHhcCCCCHHHHHHHHhHHHHHh
Q 019335          300 YVVPE--CGYKGGREAASLIANEVPLSPSELEWIMGGTIMQL  339 (342)
Q Consensus       300 ~~~~~--~~~~~~~~~~~~~~~~~~l~~~~~~~I~~~NA~rl  339 (342)
                      +....  .+|......++.+.+ .--+++++++|+++|+++|
T Consensus       223 ~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~n~~~~  263 (263)
T cd01311         223 HPRLREPDPMPDDGALLRLIPS-WAPDAQLQRKNLVDNPARL  263 (263)
T ss_pred             CCCccccCCCCCHHHHHHHHHH-HcCCHHHHHHHHHhChhhC
Confidence            98655  233333333333322 1125688999999999986

This reaction is part of the protocatechuate (PCA) 4,5-cleavage pathway. PCA is one of the most important intermediate metabolites in the bacterial pathways for various phenolic compounds, including lignin, which is the most abundant aromatic material in nature.
>COG3618 Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>PF04909 Amidohydro_2: Amidohydrolase; InterPro: IPR006992 These proteins are related to the metal-dependent hydrolase superfamily [] Back     alignment and domain information
>COG2159 Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>cd01310 TatD_DNAse TatD like proteins; E Back     alignment and domain information
>TIGR00010 hydrolase, TatD family Back     alignment and domain information
>COG0084 TatD Mg-dependent DNase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4245 consensus Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>PRK10812 putative DNAse; Provisional Back     alignment and domain information
>PRK11449 putative deoxyribonuclease YjjV; Provisional Back     alignment and domain information
>PRK10425 DNase TatD; Provisional Back     alignment and domain information
>PF01026 TatD_DNase: TatD related DNase The Pfam entry finds members not in the Prosite definition Back     alignment and domain information
>cd01294 DHOase Dihydroorotase (DHOase) catalyzes the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in the pyrimidine biosynthesis Back     alignment and domain information
>cd00530 PTE Phosphotriesterase (PTE) catalyzes the hydrolysis of organophosphate nerve agents, including the chemical warfare agents VX, soman, and sarin as well as the insecticide paraoxon Back     alignment and domain information
>KOG3020 consensus TatD-related DNase [Replication, recombination and repair] Back     alignment and domain information
>PRK05451 dihydroorotase; Provisional Back     alignment and domain information
>cd01292 metallo-dependent_hydrolases Superfamily of metallo-dependent hydrolases (also called amidohydrolase superfamily) is a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>COG1099 Predicted metal-dependent hydrolases with the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>COG0418 PyrC Dihydroorotase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00856 pyrC_dimer dihydroorotase, homodimeric type Back     alignment and domain information
>cd01295 AdeC Adenine deaminase (AdeC) directly deaminates adenine to form hypoxanthine Back     alignment and domain information
>PRK09875 putative hydrolase; Provisional Back     alignment and domain information
>PLN02599 dihydroorotase Back     alignment and domain information
>KOG2902 consensus Dihydroorotase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01307 Met_dep_hydrolase_B Metallo-dependent hydrolases, subgroup B is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>cd01302 Cyclic_amidohydrolases Cyclic amidohydrolases, including hydantoinase, dihydropyrimidinase, allantoinase, and dihydroorotase, are involved in the metabolism of pyrimidines and purines, sharing the property of hydrolyzing the cyclic amide bond of each substrate to the corresponding N-carbamyl amino acids Back     alignment and domain information
>TIGR03583 EF_0837 probable amidohydrolase EF_0837/AHA_3915 Back     alignment and domain information
>COG1831 Predicted metal-dependent hydrolase (urease superfamily) [General function prediction only] Back     alignment and domain information
>PF01244 Peptidase_M19: Membrane dipeptidase (Peptidase family M19); InterPro: IPR008257 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK07583 cytosine deaminase-like protein; Validated Back     alignment and domain information
>PRK07369 dihydroorotase; Provisional Back     alignment and domain information
>PRK07627 dihydroorotase; Provisional Back     alignment and domain information
>TIGR01975 isoAsp_dipep isoaspartyl dipeptidase IadA Back     alignment and domain information
>COG2355 Zn-dependent dipeptidase, microsomal dipeptidase homolog [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00857 pyrC_multi dihydroorotase, multifunctional complex type Back     alignment and domain information
>cd01297 D-aminoacylase D-aminoacylases (N-acyl-D-Amino acid amidohydrolases) catalyze the hydrolysis of N-acyl-D-amino acids to produce the corresponding D-amino acids, which are used as intermediates in the synthesis of pesticides, bioactive peptides, and antibiotics Back     alignment and domain information
>cd01317 DHOase_IIa Dihydroorotase (DHOase), subgroup IIa; DHOases catalyze the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in pyrimidine biosynthesis Back     alignment and domain information
>PRK08417 dihydroorotase; Provisional Back     alignment and domain information
>PLN02795 allantoinase Back     alignment and domain information
>PRK09059 dihydroorotase; Validated Back     alignment and domain information
>cd01301 rDP_like renal dipeptidase (rDP), best studied in mammals and also called membrane or microsomal dipeptidase, is a membrane-bound glycoprotein hydrolyzing dipeptides and is involved in hydrolytic metabolism of penem and carbapenem beta-lactam antibiotics Back     alignment and domain information
>cd01299 Met_dep_hydrolase_A Metallo-dependent hydrolases, subgroup A is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>TIGR01178 ade adenine deaminase Back     alignment and domain information
>cd01318 DHOase_IIb Dihydroorotase (DHOase), subgroup IIb; DHOases catalyze the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in pyrimidine biosynthesis Back     alignment and domain information
>PF02126 PTE: Phosphotriesterase family; InterPro: IPR001559 Synonym(s): Paraoxonase, A-esterase, Aryltriphosphatase, Phosphotriesterase, Paraoxon hydrolase Bacteria such as Brevundimonas diminuta (Pseudomonas diminuta) harbour a plasmid that carries the gene for Aryldialkylphosphatase (3 Back     alignment and domain information
>PLN02942 dihydropyrimidinase Back     alignment and domain information
>PRK09357 pyrC dihydroorotase; Validated Back     alignment and domain information
>PRK10657 isoaspartyl dipeptidase; Provisional Back     alignment and domain information
>PRK12394 putative metallo-dependent hydrolase; Provisional Back     alignment and domain information
>cd01315 L-HYD_ALN L-Hydantoinases (L-HYDs) and Allantoinase (ALN); L-Hydantoinases are a member of the dihydropyrimidinase family, which catalyzes the reversible hydrolytic ring opening of dihydropyrimidines and hydantoins (five-membered cyclic diamides used in biotechnology) Back     alignment and domain information
>TIGR03178 allantoinase allantoinase Back     alignment and domain information
>COG3964 Predicted amidohydrolase [General function prediction only] Back     alignment and domain information
>PRK09237 dihydroorotase; Provisional Back     alignment and domain information
>PRK13404 dihydropyrimidinase; Provisional Back     alignment and domain information
>TIGR02967 guan_deamin guanine deaminase Back     alignment and domain information
>PRK08203 hydroxydechloroatrazine ethylaminohydrolase; Reviewed Back     alignment and domain information
>cd01298 ATZ_TRZ_like TRZ/ATZ family contains enzymes from the atrazine degradation pathway and related hydrolases Back     alignment and domain information
>PRK02382 dihydroorotase; Provisional Back     alignment and domain information
>cd01308 Isoaspartyl-dipeptidase Isoaspartyl dipeptidase hydrolyzes the beta-L-isoaspartyl linkages in dipeptides, as part of the degradative pathway to eliminate proteins with beta-L-isoaspartyl peptide bonds, bonds whereby the beta-group of an aspartate forms the peptide link with the amino group of the following amino acid Back     alignment and domain information
>cd01320 ADA Adenosine deaminase (ADA) is a monomeric zinc dependent enzyme which catalyzes the irreversible hydrolytic deamination of both adenosine, as well as desoxyadenosine, to ammonia and inosine or desoxyinosine, respectively Back     alignment and domain information
>cd01303 GDEase Guanine deaminase (GDEase) Back     alignment and domain information
>PRK13985 ureB urease subunit beta; Provisional Back     alignment and domain information
>PRK13206 ureC urease subunit alpha; Reviewed Back     alignment and domain information
>PRK08044 allantoinase; Provisional Back     alignment and domain information
>PRK13308 ureC urease subunit alpha; Reviewed Back     alignment and domain information
>cd01316 CAD_DHOase The eukaryotic CAD protein is a trifunctional enzyme of carbamoylphosphate synthetase-aspartate transcarbamoylase-dihydroorotase, which catalyzes the first three steps of de novo pyrimidine nucleotide biosynthesis Back     alignment and domain information
>PRK06189 allantoinase; Provisional Back     alignment and domain information
>cd01314 D-HYD D-hydantoinases (D-HYD) also called dihydropyrimidases (DHPase) and related proteins; DHPases are a family of enzymes that catalyze the reversible hydrolytic ring opening of the amide bond in five- or six-membered cyclic diamides, like dihydropyrimidine or hydantoin Back     alignment and domain information
>COG1735 Php Predicted metal-dependent hydrolase with the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>PRK06687 chlorohydrolase; Validated Back     alignment and domain information
>cd00375 Urease_alpha Urease alpha-subunit; Urease is a nickel-dependent metalloenzyme that catalyzes the hydrolysis of urea to form ammonia and carbon dioxide Back     alignment and domain information
>PRK13309 ureC urease subunit alpha; Reviewed Back     alignment and domain information
>cd01293 Bact_CD Bacterial cytosine deaminase and related metal-dependent hydrolases Back     alignment and domain information
>TIGR01430 aden_deam adenosine deaminase Back     alignment and domain information
>PRK08393 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>PRK05985 cytosine deaminase; Provisional Back     alignment and domain information
>PRK12393 amidohydrolase; Provisional Back     alignment and domain information
>PRK15493 5-methylthioadenosine/S-adenosylhomocysteine deaminase; Provisional Back     alignment and domain information
>COG0044 PyrC Dihydroorotase and related cyclic amidohydrolases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09060 dihydroorotase; Validated Back     alignment and domain information
>PRK07213 chlorohydrolase; Provisional Back     alignment and domain information
>PRK08204 hypothetical protein; Provisional Back     alignment and domain information
>cd01309 Met_dep_hydrolase_C Metallo-dependent hydrolases, subgroup C is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>PRK08323 phenylhydantoinase; Validated Back     alignment and domain information
>PRK09236 dihydroorotase; Reviewed Back     alignment and domain information
>PRK09358 adenosine deaminase; Provisional Back     alignment and domain information
>PRK13207 ureC urease subunit alpha; Reviewed Back     alignment and domain information
>PRK06846 putative deaminase; Validated Back     alignment and domain information
>PRK06038 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>TIGR01792 urease_alph urease, alpha subunit Back     alignment and domain information
>PRK07228 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>PRK07203 putative chlorohydrolase/aminohydrolase; Validated Back     alignment and domain information
>PRK00369 pyrC dihydroorotase; Provisional Back     alignment and domain information
>TIGR02033 D-hydantoinase D-hydantoinase Back     alignment and domain information
>PRK14085 imidazolonepropionase; Provisional Back     alignment and domain information
>PRK10027 cryptic adenine deaminase; Provisional Back     alignment and domain information
>cd00854 NagA N-acetylglucosamine-6-phosphate deacetylase, NagA, catalyzes the hydrolysis of the N-acetyl group of N-acetyl-glucosamine-6-phosphate (GlcNAc-6-P) to glucosamine 6-phosphate and acetate Back     alignment and domain information
>PRK09061 D-glutamate deacylase; Validated Back     alignment and domain information
>PRK07575 dihydroorotase; Provisional Back     alignment and domain information
>PRK01211 dihydroorotase; Provisional Back     alignment and domain information
>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional Back     alignment and domain information
>PRK06380 metal-dependent hydrolase; Provisional Back     alignment and domain information
>PRK06886 hypothetical protein; Validated Back     alignment and domain information
>PRK09228 guanine deaminase; Provisional Back     alignment and domain information
>PRK07572 cytosine deaminase; Validated Back     alignment and domain information
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases Back     alignment and domain information
>PRK08392 hypothetical protein; Provisional Back     alignment and domain information
>PLN02303 urease Back     alignment and domain information
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase Back     alignment and domain information
>cd01304 FMDH_A Formylmethanofuran dehydrogenase (FMDH) subunit A; Methanogenic bacteria and archea derive the energy for autotrophic growth from methanogenesis, the reduction of CO2 with molecular hydrogen as the electron donor Back     alignment and domain information
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>PTZ00124 adenosine deaminase; Provisional Back     alignment and domain information
>cd00953 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolases found in archaea Back     alignment and domain information
>cd01300 YtcJ_like YtcJ_like metal dependent amidohydrolases Back     alignment and domain information
>cd01296 Imidazolone-5PH Imidazolonepropionase/imidazolone-5-propionate hydrolase (Imidazolone-5PH) catalyzes the third step in the histidine degradation pathway, the hydrolysis of (S)-3-(5-oxo-4,5-dihydro-3H-imidazol-4-yl)propanoate to N-formimidoyl-L-glutamate Back     alignment and domain information
>TIGR02318 phosphono_phnM phosphonate metabolism protein PhnM Back     alignment and domain information
>COG0804 UreC Urea amidohydrolase (urease) alpha subunit [Amino acid transport and metabolism] Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>PRK09045 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>cd00443 ADA_AMPD Adenosine/AMP deaminase Back     alignment and domain information
>PF00701 DHDPS: Dihydrodipicolinate synthetase family; InterPro: IPR002220 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants Back     alignment and domain information
>KOG2584 consensus Dihydroorotase and related enzymes [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02417 dihydrodipicolinate synthase Back     alignment and domain information
>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA) Back     alignment and domain information
>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis Back     alignment and domain information
>PRK09230 cytosine deaminase; Provisional Back     alignment and domain information
>TIGR01224 hutI imidazolonepropionase Back     alignment and domain information
>PRK15446 phosphonate metabolism protein PhnM; Provisional Back     alignment and domain information
>COG1001 AdeC Adenine deaminase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK03170 dihydrodipicolinate synthase; Provisional Back     alignment and domain information
>PRK04147 N-acetylneuraminate lyase; Provisional Back     alignment and domain information
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid) Back     alignment and domain information
>TIGR00674 dapA dihydrodipicolinate synthase Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>KOG4127 consensus Renal dipeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03234 OH-pyruv-isom hydroxypyruvate isomerase Back     alignment and domain information
>TIGR00221 nagA N-acetylglucosamine-6-phosphate deacetylase Back     alignment and domain information
>PRK15108 biotin synthase; Provisional Back     alignment and domain information
>cd01313 Met_dep_hydrolase_E Metallo-dependent hydrolases, subgroup D is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>COG1574 Predicted metal-dependent hydrolase with the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>PRK00912 ribonuclease P protein component 3; Provisional Back     alignment and domain information
>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK07328 histidinol-phosphatase; Provisional Back     alignment and domain information
>TIGR00683 nanA N-acetylneuraminate lyase Back     alignment and domain information
>cd01305 archeal_chlorohydrolases Predicted chlorohydrolases Back     alignment and domain information
>PF02614 UxaC: Glucuronate isomerase; InterPro: IPR003766 Uronate isomerase (also known as glucuronate isomerase) catalyses the reaction D-glucuronate to D-fructuronate and also converts D-galacturonate to D-tagaturonate [] Back     alignment and domain information
>TIGR00683 nanA N-acetylneuraminate lyase Back     alignment and domain information
>PF10566 Glyco_hydro_97: Glycoside hydrolase 97 ; InterPro: IPR019563 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK06151 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>PRK08609 hypothetical protein; Provisional Back     alignment and domain information
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid) Back     alignment and domain information
>PRK04250 dihydroorotase; Provisional Back     alignment and domain information
>TIGR03121 one_C_dehyd_A formylmethanofuran dehydrogenase subunit A Back     alignment and domain information
>PRK11170 nagA N-acetylglucosamine-6-phosphate deacetylase; Provisional Back     alignment and domain information
>cd01312 Met_dep_hydrolase_D Metallo-dependent hydrolases, subgroup D is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA) Back     alignment and domain information
>PRK09356 imidazolonepropionase; Validated Back     alignment and domain information
>cd01306 PhnM PhnM is believed to be a subunit of the membrane associated C-P lyase complex Back     alignment and domain information
>PF09370 TIM-br_sig_trns: TIM-barrel signal transduction protein; InterPro: IPR009215 Members of this family are predicted to have a TIM barrel fold, based on PSI-BLAST analysis (iteration 4) and on SCOP prediction (using SMART) Back     alignment and domain information
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>PRK07945 hypothetical protein; Provisional Back     alignment and domain information
>PRK09997 hydroxypyruvate isomerase; Provisional Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>cd01321 ADGF Adenosine deaminase-related growth factors (ADGF), a novel family of secreted growth-factors with sequence similarty to adenosine deaminase Back     alignment and domain information
>PF03102 NeuB: NeuB family; InterPro: IPR013132 NeuB is the prokaryotic N-acetylneuraminic acid synthase (Neu5Ac) Back     alignment and domain information
>PRK08418 chlorohydrolase; Provisional Back     alignment and domain information
>PRK13209 L-xylulose 5-phosphate 3-epimerase; Reviewed Back     alignment and domain information
>TIGR03569 NeuB_NnaB N-acetylneuraminate synthase Back     alignment and domain information
>PRK12330 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK09989 hypothetical protein; Provisional Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>PRK09229 N-formimino-L-glutamate deiminase; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query342
2ffi_A288 Crystal Structure Of Putative 2-pyrone-4,6-dicarbox 2e-09
4d8l_A303 Crystal Structure Of The 2-pyrone-4,6-dicarboxylic 3e-07
4dia_A303 Crystal Structure Of The D248n Mutant Of 2-pyrone-4 1e-06
4di8_A303 Crystal Structure Of The D248a Mutant Of 2-pyrone-4 3e-06
4dlf_A303 Crystal Structure Of An Amidohydrolase (Cog3618) Fr 8e-05
4i6k_A294 Crystal Structure Of Probable 2-Pyrone-4,6-Dicarbox 1e-04
>pdb|2FFI|A Chain A, Crystal Structure Of Putative 2-pyrone-4,6-dicarboxylic Acid Hydrolase From Pseudomonas Putida, Northeast Structural Genomics Target Ppr23. Length = 288 Back     alignment and structure 
Iteration: 1

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 68/258 (26%), Positives = 106/258 (41%), Gaps = 43/258 (16%)
Query: 63  IDSHLHVWASPEEAADKFPYFPGQEPTLPGHVDFLLQCMEEASVDGALIVQPINHKFDHS 122
           IDSH HV++     A +  Y P  +  L    D+L Q        G L VQP     D+ 
Sbjct: 15  IDSHAHVFSRGLNLASQRRYAPNYDAPLG---DYLGQLRAHGFSHGVL-VQPSFLGTDNR 70
Query: 123 LVTSVLKKYPSKFVGCCLANPAEDVIGIKQLEQLILKD----GFRAVRFNPYLWPSGQQ- 177
            + S L+  P +  G             + +EQ  L +    G R VR N      GQ  
Sbjct: 71  YLLSALQTVPGQLRGVVXLE--------RDVEQATLAEXARLGVRGVRLNL----XGQDX 118
Query: 178 --MTNEVGKAMFSKAGELGVPVGFMCMKGLNLHISEIEELCTEFP--STTVLLDHLAFCK 233
             +T    + +  + GE G  V       L+  +++I  L          +++DH  F +
Sbjct: 119 PDLTGAQWRPLLERIGEQGWHVE------LHRQVADIPVLVRALQPYGLDIVIDH--FGR 170
Query: 234 PPSNDEESL-AFSNLLKLSRFPQVYVKFSALFRVSRMP-----FPYQDLSSPLSQVVSSF 287
           P +        F+ LL LS   +V+VK S ++R+   P     F  Q L +    + + +
Sbjct: 171 PDARRGLGQPGFAELLTLSGRGKVWVKVSGIYRLQGSPEENLAFARQALCA----LEAHY 226
Query: 288 GANRVMWGSDFPYVVPEC 305
           GA R+ WGSD+P+   E 
Sbjct: 227 GAERLXWGSDWPHTQHES 244
>pdb|4D8L|A Chain A, Crystal Structure Of The 2-pyrone-4,6-dicarboxylic Acid Hydrolase From Sphingomonas Paucimobilis Length = 303 Back     alignment and structure
>pdb|4DIA|A Chain A, Crystal Structure Of The D248n Mutant Of 2-pyrone-4,6-dicarboxylic Acid Hydrolase From Sphingomonas Paucimobilis Complexed With Substrate At Ph 4.6 Length = 303 Back     alignment and structure
>pdb|4DI8|A Chain A, Crystal Structure Of The D248a Mutant Of 2-pyrone-4,6-dicarboxylic Acid Hydrolase From Sphingomonas Paucimobilis Complexed With Substrate At Ph 8.5 Length = 303 Back     alignment and structure
>pdb|4DLF|A Chain A, Crystal Structure Of An Amidohydrolase (Cog3618) From Burkholderia Multivorans (Target Efi-500235) With Bound Zn, Space Group P3221 Length = 303 Back     alignment and structure
>pdb|4I6K|A Chain A, Crystal Structure Of Probable 2-Pyrone-4,6-Dicarboxylic Acid Hydrolase Abaye1769 (Target Efi-505029) From Acinetobacter Baumannii With Citric Acid Bound Length = 294 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query342
2ffi_A288 2-pyrone-4,6-dicarboxylic acid hydrolase, putativ; 1e-52
4d9a_A303 2-pyrone-4,6-dicarbaxylate hydrolase; structural g 1e-39
3irs_A291 Uncharacterized protein BB4693; structural genomic 7e-37
4do7_A303 Amidohydrolase 2; enzyme function initiative, EFI, 6e-34
3cjp_A272 Predicted amidohydrolase, dihydroorotase family; s 6e-25
2f6k_A307 Metal-dependent hydrolase; metal dependent hydroly 2e-14
3ij6_A312 Uncharacterized metal-dependent hydrolase; structu 3e-12
3nur_A357 Amidohydrolase; TIM barrel; 1.75A {Staphylococcus 3e-10
2gwg_A350 4-oxalomesaconate hydratase; TIM-barrel like prote 3e-10
2wm1_A336 2-amino-3-carboxymuconate-6-semialdehyde decarboxy 1e-09
2dvt_A327 Thermophilic reversible gamma-resorcylate decarbo; 5e-09
2hbv_A334 2-amino-3-carboxymuconate 6-semialdehyde decarbox; 6e-08
2qpx_A376 Predicted metal-dependent hydrolase of the TIM-BA; 2e-06
4dzi_A423 Putative TIM-barrel metal-dependent hydrolase; ami 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>2ffi_A 2-pyrone-4,6-dicarboxylic acid hydrolase, putativ; TIM-barrel protein., structural genomics, PSI, protein struc initiative; 2.61A {Pseudomonas putida} SCOP: c.1.9.15 Length = 288 Back     alignment and structure
 Score =  174 bits (443), Expect = 1e-52
 Identities = 55/282 (19%), Positives = 97/282 (34%), Gaps = 21/282 (7%)

Query: 62  IIDSHLHVWASPEEAADKFPYFPGQEPTLPGH--VDFLLQCMEEASVDGALIVQPINHKF 119
            IDSH HV++              +         +   L  +        ++VQP     
Sbjct: 14  AIDSHAHVFS------RGLNLASQRRYAPNYDAPLGDYLGQLRAHGFSHGVLVQPSFLGT 67

Query: 120 DHSLVTSVLKKYPSKFVGCCLANPAEDVIGIKQLEQLILKDGFRAVRFNPYLWPSGQQMT 179
           D+  + S L+  P +  G  +     +   + ++ +     G R VR N         +T
Sbjct: 68  DNRYLLSALQTVPGQLRGVVMLERDVEQATLAEMAR----LGVRGVRLNLM-GQDMPDLT 122

Query: 180 NEVGKAMFSKAGELGVPVGFMCMKGLNLHISEIEELCTEFPSTTVLLDHLAFCKPPSNDE 239
               + +  + GE G  V           I  +      +    +++DH           
Sbjct: 123 GAQWRPLLERIGEQGWHVELHRQ---VADIPVLVRALQPYG-LDIVIDHFGRP-DARRGL 177

Query: 240 ESLAFSNLLKLSRFPQVYVKFSALFRVSRMPFP-YQDLSSPLSQVVSSFGANRVMWGSDF 298
               F+ LL LS   +V+VK S ++R+   P          L  + + +GA R+MWGSD+
Sbjct: 178 GQPGFAELLTLSGRGKVWVKVSGIYRLQGSPEENLAFARQALCALEAHYGAERLMWGSDW 237

Query: 299 PYVVPECGYKGGREAASLIANEVPLSPSELEWIMGGTIMQLF 340
           P+   E     G          +  S    + ++  T   LF
Sbjct: 238 PHTQHESEVSFGSAVEQF--EALGCSAQLRQALLLDTARALF 277
>3irs_A Uncharacterized protein BB4693; structural genomics, PSI-2, protein structure initiative, TI protein; HET: GOL; 1.76A {Bordetella bronchiseptica} PDB: 3k4w_A Length = 291 Back     alignment and structure
>4do7_A Amidohydrolase 2; enzyme function initiative, EFI, structural TIM-barrel fold, putative lactonase; 1.70A {Burkholderia multivorans} PDB: 4dlm_A 4dnm_A* 4dlf_A Length = 303 Back     alignment and structure
>3cjp_A Predicted amidohydrolase, dihydroorotase family; structural genomics, protein structure initiative; 1.85A {Clostridium acetobutylicum atcc 824} Length = 272 Back     alignment and structure
>2f6k_A Metal-dependent hydrolase; metal dependent hydrolyse, aminohydro_2, ACMDS, ACMS, trypto metabolism, quinolinic acid, QUIN; 2.50A {Lactobacillus plantarum} SCOP: c.1.9.15 Length = 307 Back     alignment and structure
>3ij6_A Uncharacterized metal-dependent hydrolase; structural genomics, amidohydrolase, PSI-2, protein structure initiative; 2.00A {Lactobacillus acidophilus} Length = 312 Back     alignment and structure
>3nur_A Amidohydrolase; TIM barrel; 1.75A {Staphylococcus aureus} Length = 357 Back     alignment and structure
>2gwg_A 4-oxalomesaconate hydratase; TIM-barrel like protein, structural genomics, PSI, protein S initiative; 1.80A {Rhodopseudomonas palustris} SCOP: c.1.9.15 Length = 350 Back     alignment and structure
>2wm1_A 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase; neurological disorders, metal-dependent amidohydrolase, kynurenine pathway; HET: 13P; 2.01A {Homo sapiens} Length = 336 Back     alignment and structure
>2dvt_A Thermophilic reversible gamma-resorcylate decarbo; TIM barrel, lyase; 1.70A {Rhizobium SP} SCOP: c.1.9.15 PDB: 2dvu_A* 2dvx_A* 3s4t_A* Length = 327 Back     alignment and structure
>2hbv_A 2-amino-3-carboxymuconate 6-semialdehyde decarbox; ACMSD, TIM-barrel, decarboxylase, metaloenzyme, lyase; 1.65A {Pseudomonas fluorescens} SCOP: c.1.9.15 PDB: 2hbx_A Length = 334 Back     alignment and structure
>2qpx_A Predicted metal-dependent hydrolase of the TIM-BA; YP_805737.1, putative metal-dependent hydrolase; HET: KCX MSE; 1.40A {Lactobacillus casei} Length = 376 Back     alignment and structure
>4dzi_A Putative TIM-barrel metal-dependent hydrolase; amidohydrolase, bimetal binding site, enzyme FUNC initiative, EFI; HET: SO4; 1.60A {Mycobacterium avium subsp} Length = 423 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query342
4do7_A303 Amidohydrolase 2; enzyme function initiative, EFI, 100.0
4d9a_A303 2-pyrone-4,6-dicarbaxylate hydrolase; structural g 100.0
4i6k_A294 Amidohydrolase family protein; enzyme function ini 100.0
2ffi_A288 2-pyrone-4,6-dicarboxylic acid hydrolase, putativ; 100.0
3ij6_A312 Uncharacterized metal-dependent hydrolase; structu 100.0
3nur_A357 Amidohydrolase; TIM barrel; 1.75A {Staphylococcus 100.0
3irs_A291 Uncharacterized protein BB4693; structural genomic 100.0
2wm1_A336 2-amino-3-carboxymuconate-6-semialdehyde decarboxy 100.0
2dvt_A327 Thermophilic reversible gamma-resorcylate decarbo; 100.0
2hbv_A334 2-amino-3-carboxymuconate 6-semialdehyde decarbox; 100.0
2f6k_A307 Metal-dependent hydrolase; metal dependent hydroly 100.0
4inf_A373 Metal-dependent hydrolase; amidohydrolase, metal b 100.0
3cjp_A272 Predicted amidohydrolase, dihydroorotase family; s 100.0
2gwg_A350 4-oxalomesaconate hydratase; TIM-barrel like prote 100.0
2gzx_A265 Putative TATD related DNAse; deoxyribonuclease, NE 100.0
4dzi_A423 Putative TIM-barrel metal-dependent hydrolase; ami 100.0
1yix_A265 Deoxyribonuclease YCFH; TIM barrel, zinc ION, NEW 99.98
1j6o_A268 TATD-related deoxyribonuclease; structural genomic 99.97
1xwy_A264 DNAse TATD, deoxyribonuclease TATD; TIM barrael, z 99.96
1zzm_A259 Putative deoxyribonuclease YJJV; hydrolaze, zinc, 99.96
2y1h_A272 Putative deoxyribonuclease tatdn3; hydrolase; 2.50 99.95
3rcm_A287 TATD family hydrolase; HET: CIT; 2.05A {Pseudomona 99.94
2xio_A301 Putative deoxyribonuclease tatdn1; hydrolase; 1.19 99.93
3ipw_A325 Hydrolase TATD family protein; niaid, ssgcid, seat 99.91
3gg7_A254 Uncharacterized metalloprotein; structural genomic 99.89
3e2v_A401 3'-5'-exonuclease; structural genomics, hydrolase, 99.83
3guw_A261 Uncharacterized protein AF_1765; alpha-beta protei 99.81
1bf6_A291 Phosphotriesterase homology protein; hypothetical 99.81
2qpx_A376 Predicted metal-dependent hydrolase of the TIM-BA; 99.8
2vc7_A314 Aryldialkylphosphatase; phosphotriesterase, promis 99.77
2ob3_A330 Parathion hydrolase; metalloenzyme, TIM barrel, ne 99.62
3gtx_A339 Organophosphorus hydrolase; mutant, amidohydrolase 99.58
3ovg_A363 Amidohydrolase; structural genomics, PSI-2, protei 99.37
3rhg_A365 Putative phophotriesterase; hydrolase, amidohydrol 99.36
3pnz_A330 Phosphotriesterase family protein; amidohydrolase 99.35
3k2g_A364 Resiniferatoxin-binding, phosphotriesterase- relat 99.33
3tn4_A360 Phosphotriesterase; lactonase, hydrolase; HET: KCX 99.28
2z26_A347 Dihydroorotase, dhoase; TIM barrel, hydrolase; HET 99.16
2i5g_A325 Amidohydrolase; NYSGXRC, NYSGXRC-9311A, PSI2, stru 99.0
3nqb_A 608 Adenine deaminase 2; PSI-II, structural genomics, 98.84
2z00_A426 Dihydroorotase; zinc binding protein, hydrolase, m 98.79
3hm7_A448 Allantoinase; metallo-dependent hydrolase, protein 98.77
3neh_A318 Renal dipeptidase family protein; structural genom 98.53
4f0r_A447 5-methylthioadenosine/S-adenosylhomocysteine DEAM; 98.53
3pnu_A359 Dihydroorotase; TIM barrel, zinc binding, hydrolas 98.49
2ics_A379 Adenine deaminase; TIM barrel, binuclear zinc, ade 98.48
3b40_A417 PVDM, probable dipeptidase; structural genomics, h 98.46
3id7_A400 Dipeptidase; streptomyces coelicolor A3(2), hydrol 98.34
3lnp_A468 Amidohydrolase family protein OLEI01672_1_465; TIM 98.3
4dzh_A 472 Amidohydrolase; adenosine deaminase, nysgrc, struc 98.28
4dyk_A451 Amidohydrolase; adenosine deaminase, nysgrc, struc 98.24
2rag_A417 Dipeptidase; aminohydrolase, structural genomics, 98.22
3gnh_A403 L-lysine, L-arginine carboxypeptidase CC2672; N-me 98.22
3h4u_A479 Amidohydrolase; signature of Zn ligands, structura 98.19
1j5s_A463 Uronate isomerase; TM0064, structural genomics, JC 98.17
3ls9_A456 Triazine hydrolase; atrazine chlorohydrolase TRZN; 98.15
1itu_A369 Renal dipeptidase; glycoprotein, membrane-bound, z 98.15
3ly0_A364 Dipeptidase AC. metallo peptidase. merops family M 98.11
3sfw_A461 Dihydropyrimidinase; hydrolase, zinc binding; HET: 98.06
3gri_A424 Dihydroorotase, dhoase; hydrolase, IDP00795, metal 98.03
3mpg_A428 Dihydroorotase, dhoase; hydrolase; 2.60A {Bacillus 97.95
4aql_A476 Guanine deaminase; hydrolase, purine metabolism; H 97.84
3e74_A473 Allantoinase; (beta/alpha)8-barrel domain, small b 97.78
2q01_A497 Uronate isomerase; structural genomics, protein st 97.76
2qs8_A418 XAA-Pro dipeptidase; amidohydrolase, TIM barrel, p 97.73
1gkr_A 458 Hydantoinase, non-ATP dependent L-selective hydant 97.67
2ogj_A417 Dihydroorotase; TIM barrel, binuclear zinc, imidaz 97.66
2i9u_A439 Cytosine/guanine deaminase related protein; protei 97.57
3feq_A423 Putative amidohydrolase; unknown source, sargasso 97.53
2fty_A 559 Dihydropyrimidinase; alpha/beta barrel, beta-sandw 97.49
3ooq_A396 Amidohydrolase; structural genomics, protein struc 97.46
2ood_A475 BLR3880 protein; PSI-II, PSI-2, guanine deaminase, 97.4
3be7_A408 Zn-dependent arginine carboxypeptidase; unknown so 97.38
2r8c_A426 Putative amidohydrolase; unknown source, sargasso 97.32
3gip_A 480 N-acyl-D-glutamate deacylase; amidohydrolase famil 97.32
2vun_A386 Enamidase; nicotinate degradation, binuclear metal 97.32
2qt3_A403 N-isopropylammelide isopropyl amidohydrolase; N-is 97.23
2gwn_A452 Dihydroorotase; zinc-binding prote structural geno 97.17
1nfg_A 457 D-hydantoinase; TIM barrel, hydrolase; HET: KCX; 2 97.12
2paj_A492 Putative cytosine/guanine deaminase; NYSGXRC, PSI- 97.07
1p1m_A406 Hypothetical protein TM0936; putative metal depend 97.07
3dc8_A 490 Dihydropyrimidinase; TIM-barrel, hydrolase; HET: K 97.0
1ra0_A430 Cytosine deaminase; alpha-beta barrel, hexamer, co 96.72
2vm8_A 501 Dihydropyrimidinase-related protein 2; neurogenesi 96.67
3icj_A534 Uncharacterized metal-dependent hydrolase; structu 96.66
3mdu_A453 N-formimino-L-glutamate iminohydrolase; amonohydra 96.64
2q09_A416 Imidazolonepropionase; 9252H, NYSGXRC, 3-(2, 5-dio 96.62
2p9b_A458 Possible prolidase; protein structure initiative I 96.47
4ubp_C 570 Protein (urease (chain C)); bacillus pasteurii, ni 96.41
4ac7_C 570 Urease subunit alpha; hydrolase, bacillus pasteuri 96.41
1e9y_B 569 Urease subunit beta; hydrolase, dodecamer; HET: KC 96.41
1gkp_A 458 Hydantoinase; hydrolase, dihydropyrimidinase, cycl 96.36
2ftw_A 521 Dihydropyrimidine amidohydrolase; (beta-alpha)8-ba 96.27
2imr_A420 Hypothetical protein DR_0824; zinc, NYSGXRC, PSI2, 96.27
2vr2_A 541 Dihydropyrimidinase; hydantoinase, metal-binding, 96.03
1v77_A212 PH1877P, hypothetical protein PH1877; RNAse P prot 96.0
1xrt_A467 Dihydroorotase, dhoase; amidohydrolase, metalloenz 96.0
3v7p_A427 Amidohydrolase family protein; iron binding site, 95.91
2pgf_A371 Adenosine deaminase; metallo-dependent hydrolase, 95.82
1onw_A390 Isoaspartyl dipeptidase; amidohydrolase, hydrolase 95.64
1o12_A376 N-acetylglucosamine-6-phosphate deacetylase; struc 95.49
3rys_A343 Adenosine deaminase 1; SGX, hydrolase; HET: ADE; 2 95.25
3b4u_A294 Dihydrodipicolinate synthase; structural genomics, 95.22
3fkr_A309 L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL f 95.16
2qee_A437 BH0493 protein; amidohydrolase, structural genomic 95.1
3pao_A326 Adenosine deaminase; structural genomics, PSI-2, p 94.88
3iar_A367 Adenosine deaminase; purine metabolism structural 94.82
3si9_A315 DHDPS, dihydrodipicolinate synthase; structural ge 94.72
2ehh_A294 DHDPS, dihydrodipicolinate synthase; structural ge 94.66
3m5v_A301 DHDPS, dihydrodipicolinate synthase; TIM barrel, c 94.58
3daq_A292 DHDPS, dihydrodipicolinate synthase; lysine biosyn 94.52
2yxg_A289 DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b 94.51
3dz1_A313 Dihydrodipicolinate synthase; lysine biosynthesis, 94.45
3l21_A304 DHDPS, dihydrodipicolinate synthase; DAPA, dimer, 94.37
3na8_A315 Putative dihydrodipicolinate synthetase; lyase; HE 94.31
3tva_A290 Xylose isomerase domain protein TIM barrel; struct 94.29
3flu_A297 DHDPS, dihydrodipicolinate synthase; TIM barrel, b 94.07
1o5k_A306 DHDPS, dihydrodipicolinate synthase; TM1521, struc 94.03
3p6l_A262 Sugar phosphate isomerase/epimerase; TIM barrel, s 93.87
3tak_A291 DHDPS, dihydrodipicolinate synthase; TIM barrel, l 93.87
3qze_A314 DHDPS, dihydrodipicolinate synthase; alpha beta ba 93.87
2v9d_A343 YAGE; dihydrodipicolinic acid synthase, N-acetyl n 93.75
3s5o_A307 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; 93.71
4f0l_A458 Amidohydrolase; ssgcid, structural genomics, seatt 93.7
2wkj_A303 N-acetylneuraminate lyase; directed evolution, sia 93.47
1xky_A301 Dihydrodipicolinate synthase; TIM barrel, , lysine 93.44
1f6k_A293 N-acetylneuraminate lyase; beta barrel; 1.60A {Hae 93.4
3cpr_A304 Dihydrodipicolinate synthetase; (beta/alpha)8-barr 93.39
3qfe_A318 Putative dihydrodipicolinate synthase family PROT; 93.34
2vc6_A292 MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar 93.33
1k77_A260 EC1530, hypothetical protein YGBM; TIM barrel, str 93.26
3d0c_A314 Dihydrodipicolinate synthase; lysine biosynthesis, 93.25
3e96_A316 Dihydrodipicolinate synthase; structural genomics, 93.18
3kws_A287 Putative sugar isomerase; structural genomics, joi 93.17
2q02_A272 Putative cytoplasmic protein; structural genomics, 92.95
3lmz_A257 Putative sugar isomerase; structural genomics, joi 92.93
2ojp_A292 DHDPS, dihydrodipicolinate synthase; dimer, lysine 92.85
3ngf_A269 AP endonuclease, family 2; structural genomics, se 92.81
4dpp_A360 DHDPS 2, dihydrodipicolinate synthase 2, chloropla 92.63
2r8w_A332 AGR_C_1641P; APC7498, dihydrodipicolinate synthase 92.59
3h5d_A311 DHDPS, dihydrodipicolinate synthase; lysine biosyn 92.54
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 92.44
2rfg_A297 Dihydrodipicolinate synthase; beta barrel, amino-a 92.06
2hmc_A344 AGR_L_411P, dihydrodipicolinate synthase; alpha-be 92.06
1i60_A278 IOLI protein; beta barrel, structural genomics, PS 91.51
3a5f_A291 Dihydrodipicolinate synthase; TIM barrel, enzyme, 91.14
3iv8_A381 N-acetylglucosamine-6-phosphate deacetylase; IDP01 90.67
3eb2_A300 Putative dihydrodipicolinate synthetase; lysine bi 90.52
1rk6_A 496 D-aminoacylase; TIM barrel, beta barrel, insertion 90.42
4gy7_A 840 Urease; JACK bean, hydrolase, ME binding, nickel; 90.24
3dx5_A286 Uncharacterized protein ASBF; beta-alpha barrel, p 89.37
1w3i_A293 EDA, 2-keto-3-deoxy gluconate aldolase; archaeal m 89.01
2r91_A286 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM 87.96
3ayv_A254 Putative uncharacterized protein TTHB071; structur 87.58
2nuw_A288 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho a 87.26
2qul_A290 D-tagatose 3-epimerase; beta/alpha barrel, isomera 87.0
2hk0_A309 D-psicose 3-epimerase; TIM-barrel, isomerase; 2.00 86.32
3cqj_A295 L-ribulose-5-phosphate 3-epimerase ULAE; TIM-barre 85.63
3qc0_A275 Sugar isomerase; TIM barrel, structural genomics, 85.57
2pcq_A283 Putative dihydrodipicolinate synthase; lyase, lysi 85.42
3vni_A294 Xylose isomerase domain protein TIM barrel; D-psic 85.33
2wkj_A303 N-acetylneuraminate lyase; directed evolution, sia 85.31
1yx1_A264 Hypothetical protein PA2260; structural genomics, 84.51
3aam_A270 Endonuclease IV, endoiv; DNA repair, base excision 84.41
3qze_A314 DHDPS, dihydrodipicolinate synthase; alpha beta ba 84.38
3eb2_A300 Putative dihydrodipicolinate synthetase; lysine bi 84.27
3e96_A316 Dihydrodipicolinate synthase; structural genomics, 83.64
2bb0_A421 Imidazolonepropionase; TIM barrel, hydrolase; 2.00 83.39
2puz_A419 Imidazolonepropionase; NYSGXRC, PSI-2, N-formimino 83.13
3iac_A473 Glucuronate isomerase; IDP02065, structural genom 81.18
1nvm_A345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 80.82
>4do7_A Amidohydrolase 2; enzyme function initiative, EFI, structural TIM-barrel fold, putative lactonase; 1.70A {Burkholderia multivorans} PDB: 4dlm_A 4dnm_A* 4dlf_A Back     alignment and structure
Probab=100.00  E-value=2.1e-48  Score=361.33  Aligned_cols=274  Identities=16%  Similarity=0.219  Sum_probs=221.1

Q ss_pred             CCCCeeeeeeeccCCCCccCCCCCCCCCC-CC-CCCCChHHHHHHhHHCCCceEEEeCCCCCccchHHHHHHHHhCCCcE
Q 019335           58 SKVKIIDSHLHVWASPEEAADKFPYFPGQ-EP-TLPGHVDFLLQCMEEASVDGALIVQPINHKFDHSLVTSVLKKYPSKF  135 (342)
Q Consensus        58 ~~~~iID~H~Hl~~~~~~~~~~~p~~~~~-~~-~~~~~~~~ll~~md~~GI~~~v~~~~~~~~~~N~~~~~~~~~~p~r~  135 (342)
                      +++||||+|+|+|+++.   ..|||.... .+ ....+++++++.|+++||+++|+++++.++.+|++++++++++| ++
T Consensus         1 ~~~m~iD~H~H~~~~~~---~~~pw~~~~~~~~~~~~~~~~ll~~~~~~GV~~~V~v~~~~~~~~n~~l~~la~~~p-~~   76 (303)
T 4do7_A            1 MGALRIDSHQHFWRYRA---ADYPWIGAGMGVLARDYLPDALHPLMHAQALGASIAVQARAGRDETAFLLELACDEA-RI   76 (303)
T ss_dssp             --CCCEEEEECCBCCCG---GGCTTCCTTCGGGSSCBCHHHHHHHHHHTTCCEEEEECCSSSHHHHHHHHHHHTTCT-TE
T ss_pred             CCCcEEeCCEecccCCC---CCCCCCCCccccccCCCCHHHHHHHHHhcCCcEEEEEccCCcHHHHHHHHHHHHhCC-Ce
Confidence            35679999999998752   589998432 21 13579999999999999999999998777889999999999998 89


Q ss_pred             EEEE-EcCCCCcchHHHHHHHHHhcCCceEEEecCCCCCCCC-cCCcHHHHHHHHHHhhhCCeEEEEeccCCCCCHHHHH
Q 019335          136 VGCC-LANPAEDVIGIKQLEQLILKDGFRAVRFNPYLWPSGQ-QMTNEVGKAMFSKAGELGVPVGFMCMKGLNLHISEIE  213 (342)
Q Consensus       136 ~g~~-~i~p~~~~~~~~eler~~~~~g~~Gvk~~~~~~~~g~-~l~~~~~~~~~~~a~e~~lpv~iH~~~~~~~~~~~l~  213 (342)
                      +|++ .++|..++ +.++|+++. +.|++|||++....+... .++++.+.+++++|+++|+||.+|++.   .++..+.
T Consensus        77 ~g~vg~v~~~~~~-~~~~L~~l~-~~gv~Gir~~~~~~~~~~~~~~~~~~~~~~~~~~~~glpv~ih~~~---~~l~~l~  151 (303)
T 4do7_A           77 AAVVGWEDLRAPQ-LAERVAEWR-GTKLRGFRHQLQDEADVRAFVDDADFARGVAWLQANDYVYDVLVFE---RQLPDVQ  151 (303)
T ss_dssp             EEEEECCCTTCTT-HHHHHTTCC-SSCEEEEECCGGGSSCHHHHHHCHHHHHHHHHHHHTTCEEEECCCG---GGHHHHH
T ss_pred             EEEEEEeCCCCch-HHHHHHHHh-hcCceEEEecCcCCCCccccccCHHHHHHHHHHHHCCCeEEEecCH---HHHHHHH
Confidence            9986 59998776 789999997 899999999865321112 578999999999999999999999973   4688999


Q ss_pred             HHHHhCCCCcEEecccCCCCCCC---CchhhHhHHH-HhcccCCCcEEEecCccccccc-C----CCCCCCchhHHHHHH
Q 019335          214 ELCTEFPSTTVLLDHLAFCKPPS---NDEESLAFSN-LLKLSRFPQVYVKFSALFRVSR-M----PFPYQDLSSPLSQVV  284 (342)
Q Consensus       214 ~l~~~~P~lk~vl~H~G~~~p~~---~~~~~~~~~~-~~~l~~~~Nvy~~~S~~~~~~~-~----~~~~~~~~~~l~~~i  284 (342)
                      +++++||+++||++|+|.+....   ..+....|.+ +..|+++||||+|+|+.+.... .    .|++.+..+.++.++
T Consensus       152 ~ll~~~P~l~iVi~H~G~p~~~~~~~~~~~~~~w~~~l~~la~~~nv~~klSg~~~~~~~~~~~~~~~~~~~~~~~~~~~  231 (303)
T 4do7_A          152 AFCARHDAHWLVLDHAGKPALAEFDRDDTALARWRAALRELAALPHVVCKLSGLVTEADWRRGLRASDLRHIEQCLDAAL  231 (303)
T ss_dssp             HHHHHCCSSCEEEGGGGCCCGGGCC---CHHHHHHHHHHHHHTSTTEEEEECSCGGGSCTTTCCCHHHHHHHHHHHHHHH
T ss_pred             HHHHHCCCCCEEEeCCCCCCccccccccchHHHHHHHHHHHHhCCCEEEEeCCccccccccccccCCCHHHHHHHHHHHH
Confidence            99999999999999999853210   0023456765 6678899999999999876542 1    233445567899999


Q ss_pred             HhcCCCcEEEccCCCCCCCCCChHhHHHHHHHHHhcCCCCHHHHHHHHhHHHHHhcC
Q 019335          285 SSFGANRVMWGSDFPYVVPECGYKGGREAASLIANEVPLSPSELEWIMGGTIMQLFQ  341 (342)
Q Consensus       285 ~~~G~dRilfGSD~P~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~I~~~NA~rl~~  341 (342)
                      +.+|+||||||||||+.....+|..+.+.++.++ ..+++++++++|+++||+|||+
T Consensus       232 ~~~G~dri~fgSD~P~~~~~~~~~~~~~~~~~~~-~~~l~~~~~~~i~~~Na~rl~~  287 (303)
T 4do7_A          232 DAFGPQRLMFGSDWPVCLLAASYDEVASLVERWA-ESRLSAAERSALWGGTAARCYA  287 (303)
T ss_dssp             HHHCGGGEEECCCBTGGGGTCCHHHHHHHHHHHH-HHHCCHHHHHHHTTHHHHHHTT
T ss_pred             HHhCcccEEEeCCCCCCcCcCCHHHHHHHHHHHH-hcCCCHHHHHHHHHHHHHHHhC
Confidence            9999999999999999987667888877777632 1368999999999999999996
>4i6k_A Amidohydrolase family protein; enzyme function initiative, isomerase, structural; HET: CIT; 2.28A {Acinetobacter baumannii} Back     alignment and structure
>2ffi_A 2-pyrone-4,6-dicarboxylic acid hydrolase, putativ; TIM-barrel protein., structural genomics, PSI, protein struc initiative; 2.61A {Pseudomonas putida} SCOP: c.1.9.15 Back     alignment and structure
>3ij6_A Uncharacterized metal-dependent hydrolase; structural genomics, amidohydrolase, PSI-2, protein structure initiative; 2.00A {Lactobacillus acidophilus} Back     alignment and structure
>3nur_A Amidohydrolase; TIM barrel; 1.75A {Staphylococcus aureus} Back     alignment and structure
>3irs_A Uncharacterized protein BB4693; structural genomics, PSI-2, protein structure initiative, TI protein; HET: GOL; 1.76A {Bordetella bronchiseptica} PDB: 3k4w_A Back     alignment and structure
>2wm1_A 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase; neurological disorders, metal-dependent amidohydrolase, kynurenine pathway; HET: 13P; 2.01A {Homo sapiens} Back     alignment and structure
>2dvt_A Thermophilic reversible gamma-resorcylate decarbo; TIM barrel, lyase; 1.70A {Rhizobium SP} SCOP: c.1.9.15 PDB: 2dvu_A* 2dvx_A* 3s4t_A* Back     alignment and structure
>2hbv_A 2-amino-3-carboxymuconate 6-semialdehyde decarbox; ACMSD, TIM-barrel, decarboxylase, metaloenzyme, lyase; 1.65A {Pseudomonas fluorescens} SCOP: c.1.9.15 PDB: 2hbx_A Back     alignment and structure
>2f6k_A Metal-dependent hydrolase; metal dependent hydrolyse, aminohydro_2, ACMDS, ACMS, trypto metabolism, quinolinic acid, QUIN; 2.50A {Lactobacillus plantarum} SCOP: c.1.9.15 Back     alignment and structure
>4inf_A Metal-dependent hydrolase; amidohydrolase, metal binding site, enzyme functi initiative, EFI; 1.48A {Novosphingobium aromaticivorans} PDB: 4ing_A* Back     alignment and structure
>3cjp_A Predicted amidohydrolase, dihydroorotase family; structural genomics, protein structure initiative; 1.85A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>2gwg_A 4-oxalomesaconate hydratase; TIM-barrel like protein, structural genomics, PSI, protein S initiative; 1.80A {Rhodopseudomonas palustris} SCOP: c.1.9.15 Back     alignment and structure
>2gzx_A Putative TATD related DNAse; deoxyribonuclease, NESG, ZR237, structural GENO PSI, protein structure initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>4dzi_A Putative TIM-barrel metal-dependent hydrolase; amidohydrolase, bimetal binding site, enzyme FUNC initiative, EFI; HET: SO4; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>1yix_A Deoxyribonuclease YCFH; TIM barrel, zinc ION, NEW YORK SGX center for structural genomics, nysgxrc; 1.90A {Escherichia coli} SCOP: c.1.9.12 Back     alignment and structure
>1j6o_A TATD-related deoxyribonuclease; structural genomics, TM0667, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.80A {Thermotoga maritima} SCOP: c.1.9.12 Back     alignment and structure
>1xwy_A DNAse TATD, deoxyribonuclease TATD; TIM barrael, zinc ION, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.1.9.12 Back     alignment and structure
>1zzm_A Putative deoxyribonuclease YJJV; hydrolaze, zinc, PEG, structural genomics, PSI; HET: P33; 1.80A {Escherichia coli} SCOP: c.1.9.12 Back     alignment and structure
>2y1h_A Putative deoxyribonuclease tatdn3; hydrolase; 2.50A {Homo sapiens} Back     alignment and structure
>3rcm_A TATD family hydrolase; HET: CIT; 2.05A {Pseudomonas putida} Back     alignment and structure
>2xio_A Putative deoxyribonuclease tatdn1; hydrolase; 1.19A {Homo sapiens} Back     alignment and structure
>3ipw_A Hydrolase TATD family protein; niaid, ssgcid, seattle structural genomics center for infect disease, dysentery, liver abcess; 1.95A {Entamoeba histolytica hm-1} Back     alignment and structure
>3gg7_A Uncharacterized metalloprotein; structural genomics, unknown function, plasmid, PSI-2, protein structure initiative; 1.50A {Deinococcus radiodurans} SCOP: c.1.9.0 Back     alignment and structure
>3e2v_A 3'-5'-exonuclease; structural genomics, hydrolase, PSI-2, protein initiative, NEW YORK SGX research center for structural GEN nysgxrc; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3guw_A Uncharacterized protein AF_1765; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 3.20A {Archaeoglobus fulgidus dsm 4304} Back     alignment and structure
>1bf6_A Phosphotriesterase homology protein; hypothetical protein; 1.70A {Escherichia coli} SCOP: c.1.9.3 Back     alignment and structure
>2qpx_A Predicted metal-dependent hydrolase of the TIM-BA; YP_805737.1, putative metal-dependent hydrolase; HET: KCX MSE; 1.40A {Lactobacillus casei} Back     alignment and structure
>2vc7_A Aryldialkylphosphatase; phosphotriesterase, promiscuous activities, enzyme evolution, hyperthermophilic, lactonase, hydrolase; HET: KCX GOL HT5; 2.05A {Sulfolobus solfataricus} PDB: 2vc5_A* Back     alignment and structure
>2ob3_A Parathion hydrolase; metalloenzyme, TIM barrel, nerve agents; HET: KCX BTB; 1.04A {Brevundimonas diminuta} PDB: 1psc_A* 1jgm_A* 3cak_A* 1ez2_A* 1eyw_A* 1hzy_A 1i0b_A 1i0d_A 1p6b_A* 1p6c_A* 2oql_A* 2o4q_A* 3cs2_A* 3e3h_A* 1qw7_A* 1dpm_A* 2o4m_A* 1pta_A 3c86_A* 2d2j_A ... Back     alignment and structure
>3gtx_A Organophosphorus hydrolase; mutant, amidohydrolase, alpha-beta barrel; HET: KCX; 1.62A {Deinococcus radiodurans} PDB: 2zc1_A* 3gti_A* 3gu9_A* 3gtf_A* 3gth_A* 3gu2_A* 3gu1_A* 3fdk_A* 3htw_A* Back     alignment and structure
>3ovg_A Amidohydrolase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, NYSGXRC, HAD, PSI; HET: KCX; 2.06A {Mycoplasma synoviae} PDB: 3msr_A* Back     alignment and structure
>3rhg_A Putative phophotriesterase; hydrolase, amidohydrolase, zinc binding site, enzyme functio initiative, EFI; HET: SO4; 1.53A {Proteus mirabilis} Back     alignment and structure
>3pnz_A Phosphotriesterase family protein; amidohydrolase fold; HET: KCX; 1.60A {Listeria monocytogenes serotype 4b strorganism_taxid} SCOP: c.1.9.0 Back     alignment and structure
>3k2g_A Resiniferatoxin-binding, phosphotriesterase- related protein; TIM barrel, binuclear zinc, protein structure initiative II (PSI II); 1.80A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3tn4_A Phosphotriesterase; lactonase, hydrolase; HET: KCX; 1.50A {Geobacillus kaustophilus} PDB: 3tnb_A* 3tn3_A* 3tn5_A* 3tn6_A* 3ojg_A* 3orw_A* 3f4c_A* 3f4d_A* Back     alignment and structure
>2z26_A Dihydroorotase, dhoase; TIM barrel, hydrolase; HET: KCX DOR NCD; 1.29A {Escherichia coli} PDB: 2z24_A* 2z25_A* 2eg6_A* 1xge_A* 2eg7_A* 2eg8_A* 2z27_A* 2e25_A* 2z28_A* 2z29_A* 3mjm_A* 2z2a_A* 1j79_A* 2z2b_A* 3ihn_A* 3jze_A* Back     alignment and structure
>2i5g_A Amidohydrolase; NYSGXRC, NYSGXRC-9311A, PSI2, structural genomics, protein structure initiative; 2.60A {Pseudomonas aeruginosa} Back     alignment and structure
>3nqb_A Adenine deaminase 2; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics, nysgxrc; 2.21A {Agrobacterium tumefaciens} PDB: 3t81_A 3t8l_A Back     alignment and structure
>2z00_A Dihydroorotase; zinc binding protein, hydrolase, metal-binding, pyrimidine biosynthesis, structural genomics, NPPSFA; 2.42A {Thermus thermophilus} Back     alignment and structure
>3hm7_A Allantoinase; metallo-dependent hydrolase, protein structure initiative, PSI-2, NEW YORK structural genomix research CON nysgxrc; 2.60A {Bacillus halodurans} Back     alignment and structure
>3neh_A Renal dipeptidase family protein; structural genomics, nysgrc, dipeptide L-Leu-D-Ala, PSI-2, P structure initiative; HET: L3A; 1.64A {Listeria monocytogenes} PDB: 3lu2_A Back     alignment and structure
>4f0r_A 5-methylthioadenosine/S-adenosylhomocysteine DEAM; structural genomics, PSI-biology; HET: MSE MTA; 1.80A {Chromobacterium violaceum} PDB: 4f0s_A* Back     alignment and structure
>3pnu_A Dihydroorotase; TIM barrel, zinc binding, hydrolase, structu genomics, center for structural genomics of infectious DISE csgid; HET: KCX; 2.40A {Campylobacter jejuni subsp} Back     alignment and structure
>2ics_A Adenine deaminase; TIM barrel, binuclear zinc, adenine complex, amidohydrolase, structural genomics, PSI, protein structure initiative; HET: KCX ADE; 2.30A {Enterococcus faecalis} SCOP: b.92.1.8 c.1.9.14 Back     alignment and structure
>3b40_A PVDM, probable dipeptidase; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3id7_A Dipeptidase; streptomyces coelicolor A3(2), hydrolase; 1.30A {Streptomyces coelicolor} PDB: 3isi_X* 3itc_A* 3k5x_A* 3s2j_A* 3s2l_A* 3s2m_A* 3s2n_A* Back     alignment and structure
>3lnp_A Amidohydrolase family protein OLEI01672_1_465; TIM barrel, beta-fold, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Oleispira antarctica} Back     alignment and structure
>4dzh_A Amidohydrolase; adenosine deaminase, nysgrc, structural GENO YORK structural genomics research consortium; 1.55A {Xanthomonas campestris PV} Back     alignment and structure
>4dyk_A Amidohydrolase; adenosine deaminase, nysgrc, structural GENO PSI-biology, NEW YORK structural genomics research consorti hydrolase; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>2rag_A Dipeptidase; aminohydrolase, structural genomics, NYSGXRC, target 9257A, protein structure initiative; 2.00A {Caulobacter crescentus} Back     alignment and structure
>1j5s_A Uronate isomerase; TM0064, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 2.85A {Thermotoga maritima} SCOP: c.1.9.8 Back     alignment and structure
>3ls9_A Triazine hydrolase; atrazine chlorohydrolase TRZN; 1.40A {Arthrobacter aurescens} PDB: 3lsc_A* 3lsb_A* Back     alignment and structure
>1itu_A Renal dipeptidase; glycoprotein, membrane-bound, zinc protease BET lactamase, cilastatin, complex (hydrolase-inhibitor), hydro; HET: NAG CIL; 2.00A {Homo sapiens} SCOP: c.1.9.7 PDB: 1itq_A* Back     alignment and structure
>3ly0_A Dipeptidase AC. metallo peptidase. merops family M19; structural genomics, nysgrc, target 9523C, phosphinate inhibitor, PSI-2; HET: LY0; 1.40A {Rhodobacter sphaeroides} PDB: 3fdg_A Back     alignment and structure
>3sfw_A Dihydropyrimidinase; hydrolase, zinc binding; HET: KCX; 1.73A {Brevibacillus agri} PDB: 1yny_A 1k1d_A* Back     alignment and structure
>3gri_A Dihydroorotase, dhoase; hydrolase, IDP00795, metal-binding, pyrimidine biosynthesis, structural genomics; 2.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3mpg_A Dihydroorotase, dhoase; hydrolase; 2.60A {Bacillus anthracis} Back     alignment and structure
>4aql_A Guanine deaminase; hydrolase, purine metabolism; HET: TXC; 1.99A {Homo sapiens} PDB: 2uz9_A* 3e0l_A Back     alignment and structure
>3e74_A Allantoinase; (beta/alpha)8-barrel domain, small beta-sheet domain, hydrolase, metal-binding, purine metabolism, zinc; HET: KCX; 2.10A {Escherichia coli} Back     alignment and structure
>2q01_A Uronate isomerase; structural genomics, protein structure initiative NEW YORK SGX research center for structural genomics, nysgx; 2.34A {Caulobacter crescentus} Back     alignment and structure
>2qs8_A XAA-Pro dipeptidase; amidohydrolase, TIM barrel, protein structure initiative, PSI-2, NYSGXRC, structural genomics; 2.33A {Alteromonas macleodii} SCOP: b.92.1.9 c.1.9.18 Back     alignment and structure
>1gkr_A Hydantoinase, non-ATP dependent L-selective hydantoinase; hydrolase, dihydropyrimidinase, cyclic amidase; HET: KCX; 2.60A {Arthrobacter aurescens} SCOP: b.92.1.3 c.1.9.6 Back     alignment and structure
>2ogj_A Dihydroorotase; TIM barrel, binuclear zinc, imidazole complex, amido hydrola 9244B, structural genomics, PSI-2; HET: KCX; 2.62A {Agrobacterium tumefaciens} Back     alignment and structure
>2i9u_A Cytosine/guanine deaminase related protein; protein structure initiative II (PSI-II), amidohydrol guanine deaminase; HET: GUN; 2.05A {Clostridium acetobutylicum} SCOP: b.92.1.4 c.1.9.9 Back     alignment and structure
>3feq_A Putative amidohydrolase; unknown source, sargasso SEA, structural GEN protein structure initiative, PSI; 2.63A {Unidentified} PDB: 3lwy_A* 3n2c_A* Back     alignment and structure
>2fty_A Dihydropyrimidinase; alpha/beta barrel, beta-sandwich, hydrolase; HET: KCX; 2.40A {Lachancea kluyveri} SCOP: b.92.1.3 c.1.9.6 PDB: 2fvk_A* 2fvm_A* Back     alignment and structure
>3ooq_A Amidohydrolase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, H PSI-2; 2.06A {Thermotoga maritima} Back     alignment and structure
>2ood_A BLR3880 protein; PSI-II, PSI-2, guanine deaminase, guanine, structural genomics, protein structure initiative; HET: GUN; 2.62A {Bradyrhizobium japonicum} SCOP: b.92.1.4 c.1.9.9 Back     alignment and structure
>3be7_A Zn-dependent arginine carboxypeptidase; unknown source, amidohydrolase, sargasso SEA, structural GEN protein structure initiative, PSI; HET: ARG; 2.30A {Unidentified} SCOP: b.92.1.9 c.1.9.18 PDB: 3dug_A* Back     alignment and structure
>2r8c_A Putative amidohydrolase; unknown source, sargasso SEA, structural genomics, protein structure initiative, PSI; 2.31A {Unidentified} PDB: 3mkv_A* Back     alignment and structure
>3gip_A N-acyl-D-glutamate deacylase; amidohydrolase family, hydrolase; 1.50A {Bordetella bronchiseptica} PDB: 3giq_A* Back     alignment and structure
>2vun_A Enamidase; nicotinate degradation, binuclear metal center, amidohydrolases, stereospecificity, hydrolase; 1.89A {Eubacterium barkeri} Back     alignment and structure
>2qt3_A N-isopropylammelide isopropyl amidohydrolase; N-isopropylammelide isopropylaminohydrolase ATZC, structural genomics, NYSGXRC, target 9364B; 2.24A {Pseudomonas SP} Back     alignment and structure
>2gwn_A Dihydroorotase; zinc-binding prote structural genomics, PSI, protein structure initiative, MID center for structural genomics, MCSG; HET: KCX GOL; 1.85A {Porphyromonas gingivalis} Back     alignment and structure
>1nfg_A D-hydantoinase; TIM barrel, hydrolase; HET: KCX; 2.70A {Ralstonia pickettii} SCOP: b.92.1.3 c.1.9.6 Back     alignment and structure
>2paj_A Putative cytosine/guanine deaminase; NYSGXRC, PSI-II, amidohydrolase, sargasso SEA, enviro sample, structural genomics; 2.70A {Unidentified} SCOP: b.92.1.4 c.1.9.9 Back     alignment and structure
>1p1m_A Hypothetical protein TM0936; putative metal dependent hydrolase, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: b.92.1.4 c.1.9.9 PDB: 2plm_A* 1j6p_A Back     alignment and structure
>3dc8_A Dihydropyrimidinase; TIM-barrel, hydrolase; HET: KCX; 1.85A {Sinorhizobium meliloti} Back     alignment and structure
>1ra0_A Cytosine deaminase; alpha-beta barrel, hexamer, conformation change, D314G mutant, hydrolase; 1.12A {Escherichia coli} SCOP: b.92.1.2 c.1.9.5 PDB: 1r9x_A 1ra5_A 1r9y_A 1r9z_A 1rak_A 3r0d_A* 3o7u_A* 3rn6_A* 1k6w_A 1k70_A 3g77_A Back     alignment and structure
>2vm8_A Dihydropyrimidinase-related protein 2; neurogenesis, phosphoprotein, differentiation, CRMP, cytoplasm, TIM barrel, polymorphism, axonal pathfinding; 1.9A {Homo sapiens} PDB: 2gse_A 1kcx_A Back     alignment and structure
>3icj_A Uncharacterized metal-dependent hydrolase; structural genomics, amidohydrolase, PSI-2, protein structur initiative; HET: KCX; 1.95A {Pyrococcus furiosus} PDB: 3etk_A* 3igh_X* Back     alignment and structure
>3mdu_A N-formimino-L-glutamate iminohydrolase; amonohydralase family, N-formimino-L-glutamate iminohydrolas guanidino-L-glutamate; HET: NGQ; 1.40A {Pseudomonas aeruginosa} PDB: 3mdw_A* Back     alignment and structure
>2q09_A Imidazolonepropionase; 9252H, NYSGXRC, 3-(2, 5-dioxo-imidazo 4YL)-propionic acid, PSI-2 community, structural genomics, structure initiative; HET: DI6; 1.97A {Unidentified} SCOP: b.92.1.10 c.1.9.17 PDB: 2oof_A* Back     alignment and structure
>2p9b_A Possible prolidase; protein structure initiative II, PSI-2, amidohydrolase, structural genomics; 1.70A {Bifidobacterium longum NCC2705} SCOP: b.92.1.10 c.1.9.17 Back     alignment and structure
>4ubp_C Protein (urease (chain C)); bacillus pasteurii, nickel, acetohydroxamic acid, metalloenzyme, hydrolase; HET: KCX; 1.55A {Sporosarcina pasteurii} SCOP: b.92.1.1 c.1.9.2 PDB: 1s3t_C* 2ubp_C* 3ubp_C* 1ubp_C* 1ie7_C* Back     alignment and structure
>4ac7_C Urease subunit alpha; hydrolase, bacillus pasteurii; HET: CXM KCX FLC; 1.50A {Sporosarcina pasteurii} PDB: 1s3t_C* 2ubp_C* 3ubp_C* 1ubp_C* 4ubp_C* 1ie7_C* Back     alignment and structure
>1e9y_B Urease subunit beta; hydrolase, dodecamer; HET: KCX; 3.00A {Helicobacter pylori} SCOP: b.92.1.1 c.1.9.2 PDB: 1e9z_B* 3qga_C* 3qgk_C* Back     alignment and structure
>1gkp_A Hydantoinase; hydrolase, dihydropyrimidinase, cyclic amidase; HET: KCX EPE; 1.29A {Thermus SP} SCOP: b.92.1.3 c.1.9.6 PDB: 1gkq_A* Back     alignment and structure
>2ftw_A Dihydropyrimidine amidohydrolase; (beta-alpha)8-barrel, beta-sandwich; HET: KCX; 2.05A {Dictyostelium discoideum} SCOP: b.92.1.3 c.1.9.6 Back     alignment and structure
>2imr_A Hypothetical protein DR_0824; zinc, NYSGXRC, PSI2, structural genomics, protein structure initiative; 1.78A {Deinococcus radiodurans} SCOP: b.92.1.11 c.1.9.16 Back     alignment and structure
>2vr2_A Dihydropyrimidinase; hydantoinase, metal-binding, disease mutation, dihydropyrimi amidohydrolase, nucleotide metabolism, DPYS, dhpase, hydrolase; 2.80A {Homo sapiens} Back     alignment and structure
>1v77_A PH1877P, hypothetical protein PH1877; RNAse P protein, TIM-barrel, RNA binding protein; 1.80A {Pyrococcus horikoshii} SCOP: c.6.3.2 PDB: 2czv_A* Back     alignment and structure
>1xrt_A Dihydroorotase, dhoase; amidohydrolase, metalloenzyme, pyrimidine; 1.61A {Aquifex aeolicus} SCOP: b.92.1.3 c.1.9.6 PDB: 1xrf_A 3d6n_A* Back     alignment and structure
>3v7p_A Amidohydrolase family protein; iron binding site, enzyme functio initiative, EFI; HET: TLA; 1.35A {Nitratiruptor SP} Back     alignment and structure
>2pgf_A Adenosine deaminase; metallo-dependent hydrolase, structural genomics, medical ST genomics of pathogenic protozoa consortium, MSGPP; HET: MSE ADN; 1.89A {Plasmodium vivax} PDB: 2pgr_A* 2qvn_A* 3ewc_A* 3ewd_A* 2amx_A Back     alignment and structure
>1onw_A Isoaspartyl dipeptidase; amidohydrolase, hydrolase, metalloprotease; HET: KCX; 1.65A {Escherichia coli} SCOP: b.92.1.7 c.1.9.13 PDB: 1onx_A* 1po9_A* 1poj_A* 1pok_B* 2aqo_A* 1ybq_A* 2aqv_A* Back     alignment and structure
>1o12_A N-acetylglucosamine-6-phosphate deacetylase; structural genomics, TM0814, JCSG, PSI, protein structure initiative; 2.50A {Thermotoga maritima} SCOP: b.92.1.5 c.1.9.10 Back     alignment and structure
>3rys_A Adenosine deaminase 1; SGX, hydrolase; HET: ADE; 2.60A {Arthrobacter aurescens} SCOP: c.1.9.0 Back     alignment and structure
>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>3fkr_A L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family, complex, pyruvate, lyase; HET: KPI; 1.80A {Azospirillum brasilense} PDB: 3fkk_A Back     alignment and structure
>2qee_A BH0493 protein; amidohydrolase, structural genomics, PSI-2, protein structure initiative; 1.65A {Bacillus halodurans c-125} PDB: 3hka_A* 2q6e_A 3hk5_A* 3hk7_A* 3hk8_A* 3hk9_A* 2q08_A* 2pnk_A* Back     alignment and structure
>3pao_A Adenosine deaminase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; HET: ADE; 2.49A {Pseudomonas aeruginosa} PDB: 3pan_A* 3ou8_A* 3pbm_A* Back     alignment and structure
>3iar_A Adenosine deaminase; purine metabolism structural genomics, structural genomics consortium, SGC, D mutation, hereditary hemolytic anemia, hydrolase; HET: 3D1; 1.52A {Homo sapiens} SCOP: c.1.9.1 PDB: 2bgn_E* 1w1i_E* 1qxl_A* 1krm_A* 1vfl_A 1ndv_A* 1ndy_A* 1ndz_A* 1o5r_A* 1uml_A* 1v79_A* 1v7a_A* 1ndw_A 1wxy_A* 1wxz_A* 2e1w_A* 2z7g_A* 2ada_A* 3mvi_A 1a4l_A* ... Back     alignment and structure
>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae} Back     alignment and structure
>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.1.10.0 PDB: 3ler_A* Back     alignment and structure
>3daq_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, diaminopimelate biosynthesis, lyase, schiff B; 1.45A {Staphylococcus aureus} SCOP: c.1.10.0 PDB: 3di1_A 3di0_A Back     alignment and structure
>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>3dz1_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2, structural genomics; 1.87A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A Back     alignment and structure
>3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa} Back     alignment and structure
>3tva_A Xylose isomerase domain protein TIM barrel; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.15A {Planctomyces limnophilus} Back     alignment and structure
>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} SCOP: c.1.10.0 Back     alignment and structure
>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A Back     alignment and structure
>3p6l_A Sugar phosphate isomerase/epimerase; TIM barrel, structural genomics, joint center for structural genomics, JCSG; HET: CIT; 1.85A {Parabacteroides distasonis} Back     alignment and structure
>3tak_A DHDPS, dihydrodipicolinate synthase; TIM barrel, lysine biosynthesis, pyruvate, lyase; 1.42A {Acinetobacter baumannii} PDB: 3pud_A* 3pue_A* 3pul_A 3rk8_A 3tce_A* 3tdf_A 3u8g_A 3uqn_A 4dxv_A Back     alignment and structure
>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A Back     alignment and structure
>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A* Back     alignment and structure
>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} SCOP: c.1.10.0 PDB: 3s5n_A Back     alignment and structure
>4f0l_A Amidohydrolase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.05A {Brucella melitensis biovar abortus} Back     alignment and structure
>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A Back     alignment and structure
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Back     alignment and structure
>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A* Back     alignment and structure
>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3qfe_A Putative dihydrodipicolinate synthase family PROT; seattle structural genomics center for infectious disease, S coccidioides, valley fever; 2.35A {Coccidioides immitis} Back     alignment and structure
>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>1k77_A EC1530, hypothetical protein YGBM; TIM barrel, structural genomics, PSI, structure initiative; 1.63A {Escherichia coli} SCOP: c.1.15.5 Back     alignment and structure
>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831} Back     alignment and structure
>3e96_A Dihydrodipicolinate synthase; structural genomics, nysgrc, target 9375C, operon, PSI-2; 1.80A {Bacillus clausii ksm-k16} SCOP: c.1.10.0 Back     alignment and structure
>3kws_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 1.68A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>2q02_A Putative cytoplasmic protein; structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.40A {Salmonella typhimurium LT2} SCOP: c.1.15.4 Back     alignment and structure
>3lmz_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS isomerase; HET: MSE CIT PGE; 1.44A {Parabacteroides distasonis} Back     alignment and structure
>2ojp_A DHDPS, dihydrodipicolinate synthase; dimer, lysine biosynthe lyase; HET: KGC GOL; 1.70A {Escherichia coli} PDB: 1yxc_A 1dhp_A 1yxd_A* 2ats_A* 3du0_A* 3c0j_A* 3ubs_A* 4eou_A* 3i7q_A* 3i7r_A* 3i7s_A* 2pur_A* 1s5v_A 1s5w_A 1s5t_A 3den_A* 2a6l_A 2a6n_A 3g0s_A Back     alignment and structure
>3ngf_A AP endonuclease, family 2; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 1.80A {Brucella melitensis biovar abortus} SCOP: c.1.15.0 Back     alignment and structure
>4dpp_A DHDPS 2, dihydrodipicolinate synthase 2, chloroplastic; amino-acid biosynthesis, (S)-lysine biosynthesis VIA DAP PAT (beta/alpha)8-barrel; 2.00A {Arabidopsis thaliana} PDB: 4dpq_A* 3tuu_A* Back     alignment and structure
>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>3h5d_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, schiff base, cytoplasm, diaminopimelate biosy lyase; HET: MES; 1.99A {Streptococcus pneumoniae} Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Back     alignment and structure
>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis} Back     alignment and structure
>2hmc_A AGR_L_411P, dihydrodipicolinate synthase; alpha-beta barrel (TIM barrel), structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>1i60_A IOLI protein; beta barrel, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Bacillus subtilis} SCOP: c.1.15.4 PDB: 1i6n_A Back     alignment and structure
>3a5f_A Dihydrodipicolinate synthase; TIM barrel, enzyme, amino-acid biosynthesis, cytoplasm, diaminopimelate biosynthesis, lyase; HET: KPI; 1.19A {Clostridium botulinum A} PDB: 3bi8_A* 3ird_A* Back     alignment and structure
>3iv8_A N-acetylglucosamine-6-phosphate deacetylase; IDP01334, fruct phosphate, carbohydrate metabolism, hydrolase; HET: F6P; 2.53A {Vibrio cholerae} PDB: 3egj_A* Back     alignment and structure
>3eb2_A Putative dihydrodipicolinate synthetase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2., structural genomics; HET: PGE; 2.04A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>1rk6_A D-aminoacylase; TIM barrel, beta barrel, insertion, hydrolase; 1.43A {Alcaligenes faecalis} SCOP: b.92.1.6 b.92.1.6 c.1.9.11 PDB: 1rjp_A 1v51_A 1rjq_A 1rjr_A 1rk5_A 1v4y_A 1m7j_A Back     alignment and structure
>4gy7_A Urease; JACK bean, hydrolase, ME binding, nickel; HET: CME KCX; 1.49A {Canavalia ensiformis} PDB: 3la4_A* 4h9m_A* Back     alignment and structure
>3dx5_A Uncharacterized protein ASBF; beta-alpha barrel, petrobactin synthesis, ASB locus, structu genomics, PSI-2, protein structure initiative; HET: MSE DHB TRS; 2.12A {Bacillus anthracis} Back     alignment and structure
>1w3i_A EDA, 2-keto-3-deoxy gluconate aldolase; archaeal metabolism, pyruvate; 1.7A {Sulfolobus solfataricus} SCOP: c.1.10.1 PDB: 1w37_A 1w3n_A* 1w3t_A* 2yda_A* Back     alignment and structure
>2r91_A 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM barrel, thermophilic, lyase; 2.00A {Thermoproteus tenax} PDB: 2r94_A Back     alignment and structure
>3ayv_A Putative uncharacterized protein TTHB071; structural genomics, riken structural genomics/proteomics in RSGI, TIM barrel, unknown function; 1.85A {Thermus thermophilus} PDB: 3ayt_A Back     alignment and structure
>2nuw_A 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho aldolase; TIM barrel, lyase; 1.80A {Sulfolobus acidocaldarius dsm 639} PDB: 2nux_A 2nuy_A Back     alignment and structure
>2qul_A D-tagatose 3-epimerase; beta/alpha barrel, isomerase; 1.79A {Pseudomonas cichorii} PDB: 2ou4_A 2qum_A* 2qun_A* Back     alignment and structure
>2hk0_A D-psicose 3-epimerase; TIM-barrel, isomerase; 2.00A {Agrobacterium tumefaciens} PDB: 2hk1_A* Back     alignment and structure
>3cqj_A L-ribulose-5-phosphate 3-epimerase ULAE; TIM-barrel, isomerase, phosphate-binding motif; 2.04A {Escherichia coli} PDB: 3cqi_A 3cqh_A 3cqk_A Back     alignment and structure
>3qc0_A Sugar isomerase; TIM barrel, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-biology,; HET: UNL PG4; 1.45A {Sinorhizobium meliloti} PDB: 3ju2_A Back     alignment and structure
>2pcq_A Putative dihydrodipicolinate synthase; lyase, lysine biosynthesis, dihydrodipicoliante, S genomics, NPPSFA; 2.10A {Thermus thermophilus} Back     alignment and structure
>3vni_A Xylose isomerase domain protein TIM barrel; D-psicose 3-epimerase, ketohexose; 1.98A {Clostridium cellulolyticum} PDB: 3vnj_A* 3vnl_A* 3vnk_A* 3vnm_A* Back     alignment and structure
>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A Back     alignment and structure
>1yx1_A Hypothetical protein PA2260; structural genomics, PSI, PROT structure initiative; HET: MSE; 1.80A {Pseudomonas aeruginosa PAO1} SCOP: c.1.15.7 Back     alignment and structure
>3aam_A Endonuclease IV, endoiv; DNA repair, base excision repair, BER, TIM barrel, endonucle hydrolase, structural genomics, NPPSFA; 1.58A {Thermus thermophilus} Back     alignment and structure
>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A Back     alignment and structure
>3eb2_A Putative dihydrodipicolinate synthetase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2., structural genomics; HET: PGE; 2.04A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>3e96_A Dihydrodipicolinate synthase; structural genomics, nysgrc, target 9375C, operon, PSI-2; 1.80A {Bacillus clausii ksm-k16} SCOP: c.1.10.0 Back     alignment and structure
>2bb0_A Imidazolonepropionase; TIM barrel, hydrolase; 2.00A {Bacillus subtilis} SCOP: b.92.1.10 c.1.9.17 PDB: 2g3f_A Back     alignment and structure
>2puz_A Imidazolonepropionase; NYSGXRC, PSI-2, N-formimino-L- glutamate, product-bound, structural genomics, protein STRU initiative; HET: NIG; 1.83A {Agrobacterium tumefaciens str} SCOP: b.92.1.10 c.1.9.17 PDB: 2gok_A Back     alignment and structure
>3iac_A Glucuronate isomerase; IDP02065, structural genom center for structural genomics of infectious diseases, CSGI; 2.22A {Salmonella typhimurium} SCOP: c.1.9.0 Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 342
d2ffia1271 c.1.9.15 (A:10-280) Putative 2-pyrone-4,6-dicarbox 2e-29
d2f6ka1306 c.1.9.15 (A:2-307) Putative amidohydrolase LP2961 7e-19
d2gwga1342 c.1.9.15 (A:1-342) 4-oxalomesaconate hydratase Lig 9e-15
d2dvta1325 c.1.9.15 (A:1-325) Thermophilic reversible gamma-r 6e-13
d1i0da_331 c.1.9.3 (A:) Phosphotriesterase (parathion hydrola 1e-09
d1bf6a_291 c.1.9.3 (A:) Phosphotriesterase homology protein { 3e-09
d2hbva1331 c.1.9.15 (A:3-333) 2-amino-3-carboxymuconate 6-sem 1e-08
>d2ffia1 c.1.9.15 (A:10-280) Putative 2-pyrone-4,6-dicarboxylic acid hydrolase PP1699 {Pseudomonas putida [TaxId: 303]} Length = 271 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Metallo-dependent hydrolases
family: PP1699/LP2961-like
domain: Putative 2-pyrone-4,6-dicarboxylic acid hydrolase PP1699
species: Pseudomonas putida [TaxId: 303]

 Score =  111 bits (278), Expect = 2e-29
 Identities = 54/282 (19%), Positives = 98/282 (34%), Gaps = 17/282 (6%)

Query: 60  VKIIDSHLHVWASPEEAADKFPYFPGQEPTLPGHVDFLLQCMEEASVDGALIVQPINHKF 119
           +  IDSH HV++     A +  Y P  +  L       L  +        ++VQP     
Sbjct: 3   LTAIDSHAHVFSRGLNLASQRRYAPNYDAPL----GDYLGQLRAHGFSHGVLVQPSFLGT 58

Query: 120 DHSLVTSVLKKYPSKFVGCCLANPAEDVIGIKQLEQLILKDGFRAVRFNPYLWPSGQQMT 179
           D+  + S L+  P +  G  +     +   + ++ +L ++           +      +T
Sbjct: 59  DNRYLLSALQTVPGQLRGVVMLERDVEQATLAEMARLGVRGV-----RLNLMGQDMPDLT 113

Query: 180 NEVGKAMFSKAGELGVPVGFMCMKGLNLHISEIEELCTEFPSTTVLLDHLAFCKPPSNDE 239
               + +  + GE G  V           I  +      +    V+              
Sbjct: 114 GAQWRPLLERIGEQGWHVELHRQVA---DIPVLVRALQPYGLDIVIDHF--GRPDARRGL 168

Query: 240 ESLAFSNLLKLSRFPQVYVKFSALFRVSRMPFP-YQDLSSPLSQVVSSFGANRVMWGSDF 298
               F+ LL LS   +V+VK S ++R+   P          L  + + +GA R+MWGSD+
Sbjct: 169 GQPGFAELLTLSGRGKVWVKVSGIYRLQGSPEENLAFARQALCALEAHYGAERLMWGSDW 228

Query: 299 PYVVPECGYKGGREAASLIANEVPLSPSELEWIMGGTIMQLF 340
           P+   E     G          +  S    + ++  T   LF
Sbjct: 229 PHTQHESEVSFGSAVEQF--EALGCSAQLRQALLLDTARALF 268
>d2f6ka1 c.1.9.15 (A:2-307) Putative amidohydrolase LP2961 {Lactobacillus plantarum [TaxId: 1590]} Length = 306 Back     information, alignment and structure
>d2gwga1 c.1.9.15 (A:1-342) 4-oxalomesaconate hydratase LigJ {Rhodopseudomonas palustris [TaxId: 1076]} Length = 342 Back     information, alignment and structure
>d2dvta1 c.1.9.15 (A:1-325) Thermophilic reversible gamma-resorcylate decarboxylase {Rhizobium sp. MTP-10005 [TaxId: 267998]} Length = 325 Back     information, alignment and structure
>d1i0da_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Pseudomonas diminuta [TaxId: 293]} Length = 331 Back     information, alignment and structure
>d1bf6a_ c.1.9.3 (A:) Phosphotriesterase homology protein {Escherichia coli [TaxId: 562]} Length = 291 Back     information, alignment and structure
>d2hbva1 c.1.9.15 (A:3-333) 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase NbaD {Pseudomonas fluorescens [TaxId: 294]} Length = 331 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query342
d2f6ka1306 Putative amidohydrolase LP2961 {Lactobacillus plan 100.0
d2dvta1325 Thermophilic reversible gamma-resorcylate decarbox 100.0
d2gwga1342 4-oxalomesaconate hydratase LigJ {Rhodopseudomonas 100.0
d2hbva1331 2-amino-3-carboxymuconate 6-semialdehyde decarboxy 100.0
d2ffia1271 Putative 2-pyrone-4,6-dicarboxylic acid hydrolase 100.0
d1yixa1265 Putative deoxyribonuclease YcfH {Escherichia coli 99.9
d1zzma1259 Putative deoxyribonuclease YjjV {Escherichia coli 99.89
d1j6oa_260 Hypothetical protein TM0667 {Thermotoga maritima [ 99.89
d1bf6a_291 Phosphotriesterase homology protein {Escherichia c 99.87
d1xwya1260 Deoxyribonuclease TatD (MttC) {Escherichia coli [T 99.86
d1i0da_331 Phosphotriesterase (parathion hydrolase, PTE) {Pse 99.68
d2ftwa2334 Dihydropyrimidine amidohydrolase Pyd2 {Dictyosteli 98.53
d1ynya2332 D-hydantoinase {Bacillus sp. AR9 [TaxId: 301298]} 98.5
d2qeec1415 Uncharacterized protein BH0493 {Bacillus haloduran 98.48
d1itua_369 Renal dipeptidase {Human (Homo sapiens) [TaxId: 96 98.44
d1nfga2330 D-hydantoinase {Burkholderia pickettii [TaxId: 329 98.39
d1kcxa2334 Dihydropyrimidinase related protein-1 {Mouse (Mus 98.38
d1xrta2310 Two-domain dihydroorotase {Aquifex aeolicus [TaxId 98.26
d1j5sa_451 Uronate isomerase TM0064 {Thermotoga maritima [Tax 98.21
d1gkpa2335 D-hydantoinase {Thermus sp. [TaxId: 275]} 98.21
d1gkra2325 L-hydantoinase {Arthrobacter aurescens [TaxId: 436 97.96
d2fvka2384 Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Sacc 97.74
d1p1ma2281 Hypothetical protein TM0936, probable catalytic do 97.45
d1ejxc2 385 alpha-subunit of urease, catalytic domain {Klebsie 97.15
d2i9ua2310 Guanine deaminase {Clostridium acetobutylicum [Tax 97.12
d4ubpc2 390 alpha-subunit of urease, catalytic domain {Bacillu 97.1
d1e9yb2 389 alpha-subunit of urease, catalytic domain {Helicob 97.02
d1onwa2284 Isoaspartyl dipeptidase, catalytic domain {Escheri 95.71
d1o5ka_295 Dihydrodipicolinate synthase {Thermotoga maritima 95.06
d1a4ma_349 Adenosine deaminase (ADA) {Mouse (Mus musculus) [T 94.7
d2imra2308 Hypothetical protein DR0824 {Deinococcus radiodura 94.36
d1m7ja3358 N-acyl-D-aminoacid amidohydrolase, catalytic domai 94.1
d1ra0a2320 Cytosine deaminase catalytic domain {Escherichia c 93.97
d2amxa1357 Adenosine deaminase (ADA) {Plasmodium yoelii [TaxI 93.63
d2icsa2267 Putative adenine deaminase EF0837 {Enterococcus fa 93.41
d1xkya1292 Dihydrodipicolinate synthase {Bacillus anthracis [ 92.96
d1xxxa1296 Dihydrodipicolinate synthase {Mycobacterium tuberc 92.71
d2a6na1292 Dihydrodipicolinate synthase {Escherichia coli [Ta 92.26
d1i60a_278 Hypothetical protein IolI {Bacillus subtilis [TaxI 90.64
d2paja2336 Hypothetical protein GOS_1943094 {Environmental sa 90.25
d1f74a_293 N-acetylneuraminate lyase {Haemophilus influenzae 90.16
d1hl2a_295 N-acetylneuraminate lyase {Escherichia coli [TaxId 87.84
d1yx1a1250 Hypothetical protein PA2260 {Pseudomonas aeruginos 87.62
d2eg6a1343 Dihydroorotase {Escherichia coli [TaxId: 562]} 86.75
d2uz9a2313 Guanine deaminase {Human (Homo sapiens) [TaxId: 96 86.67
d2q02a1271 Putative cytoplasmic protein STM4435 {Salmonella t 81.37
d1f74a_293 N-acetylneuraminate lyase {Haemophilus influenzae 80.56
>d2f6ka1 c.1.9.15 (A:2-307) Putative amidohydrolase LP2961 {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Metallo-dependent hydrolases
family: PP1699/LP2961-like
domain: Putative amidohydrolase LP2961
species: Lactobacillus plantarum [TaxId: 1590]

Probab=100.00  E-value=2.3e-42  Score=318.87  Aligned_cols=264  Identities=15%  Similarity=0.163  Sum_probs=188.3

Q ss_pred             eeeeeeeccCCCCc--cCCCCCCCCCCCCCCCCChHHHHHHhHHCCCceEEEeCCC--CC-----------ccchHHHHH
Q 019335           62 IIDSHLHVWASPEE--AADKFPYFPGQEPTLPGHVDFLLQCMEEASVDGALIVQPI--NH-----------KFDHSLVTS  126 (342)
Q Consensus        62 iID~H~Hl~~~~~~--~~~~~p~~~~~~~~~~~~~~~ll~~md~~GI~~~v~~~~~--~~-----------~~~N~~~~~  126 (342)
                      .||+|+|++.++-.  ....++-.....+....+++.+++.||+.||+++|+..+.  ..           +..|+++.+
T Consensus         2 kID~H~H~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~Md~~GI~~avl~~~~p~~~~~~~~~~~~~~~~~Nd~~~~   81 (306)
T d2f6ka1           2 KIDFHTHYLPTSYVEALKRHVPGDPDGWPTPEWTPQLTLNFMRDNDISYSILSLSSPHVNFGDKAETIRLVEAANDDGKS   81 (306)
T ss_dssp             EEEEEEECCCHHHHHHHHHHCCSSGGGSCCCCCCHHHHHHHHHHTTEEEEEEECCSSCSCSSCHHHHHHHHHHHHHHHHH
T ss_pred             cEEEecCCCCHHHHHHHHHhcCCCCCCCcCCCCCHHHHHHHHHHcCCCEEEEcCCCcccccCCHHHHHHHHHHHHHHHHH
Confidence            49999999843100  0000111011112234689999999999999999984322  11           124999999


Q ss_pred             HHHhCCCcEEEEEEcCCCCcchHHHHHHHHHhcCCceEEEecCCCCCCCCcCCcHHHHHHHHHHhhhCCeEEEEeccCCC
Q 019335          127 VLKKYPSKFVGCCLANPAEDVIGIKQLEQLILKDGFRAVRFNPYLWPSGQQMTNEVGKAMFSKAGELGVPVGFMCMKGLN  206 (342)
Q Consensus       127 ~~~~~p~r~~g~~~i~p~~~~~~~~eler~~~~~g~~Gvk~~~~~~~~g~~l~~~~~~~~~~~a~e~~lpv~iH~~~~~~  206 (342)
                      ++++||+||+|++.+++.+++++++||+|++++.|++|+++++..  .|..++++.++|+|++|+|+|+||.+|.+.+..
T Consensus        82 ~~~~~P~Rf~~~a~vp~~~~~~a~~el~r~~~~~G~~Gi~~~~~~--~~~~~~dp~~~pi~~~~~e~~lpv~~H~~~~~~  159 (306)
T d2f6ka1          82 LAQQYPDQLGYLASLPIPYELDAVKTVQQALDQDGALGVTVPTNS--RGLYFGSPVLERVYQELDARQAIVALHPNEPAI  159 (306)
T ss_dssp             HHHHCTTTEEEEECCCTTCHHHHHHHHHHHHHTSCCSEEEEESEE--TTEETTCGGGHHHHHHHHTTTCEEEEECCCCSC
T ss_pred             HHHHCCCeEEEEeecccchhhHHHHHHHHHHhcccceEEEecCcc--ccccCCCccchHHHHHHHHcCCceEeccCCCCC
Confidence            999999999999999999888899999999889999999998764  367899999999999999999999999764310


Q ss_pred             -------C-CHH---------------HHHHHHHhCCCCcEEecccCCCCCCCCchhhHhHHHHhc---ccCCCcEEEec
Q 019335          207 -------L-HIS---------------EIEELCTEFPSTTVLLDHLAFCKPPSNDEESLAFSNLLK---LSRFPQVYVKF  260 (342)
Q Consensus       207 -------~-~~~---------------~l~~l~~~~P~lk~vl~H~G~~~p~~~~~~~~~~~~~~~---l~~~~Nvy~~~  260 (342)
                             . ...               .+.++++|||+||||++|+|+..|...++....+.....   ....+|+|+|+
T Consensus       160 ~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~v~~rfP~l~~v~~H~Gg~~p~~~~r~~~~~~~~~~~~~~~~~~n~y~d~  239 (306)
T d2f6ka1         160 LPKNVDIDLPVPLLGFFMDTTMTFINMLKYHFFEKYPNIKVIIPHAGAFLGIVDDRIAQYAQKVYQVDVYDVMHHVYFDV  239 (306)
T ss_dssp             CCTTSSTTCCHHHHHHHHHHHHHHHHHHHTTHHHHCTTCEEEESGGGTTHHHHHHHHHHHHHHHHCCCHHHHHHHSEEEC
T ss_pred             CcccccccCccchhhhhHHHHHHHHHHHHhhhhhhccCceEEEeeccccchhHHhhhhhhhhccchhhHHHHhccceeee
Confidence                   0 000               234588999999999999997544322111111111111   12357999999


Q ss_pred             CcccccccCCCCCCCchhHHHHHHHhcCCCcEEEccCCCCCCCCCChHhHHHHHHHHHhcCCCCHHHHHHHHhHHHHHhc
Q 019335          261 SALFRVSRMPFPYQDLSSPLSQVVSSFGANRVMWGSDFPYVVPECGYKGGREAASLIANEVPLSPSELEWIMGGTIMQLF  340 (342)
Q Consensus       261 S~~~~~~~~~~~~~~~~~~l~~~i~~~G~dRilfGSD~P~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~I~~~NA~rl~  340 (342)
                      |+.+.           .+.++.+++.+|+||||||||||+.... .....   ...+.....|+++++++|+++||+|||
T Consensus       240 s~~~~-----------~~~l~~~i~~~G~drilfGSD~P~~~~~-~~~~~---~~~~~~~~~l~~~~~~~Il~~NA~rll  304 (306)
T d2f6ka1         240 AGAVL-----------PRQLPTLMSLAQPEHLLYGSDIPYTPLD-GSRQL---GHALATTDLLTNEQKQAIFYDNAHRLL  304 (306)
T ss_dssp             CSSCT-----------TTHHHHHTTTSCGGGEECCCCTTTSCHH-HHHHH---HHHHHHCTTSCHHHHHHHHTHHHHHHH
T ss_pred             cccCC-----------HHHHHHHHHhcCCCeEEEeCCCCCCCCc-cchhH---HHHHHhcCCCCHHHHHHHHhHHHHHHh
Confidence            87532           1468899999999999999999996432 11222   222223346999999999999999999


Q ss_pred             CC
Q 019335          341 QD  342 (342)
Q Consensus       341 ~~  342 (342)
                      |.
T Consensus       305 g~  306 (306)
T d2f6ka1         305 TE  306 (306)
T ss_dssp             HC
T ss_pred             Cc
Confidence            73
>d2dvta1 c.1.9.15 (A:1-325) Thermophilic reversible gamma-resorcylate decarboxylase {Rhizobium sp. MTP-10005 [TaxId: 267998]} Back     information, alignment and structure
>d2gwga1 c.1.9.15 (A:1-342) 4-oxalomesaconate hydratase LigJ {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d2hbva1 c.1.9.15 (A:3-333) 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase NbaD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2ffia1 c.1.9.15 (A:10-280) Putative 2-pyrone-4,6-dicarboxylic acid hydrolase PP1699 {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1yixa1 c.1.9.12 (A:1-265) Putative deoxyribonuclease YcfH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zzma1 c.1.9.12 (A:1-259) Putative deoxyribonuclease YjjV {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j6oa_ c.1.9.12 (A:) Hypothetical protein TM0667 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1bf6a_ c.1.9.3 (A:) Phosphotriesterase homology protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xwya1 c.1.9.12 (A:1-260) Deoxyribonuclease TatD (MttC) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i0da_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Pseudomonas diminuta [TaxId: 293]} Back     information, alignment and structure
>d2ftwa2 c.1.9.6 (A:60-393) Dihydropyrimidine amidohydrolase Pyd2 {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1ynya2 c.1.9.6 (A:53-384) D-hydantoinase {Bacillus sp. AR9 [TaxId: 301298]} Back     information, alignment and structure
>d2qeec1 c.1.9.8 (C:2-416) Uncharacterized protein BH0493 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1itua_ c.1.9.7 (A:) Renal dipeptidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nfga2 c.1.9.6 (A:52-381) D-hydantoinase {Burkholderia pickettii [TaxId: 329]} Back     information, alignment and structure
>d1kcxa2 c.1.9.6 (A:67-400) Dihydropyrimidinase related protein-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xrta2 c.1.9.6 (A:56-365) Two-domain dihydroorotase {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1j5sa_ c.1.9.8 (A:) Uronate isomerase TM0064 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gkpa2 c.1.9.6 (A:55-389) D-hydantoinase {Thermus sp. [TaxId: 275]} Back     information, alignment and structure
>d1gkra2 c.1.9.6 (A:55-379) L-hydantoinase {Arthrobacter aurescens [TaxId: 43663]} Back     information, alignment and structure
>d2fvka2 c.1.9.6 (A:57-440) Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Saccharomyces kluyveri) [TaxId: 4934]} Back     information, alignment and structure
>d1p1ma2 c.1.9.9 (A:50-330) Hypothetical protein TM0936, probable catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ejxc2 c.1.9.2 (C:1130-1422,C:1476-1567) alpha-subunit of urease, catalytic domain {Klebsiella aerogenes [TaxId: 28451]} Back     information, alignment and structure
>d2i9ua2 c.1.9.9 (A:67-376) Guanine deaminase {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d4ubpc2 c.1.9.2 (C:132-434,C:484-570) alpha-subunit of urease, catalytic domain {Bacillus pasteurii [TaxId: 1474]} Back     information, alignment and structure
>d1e9yb2 c.1.9.2 (B:132-431,B:481-569) alpha-subunit of urease, catalytic domain {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1onwa2 c.1.9.13 (A:63-346) Isoaspartyl dipeptidase, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a4ma_ c.1.9.1 (A:) Adenosine deaminase (ADA) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2imra2 c.1.9.16 (A:91-398) Hypothetical protein DR0824 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1m7ja3 c.1.9.11 (A:62-419) N-acyl-D-aminoacid amidohydrolase, catalytic domain {Alcaligenes faecalis [TaxId: 511]} Back     information, alignment and structure
>d1ra0a2 c.1.9.5 (A:56-375) Cytosine deaminase catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2amxa1 c.1.9.1 (A:20-376) Adenosine deaminase (ADA) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d2icsa2 c.1.9.14 (A:55-321) Putative adenine deaminase EF0837 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2a6na1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i60a_ c.1.15.4 (A:) Hypothetical protein IolI {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2paja2 c.1.9.9 (A:70-405) Hypothetical protein GOS_1943094 {Environmental samples} Back     information, alignment and structure
>d1f74a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1hl2a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yx1a1 c.1.15.7 (A:3-252) Hypothetical protein PA2260 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2eg6a1 c.1.9.4 (A:4-346) Dihydroorotase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2uz9a2 c.1.9.9 (A:76-388) Guanine deaminase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2q02a1 c.1.15.4 (A:1-271) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1f74a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure