Citrus Sinensis ID: 019353

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340--
MLLRRRTEAPKPNIHRPITYESPDDDDSRCEKCGSGDFPDELLLCDKCDKGFHLFCLRPILVSVPKGSWFCPSCSHHKRPKPFPLVQTKIIDFFRIQRSADLTQKLTPDNLRKRKRASGLVMSKKRRKLLPFNPTEDPERRLQQMASLATALRASGTEFTDELTYVTGMAPRSANSAVLEKGGMQVLSKEDIETLNLCKHMMNRGEWPPLMVEYDPKEGFTVQADRFIKDLTIITEYVGDVDYLNNRENDDGDSTMTLLHASNPAQSLVVCPYKHGNIARFVNGINNHTADGKKKQNLKCVRYNVNGECRVLLVANRDIAKGERLYYDYNGYEKEYPTEHFV
cccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHcccccccEEEcHHHHccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHcHHHHHHHHHHHHccccccEEEEEcccccEEEEEcccccccEEEEEEcccccccccccccccccEEEEcccccccccEEEcccccccccHHHcccccccccccccccEEEEEEEEcccEEEEEEEEEccccccEEEEEcccccccccccccc
ccccccccccccccccccccccccccccEEEEccccccccHEEEEcccccccEEEEccccccccccccccccHcccccccccccccHcHHHHEEEHHHcHHHHHHHHHHHcccccccccEEEEHcHHHHHEccccccccEEEEEcccccccccccccccccccccccccccccHcHHHHcccccccccHHcHHHHHHHHHHHHccccccEEEEEcccccEEEEEcccHcccEEEEEEcccHHHHHcccccccccHHHHHcccccccEEEEcccccccHHHHHcccccccccccccEcEEEEEEEccccEEEEEEEEcccccccEEEEEcccccccccccccc
mllrrrteapkpnihrpityespddddsrcekcgsgdfpdelllcdkcdkgfhlfclrpilvsvpkgswfcpscshhkrpkpfplvqtKIIDFFRIqrsadltqkltpdnlrkrkrasglvmskkrrkllpfnptedpERRLQQMASLATALRAsgteftdeltyvtgmaprsansavlekggmqvlskEDIETLNLCKHmmnrgewpplmveydpkegftvqADRFIKDLTIITEYvgdvdylnnrenddgdstmtllhasnpaqslvvcpykhgniarfvnginnhtadgkkkqnlkCVRYNVNGECRVLLVANRdiakgerlyydyngyekeyptehfv
mllrrrteapkpnihrpityespddddsrcEKCGSGDFPDELLLCDKCDKGFHLFCLRPILVSVPKGSWFCPSCSHHKRPKPFPLVQTKIIDFFriqrsadltqkltpdnlrkrkrasglvmskkrrkllpfnptedperRLQQMASLATALRASGTEFTDELTYVTGMAPRSANSAVLEKGGMQVLSKEDIETLNLCKHMMNRGEWPPLMVEYDPKEGFTVQADRFIKDLTIITEyvgdvdylNNRENDDGDSTMTLLHASNPAQSLVVCPYKHGNIARFVNGINnhtadgkkkqnlKCVRYNVNGECRVllvanrdiakgerLYYDyngyekeyptehfv
MLLRRRTEAPKPNIHRPITYESPDDDDSRCEKCGSGDFPDELLLCDKCDKGFHLFCLRPILVSVPKGSWFCPSCSHHKRPKPFPLVQTKIIDFFRIQRSADLTQKLTPDNLRKRKRASGLVMSKKRRKLLPFNPTEDPERRLQQMASLATALRASGTEFTDELTYVTGMAPRSANSAVLEKGGMQVLSKEDIETLNLCKHMMNRGEWPPLMVEYDPKEGFTVQADRFIKDLTIITEYVGDVDYLNNRENDDGDSTMTLLHASNPAQSLVVCPYKHGNIARFVNGINNHTADGKKKQNLKCVRYNVNGECRVLLVANRDIAKGERLYYDYNGYEKEYPTEHFV
***********************************GDFPDELLLCDKCDKGFHLFCLRPILVSVPKGSWFCPSCSHHKRPKPFPLVQTKIIDFFRIQRS***********************************************************FTDELTYVTGM*************GMQVLSKEDIETLNLCKHMMNRGEWPPLMVEYDPKEGFTVQADRFIKDLTIITEYVGDVDYLNN**********TLLHASNPAQSLVVCPYKHGNIARFVNGINNHTADGKKKQNLKCVRYNVNGECRVLLVANRDIAKGERLYYDYNGYEK********
************************DDDSRCEKCGSGDFPDELLLCDKCDKGFHLFCLRPILVSVPKGSWFCPSCSHHKRPK***************************************************************************TEFTDELTYVT****************************NLCKHMMNRGEWPPLMVEYDPKEGFTVQADRFIKDLTIITEYVGDVDYLNNRENDDGDSTMTLLHASNPAQSLVVCPYKHGNIARFVNGINN*********NLKCVRYNVNGECRVLLVANRDIAKGERLYYDYNGYEKEYP*****
********APKPNIHRPITYE*********EKCGSGDFPDELLLCDKCDKGFHLFCLRPILVSVPKGSWFCPSCSHHKRPKPFPLVQTKIIDFFRIQRSADLTQKLTPDNLRKRKRASGLVMSKKRRKLLPFNPTEDPERRLQQMASLATALRASGTEFTDELTYVTGMAPRSANSAVLEKGGMQVLSKEDIETLNLCKHMMNRGEWPPLMVEYDPKEGFTVQADRFIKDLTIITEYVGDVDYLNNRENDDGDSTMTLLHASNPAQSLVVCPYKHGNIARFVNGINNHTADGKKKQNLKCVRYNVNGECRVLLVANRDIAKGERLYYDYNGYEKEYPTEHFV
**********************PDDDDSRCEKCGSGDFPDELLLCDKCDKGFHLFCLRPILVSVPKGSWFCPSCSHHKRPKPFPLVQTKIIDFFRIQRSADLTQKLTPDNLRKRKRASGLVMSKKRRKLLPFNPTEDPERRLQQMASLATALRASGTEFTDELTYVTGMAPRSANSAVLEKGGMQVLSKEDIETLNLCKHMMNRGEWPPLMVEYDPKEGFTVQADRFIKDLTIITEYVGDVDYLNNRENDDGDSTMTLLHASNPAQSLVVCPYKHGNIARFVNGINNHTADGKKKQNLKCVRYNVNGECRVLLVANRDIAKGERLYYDYNGYEKEYP***F*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLRRRTEAPKPNIHRPITYESPDDDDSRCEKCGSGDFPDELLLCDKCDKGFHLFCLRPILVSVPKGSWFCPSCSHHKRPKPFPLVQTKIIDFFRIQRSADLTQKLTPDNLRKRKRASGLVMSKKRRKLLPFNPTEDPERRLQQMASLATALRASGTEFTDELTYVTGMAPRSANSAVLEKGGMQVLSKEDIETLNLCKHMMNRGEWPPLMVEYDPKEGFTVQADRFIKDLTIITEYVGDVDYLNNRENDDGDSTMTLLHASNPAQSLVVCPYKHGNIARFVNGINNHTADGKKKQNLKCVRYNVNGECRVLLVANRDIAKGERLYYDYNGYEKEYPTEHFV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query342 2.2.26 [Sep-21-2011]
Q9FNE9349 Histone-lysine N-methyltr yes no 0.991 0.971 0.712 1e-138
Q8VZJ1352 Histone-lysine N-methyltr no no 0.836 0.812 0.600 1e-107
Q96T23 1441 Remodeling and spacing fa yes no 0.152 0.036 0.557 1e-13
A8DZJ11441 Tyrosine-protein kinase B N/A no 0.143 0.034 0.510 3e-12
A2BIL71536 Tyrosine-protein kinase B no no 0.143 0.031 0.510 1e-11
Q9UIG01483 Tyrosine-protein kinase B no no 0.143 0.033 0.530 2e-11
Q9Z2771479 Tyrosine-protein kinase B no no 0.143 0.033 0.530 3e-11
A6H619 1682 PHD and RING finger domai no no 0.160 0.032 0.509 5e-11
Q9P1Y6 1649 PHD and RING finger domai no no 0.152 0.031 0.519 1e-10
Q9VMJ7 1838 Lysine-specific demethyla yes no 0.154 0.028 0.490 1e-10
>sp|Q9FNE9|ATXR6_ARATH Histone-lysine N-methyltransferase ATXR6 OS=Arabidopsis thaliana GN=ATXR6 PE=2 SV=1 Back     alignment and function desciption
 Score =  492 bits (1266), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 245/344 (71%), Positives = 287/344 (83%), Gaps = 5/344 (1%)

Query: 4   RRRTEAPKPNIHRP---ITYESPDDDDSRCEKCGSGDFPDELLLCDKCDKGFHLFCLRPI 60
           RRRT+A  P    P     ++S  D D+ CE+C SG  P +LLLCDKCDKGFHLFCLRPI
Sbjct: 6   RRRTQASNPRSEPPQHMSDHDSDSDWDTVCEECSSGKQPAKLLLCDKCDKGFHLFCLRPI 65

Query: 61  LVSVPKGSWFCPSCSHHKRPKPFPLVQTKIIDFFRIQRSADLTQKLTPDNLRKRKRA-SG 119
           LVSVPKGSWFCPSCS H+ PK FPL+QTKIIDFFRI+RS D +Q  +  +   +KR  + 
Sbjct: 66  LVSVPKGSWFCPSCSKHQIPKSFPLIQTKIIDFFRIKRSPDSSQISSSSDSIGKKRKKTS 125

Query: 120 LVMSKKRRKLLPFNPTEDPERRLQQMASLATALRASGTEFTDELTYVTGMAPRSANSAVL 179
           LVMSKK+R+LLP+NP+ DP+RRL+QMASLATALRAS T+F++ELTYV+G APRSAN A  
Sbjct: 126 LVMSKKKRRLLPYNPSNDPQRRLEQMASLATALRASNTKFSNELTYVSGKAPRSANQAAF 185

Query: 180 EKGGMQVLSKEDIETLNLCKHMMNRGEWPPLMVEYDPKEGFTVQADRFIKDLTIITEYVG 239
           EKGGMQVLSKE +ETL LCK MM+ GE PPLMV +DP EGFTV+ADRFIKD TIITEYVG
Sbjct: 186 EKGGMQVLSKEGVETLALCKKMMDLGECPPLMVVFDPYEGFTVEADRFIKDWTIITEYVG 245

Query: 240 DVDYLNNREND-DGDSTMTLLHASNPAQSLVVCPYKHGNIARFVNGINNHTADGKKKQNL 298
           DVDYL+NRE+D DGDS MTLLHAS+P+Q LV+CP +  NIARF++GINNH+ +G+KKQNL
Sbjct: 246 DVDYLSNREDDYDGDSMMTLLHASDPSQCLVICPDRRSNIARFISGINNHSPEGRKKQNL 305

Query: 299 KCVRYNVNGECRVLLVANRDIAKGERLYYDYNGYEKEYPTEHFV 342
           KCVR+N+NGE RVLLVANRDI+KGERLYYDYNGYE EYPTEHFV
Sbjct: 306 KCVRFNINGEARVLLVANRDISKGERLYYDYNGYEHEYPTEHFV 349
Histone methyltransferase.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 4EC: 3
>sp|Q8VZJ1|ATXR5_ARATH Histone-lysine N-methyltransferase ATXR5 OS=Arabidopsis thaliana GN=ATXR5 PE=2 SV=1 Back     alignment and function description
>sp|Q96T23|RSF1_HUMAN Remodeling and spacing factor 1 OS=Homo sapiens GN=RSF1 PE=1 SV=2 Back     alignment and function description
>sp|A8DZJ1|BAZ1B_XENLA Tyrosine-protein kinase BAZ1B OS=Xenopus laevis GN=baz1b PE=2 SV=2 Back     alignment and function description
>sp|A2BIL7|BAZ1B_DANRE Tyrosine-protein kinase BAZ1B OS=Danio rerio GN=baz1b PE=1 SV=2 Back     alignment and function description
>sp|Q9UIG0|BAZ1B_HUMAN Tyrosine-protein kinase BAZ1B OS=Homo sapiens GN=BAZ1B PE=1 SV=2 Back     alignment and function description
>sp|Q9Z277|BAZ1B_MOUSE Tyrosine-protein kinase BAZ1B OS=Mus musculus GN=Baz1b PE=1 SV=2 Back     alignment and function description
>sp|A6H619|PHRF1_MOUSE PHD and RING finger domain-containing protein 1 OS=Mus musculus GN=Phrf1 PE=1 SV=2 Back     alignment and function description
>sp|Q9P1Y6|PHRF1_HUMAN PHD and RING finger domain-containing protein 1 OS=Homo sapiens GN=PHRF1 PE=1 SV=3 Back     alignment and function description
>sp|Q9VMJ7|KDM5_DROME Lysine-specific demethylase lid OS=Drosophila melanogaster GN=lid PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query342
224120882319 SET domain protein [Populus trichocarpa] 0.932 1.0 0.811 1e-154
224132698325 SET domain protein [Populus trichocarpa] 0.915 0.963 0.799 1e-151
255556257344 Histone-lysine N-methyltransferase ATXR6 1.0 0.994 0.758 1e-151
449456407342 PREDICTED: histone-lysine N-methyltransf 1.0 1.0 0.739 1e-150
302143935400 unnamed protein product [Vitis vinifera] 0.979 0.837 0.747 1e-149
225455318354 PREDICTED: histone-lysine N-methyltransf 0.979 0.946 0.747 1e-149
356568947334 PREDICTED: histone-lysine N-methyltransf 0.964 0.988 0.730 1e-141
297812613349 hypothetical protein ARALYDRAFT_489297 [ 0.991 0.971 0.715 1e-139
357436409342 Lysine-specific demethylase 5C [Medicago 0.985 0.985 0.728 1e-138
356499679334 PREDICTED: histone-lysine N-methyltransf 0.964 0.988 0.727 1e-137
>gi|224120882|ref|XP_002318442.1| SET domain protein [Populus trichocarpa] gi|222859115|gb|EEE96662.1| SET domain protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  550 bits (1416), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 259/319 (81%), Positives = 282/319 (88%)

Query: 24  DDDDSRCEKCGSGDFPDELLLCDKCDKGFHLFCLRPILVSVPKGSWFCPSCSHHKRPKPF 83
           D  D  CEKCGSG+ P ELLLCDKCDKGFHLFCLRPILV+VPKGSWFCPSCS  K P  F
Sbjct: 1   DYSDVYCEKCGSGESPGELLLCDKCDKGFHLFCLRPILVAVPKGSWFCPSCSKQKMPNSF 60

Query: 84  PLVQTKIIDFFRIQRSADLTQKLTPDNLRKRKRASGLVMSKKRRKLLPFNPTEDPERRLQ 143
           PLVQTKIIDFFRIQRS +  QKL+ D  +KRKR+S LV+SKKRRKLLPF+P+EDPE+RL+
Sbjct: 61  PLVQTKIIDFFRIQRSTESIQKLSQDIQKKRKRSSSLVVSKKRRKLLPFSPSEDPEKRLE 120

Query: 144 QMASLATALRASGTEFTDELTYVTGMAPRSANSAVLEKGGMQVLSKEDIETLNLCKHMMN 203
           QM SLATAL ASGTEF++ELTY  GMAPRS N   LEKGGMQVLSKED ETLNLCK MMN
Sbjct: 121 QMRSLATALTASGTEFSNELTYRPGMAPRSVNQPALEKGGMQVLSKEDAETLNLCKRMMN 180

Query: 204 RGEWPPLMVEYDPKEGFTVQADRFIKDLTIITEYVGDVDYLNNRENDDGDSTMTLLHASN 263
           RGEWPPLMV +DPKEGFTV+ADRFIKDLTIITEYVGDVDYL NRENDDGDS MTLLHA N
Sbjct: 181 RGEWPPLMVVFDPKEGFTVEADRFIKDLTIITEYVGDVDYLKNRENDDGDSMMTLLHADN 240

Query: 264 PAQSLVVCPYKHGNIARFVNGINNHTADGKKKQNLKCVRYNVNGECRVLLVANRDIAKGE 323
           P+QSLV+CP   GNIARF+NGINNHT +G+KKQNLKCVRY+VNGECRVLL+ANRDI+KGE
Sbjct: 241 PSQSLVICPDMRGNIARFINGINNHTQEGRKKQNLKCVRYDVNGECRVLLIANRDISKGE 300

Query: 324 RLYYDYNGYEKEYPTEHFV 342
           RLYYDYNGYE EYPTEHFV
Sbjct: 301 RLYYDYNGYEHEYPTEHFV 319

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224132698|ref|XP_002321387.1| SET domain protein [Populus trichocarpa] gi|222868383|gb|EEF05514.1| SET domain protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255556257|ref|XP_002519163.1| Histone-lysine N-methyltransferase ATXR6, putative [Ricinus communis] gi|223541826|gb|EEF43374.1| Histone-lysine N-methyltransferase ATXR6, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449456407|ref|XP_004145941.1| PREDICTED: histone-lysine N-methyltransferase ATXR6-like [Cucumis sativus] gi|449526858|ref|XP_004170430.1| PREDICTED: histone-lysine N-methyltransferase ATXR6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|302143935|emb|CBI23040.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225455318|ref|XP_002275757.1| PREDICTED: histone-lysine N-methyltransferase ATXR6-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356568947|ref|XP_003552669.1| PREDICTED: histone-lysine N-methyltransferase ATXR6-like [Glycine max] Back     alignment and taxonomy information
>gi|297812613|ref|XP_002874190.1| hypothetical protein ARALYDRAFT_489297 [Arabidopsis lyrata subsp. lyrata] gi|297320027|gb|EFH50449.1| hypothetical protein ARALYDRAFT_489297 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357436409|ref|XP_003588480.1| Lysine-specific demethylase 5C [Medicago truncatula] gi|355477528|gb|AES58731.1| Lysine-specific demethylase 5C [Medicago truncatula] Back     alignment and taxonomy information
>gi|356499679|ref|XP_003518664.1| PREDICTED: histone-lysine N-methyltransferase ATXR6-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query342
TAIR|locus:2169779349 ATXR6 "AT5G24330" [Arabidopsis 0.991 0.971 0.712 4.8e-133
TAIR|locus:2144841379 ATXR5 "AT5G09790" [Arabidopsis 0.944 0.852 0.616 2.1e-107
UNIPROTKB|H0YCN2803 RSF1 "Remodeling and spacing f 0.152 0.064 0.557 5.8e-12
RGD|1311245 1444 Rsf1 "remodeling and spacing f 0.154 0.036 0.555 9.6e-12
UNIPROTKB|F1STY8 1344 RSF1 "Uncharacterized protein" 0.152 0.038 0.557 1.1e-11
UNIPROTKB|F1MLK1 1355 RSF1 "Uncharacterized protein" 0.152 0.038 0.557 1.2e-11
UNIPROTKB|F1P8R2 1434 RSF1 "Uncharacterized protein" 0.152 0.036 0.557 1.2e-11
UNIPROTKB|Q96T23 1441 RSF1 "Remodeling and spacing f 0.152 0.036 0.557 1.2e-11
UNIPROTKB|H0YDG9276 RSF1 "Remodeling and spacing f 0.137 0.170 0.553 2.5e-11
ZFIN|ZDB-GENE-091204-206 1369 si:dkey-21n12.3 "si:dkey-21n12 0.213 0.053 0.44 9.3e-11
TAIR|locus:2169779 ATXR6 "AT5G24330" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1304 (464.1 bits), Expect = 4.8e-133, P = 4.8e-133
 Identities = 245/344 (71%), Positives = 290/344 (84%)

Query:     4 RRRTEAPKPNIHRP---ITYESPDDDDSRCEKCGSGDFPDELLLCDKCDKGFHLFCLRPI 60
             RRRT+A  P    P     ++S  D D+ CE+C SG  P +LLLCDKCDKGFHLFCLRPI
Sbjct:     6 RRRTQASNPRSEPPQHMSDHDSDSDWDTVCEECSSGKQPAKLLLCDKCDKGFHLFCLRPI 65

Query:    61 LVSVPKGSWFCPSCSHHKRPKPFPLVQTKIIDFFRIQRSADLTQ-KLTPDNLRKRKRASG 119
             LVSVPKGSWFCPSCS H+ PK FPL+QTKIIDFFRI+RS D +Q   + D++ K+++ + 
Sbjct:    66 LVSVPKGSWFCPSCSKHQIPKSFPLIQTKIIDFFRIKRSPDSSQISSSSDSIGKKRKKTS 125

Query:   120 LVMSKKRRKLLPFNPTEDPERRLQQMASLATALRASGTEFTDELTYVTGMAPRSANSAVL 179
             LVMSKK+R+LLP+NP+ DP+RRL+QMASLATALRAS T+F++ELTYV+G APRSAN A  
Sbjct:   126 LVMSKKKRRLLPYNPSNDPQRRLEQMASLATALRASNTKFSNELTYVSGKAPRSANQAAF 185

Query:   180 EKGGMQVLSKEDIETLNLCKHMMNRGEWPPLMVEYDPKEGFTVQADRFIKDLTIITEYVG 239
             EKGGMQVLSKE +ETL LCK MM+ GE PPLMV +DP EGFTV+ADRFIKD TIITEYVG
Sbjct:   186 EKGGMQVLSKEGVETLALCKKMMDLGECPPLMVVFDPYEGFTVEADRFIKDWTIITEYVG 245

Query:   240 DVDYLNNREND-DGDSTMTLLHASNPAQSLVVCPYKHGNIARFVNGINNHTADGKKKQNL 298
             DVDYL+NRE+D DGDS MTLLHAS+P+Q LV+CP +  NIARF++GINNH+ +G+KKQNL
Sbjct:   246 DVDYLSNREDDYDGDSMMTLLHASDPSQCLVICPDRRSNIARFISGINNHSPEGRKKQNL 305

Query:   299 KCVRYNVNGECRVLLVANRDIAKGERLYYDYNGYEKEYPTEHFV 342
             KCVR+N+NGE RVLLVANRDI+KGERLYYDYNGYE EYPTEHFV
Sbjct:   306 KCVRFNINGEARVLLVANRDISKGERLYYDYNGYEHEYPTEHFV 349
GO:0003677 "DNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0009901 "anther dehiscence" evidence=IMP
GO:0051726 "regulation of cell cycle" evidence=IEP
GO:0046976 "histone methyltransferase activity (H3-K27 specific)" evidence=IDA
GO:0070734 "histone H3-K27 methylation" evidence=IDA
GO:0006275 "regulation of DNA replication" evidence=IGI;RCA
GO:0000280 "nuclear division" evidence=RCA
GO:0000911 "cytokinesis by cell plate formation" evidence=RCA
GO:0006261 "DNA-dependent DNA replication" evidence=RCA
GO:0010389 "regulation of G2/M transition of mitotic cell cycle" evidence=RCA
GO:0042023 "DNA endoreduplication" evidence=RCA
GO:0051225 "spindle assembly" evidence=RCA
TAIR|locus:2144841 ATXR5 "AT5G09790" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|H0YCN2 RSF1 "Remodeling and spacing factor 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1311245 Rsf1 "remodeling and spacing factor 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1STY8 RSF1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MLK1 RSF1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1P8R2 RSF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q96T23 RSF1 "Remodeling and spacing factor 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0YDG9 RSF1 "Remodeling and spacing factor 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-091204-206 si:dkey-21n12.3 "si:dkey-21n12.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FNE9ATXR6_ARATH2, ., 1, ., 1, ., 4, 30.71220.99120.9713yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.1.430.979
3rd Layer2.1.10.983

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
SDG933
SET domain protein (319 aa)
(Populus trichocarpa)
Predicted Functional Partners:
CHR942
chromatin remodeling complex subunit (148 aa)
      • 0.700
DMT909
hypothetical protein (251 aa)
      • 0.700
HON901
SubName- Full=Putative uncharacterized protein; (197 aa)
      • 0.700
HTR902
RecName- Full=Histone H3; (137 aa)
      • 0.510
HFO909
RecName- Full=Histone H4;; Core component of nucleosome. Nucleosomes wrap and compact DNA into [...] (103 aa)
      • 0.510
HTA912
RecName- Full=Histone H2A; (145 aa)
      • 0.510
HTA902
histone H2 (130 aa)
      • 0.510
COMT6
catechol o-methyltransferase (336 aa)
      • 0.504

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query342
pfam0062851 pfam00628, PHD, PHD-finger 1e-12
smart0024947 smart00249, PHD, PHD zinc finger 9e-12
pfam00856113 pfam00856, SET, SET domain 5e-11
smart00317124 smart00317, SET, SET (Su(var)3-9, Enhancer-of-zest 4e-08
COG2940480 COG2940, COG2940, Proteins containing SET domain [ 1e-06
cd04718148 cd04718, BAH_plant_2, BAH, or Bromo Adjacent Homol 8e-05
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information 
 Score = 61.7 bits (150), Expect = 1e-12
 Identities = 25/49 (51%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query: 29 RCEKCGSGDFPDELLLCDKCDKGFHLFCLRPILVS--VPKGSWFCPSCS 75
           C  CG  D   ELLLCD CD+ FHL CL P L    +P+G W+CP C 
Sbjct: 1  YCAVCGKVDDDGELLLCDGCDRWFHLACLGPPLEPEEIPEGEWYCPECK 49

PHD folds into an interleaved type of Zn-finger chelating 2 Zn ions in a similar manner to that of the RING and FYVE domains. Several PHD fingers have been identified as binding modules of methylated histone H3. Length = 51
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information
>gnl|CDD|216155 pfam00856, SET, SET domain Back     alignment and domain information
>gnl|CDD|214614 smart00317, SET, SET (Su(var)3-9, Enhancer-of-zeste, Trithorax) domain Back     alignment and domain information
>gnl|CDD|225491 COG2940, COG2940, Proteins containing SET domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|240069 cd04718, BAH_plant_2, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 342
KOG4442 729 consensus Clathrin coat binding protein/Huntingtin 99.98
KOG10831306 consensus Putative transcription factor ASH1/LIN-5 99.95
KOG10801005 consensus Histone H3 (Lys4) methyltransferase comp 99.92
KOG1079739 consensus Transcriptional repressor EZH1 [Transcri 99.88
KOG1082364 consensus Histone H3 (Lys9) methyltransferase SUV3 99.88
smart00317116 SET SET (Su(var)3-9, Enhancer-of-zeste, Trithorax) 99.87
KOG1085392 consensus Predicted methyltransferase (contains a 99.79
KOG11411262 consensus Predicted histone methyl transferase [Ch 99.43
COG2940480 Proteins containing SET domain [General function p 99.42
PF00856162 SET: SET domain; InterPro: IPR001214 The SET domai 99.33
KOG1081463 consensus Transcription factor NSD1 and related SE 99.03
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 98.96
KOG1244336 consensus Predicted transcription factor Requiem/N 98.91
KOG2461 396 consensus Transcription factor BLIMP-1/PRDI-BF1, c 98.74
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 98.72
KOG1973274 consensus Chromatin remodeling protein, contains P 98.48
KOG4299613 consensus PHD Zn-finger protein [General function 98.43
KOG0825 1134 consensus PHD Zn-finger protein [General function 98.39
KOG2589 453 consensus Histone tail methylase [Chromatin struct 98.37
KOG1512381 consensus PHD Zn-finger protein [General function 98.3
KOG0383 696 consensus Predicted helicase [General function pre 97.98
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 97.93
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 97.85
KOG4323464 consensus Polycomb-like PHD Zn-finger protein [Gen 97.8
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 97.69
KOG0956 900 consensus PHD finger protein AF10 [General functio 97.6
KOG0954 893 consensus PHD finger protein [General function pre 97.55
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 97.53
COG5141 669 PHD zinc finger-containing protein [General functi 97.52
KOG0957707 consensus PHD finger protein [General function pre 97.51
KOG12451404 consensus Chromatin remodeling complex WSTF-ISWI, 97.3
KOG4443 694 consensus Putative transcription factor HALR/MLL3, 97.23
KOG0957 707 consensus PHD finger protein [General function pre 96.83
KOG1141 1262 consensus Predicted histone methyl transferase [Ch 95.94
KOG1844 508 consensus PHD Zn-finger proteins [General function 95.6
KOG1473 1414 consensus Nucleosome remodeling factor, subunit NU 95.17
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 94.21
KOG1246 904 consensus DNA-binding protein jumonji/RBP2/SMCY, c 94.2
PF15446175 zf-PHD-like: PHD/FYVE-zinc-finger like domain 90.33
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 86.96
PF13901202 DUF4206: Domain of unknown function (DUF4206) 86.77
KOG4299 613 consensus PHD Zn-finger protein [General function 84.83
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 84.11
PF13832110 zf-HC5HC2H_2: PHD-zinc-finger like domain 83.92
KOG1512381 consensus PHD Zn-finger protein [General function 81.45
PF07227446 DUF1423: Protein of unknown function (DUF1423); In 80.09
>KOG4442 consensus Clathrin coat binding protein/Huntingtin interacting protein HIP1, involved in regulation of endocytosis [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information 
Probab=99.98  E-value=5.8e-33  Score=271.73  Aligned_cols=164  Identities=22%  Similarity=0.273  Sum_probs=134.2

Q ss_pred             hhcCCCc--cCCCccccCCCCcccccchhhccCCceecC-hHHHHHHHHhhHH-hhcCCCCccEEeecCCCceeEEEccC
Q 019353          152 LRASGTE--FTDELTYVTGMAPRSANSAVLEKGGMQVLS-KEDIETLNLCKHM-MNRGEWPPLMVEYDPKEGFTVQADRF  227 (342)
Q Consensus       152 l~~~~~~--~s~~~~~~~~~~~~~~n~~~~~~~~~~~~~-~~~~~~~~~~~~~-~~~~~~~~~~v~~~~~~G~Gv~a~~~  227 (342)
                      ...|.|.  +.+...-..+.++.|+|++...+|+...|+ ..     ..|+|+ +|+..+.+++||.+..+||||+|..+
T Consensus        65 ~m~Cdc~~~~~d~~n~~~~cg~~CiNr~t~iECs~~~C~~cg-----~~C~NQRFQkkqyA~vevF~Te~KG~GLRA~~d  139 (729)
T KOG4442|consen   65 EMICDCKPKTGDGANGACACGEDCINRMTSIECSDRECPRCG-----VYCKNQRFQKKQYAKVEVFLTEKKGCGLRAEED  139 (729)
T ss_pred             ceeeecccccccccccccccCccccchhhhcccCCccCCCcc-----ccccchhhhhhccCceeEEEecCcccceeeccc
Confidence            3444443  455433334677899999999999887887 44     678876 99999999999999999999999999


Q ss_pred             CCCCCeEEEccceeecccc-------cccCC-CCceeeeecccCCCCcEEEeCCCCCCeeeeccCCCCCCCCCCCCCCcE
Q 019353          228 IKDLTIITEYVGDVDYLNN-------RENDD-GDSTMTLLHASNPAQSLVVCPYKHGNIARFVNGINNHTADGKKKQNLK  299 (342)
Q Consensus       228 i~~g~~I~ey~Gev~~~~~-------~~~~~-~~~~~~~~~~~~~~~~~~iDa~~~GN~aRfin~~~~hSC~~~~~pN~~  299 (342)
                      |++|+||+||+|||+....       +..+. .++|++-+   .  ...+|||+.+||+|||||    |||+    |||+
T Consensus       140 I~~g~FI~EY~GEVI~~~Ef~kR~~~Y~~d~~kh~Yfm~L---~--~~e~IDAT~KGnlaRFiN----HSC~----PNa~  206 (729)
T KOG4442|consen  140 IPKGQFILEYIGEVIEEKEFEKRVKRYAKDGIKHYYFMAL---Q--GGEYIDATKKGNLARFIN----HSCD----PNAE  206 (729)
T ss_pred             cCCCcEEeeeccccccHHHHHHHHHHHHhcCCceEEEEEe---c--CCceecccccCcHHHhhc----CCCC----CCce
Confidence            9999999999999986421       11222 22332222   2  578999999999999999    9999    9999


Q ss_pred             EEEEEECCeEEEEEEEcCCCCCCCeEEEecCCCC
Q 019353          300 CVRYNVNGECRVLLVANRDIAKGERLYYDYNGYE  333 (342)
Q Consensus       300 ~~~~~~~~~~~i~l~A~rdI~~GEELt~dY~~~~  333 (342)
                      ++.|.|+|..||+|||.|.|.+||||||||+++.
T Consensus       207 ~~KWtV~~~lRvGiFakk~I~~GEEITFDYqf~r  240 (729)
T KOG4442|consen  207 VQKWTVPDELRVGIFAKKVIKPGEEITFDYQFDR  240 (729)
T ss_pred             eeeeeeCCeeEEEEeEecccCCCceeeEeccccc
Confidence            9999999999999999999999999999999754

>KOG1083 consensus Putative transcription factor ASH1/LIN-59 [Transcription] Back     alignment and domain information
>KOG1080 consensus Histone H3 (Lys4) methyltransferase complex, subunit SET1 and related methyltransferases [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1079 consensus Transcriptional repressor EZH1 [Transcription] Back     alignment and domain information
>KOG1082 consensus Histone H3 (Lys9) methyltransferase SUV39H1/Clr4, required for transcriptional silencing [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>smart00317 SET SET (Su(var)3-9, Enhancer-of-zeste, Trithorax) domain Back     alignment and domain information
>KOG1085 consensus Predicted methyltransferase (contains a SET domain) [General function prediction only] Back     alignment and domain information
>KOG1141 consensus Predicted histone methyl transferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG2940 Proteins containing SET domain [General function prediction only] Back     alignment and domain information
>PF00856 SET: SET domain; InterPro: IPR001214 The SET domain appears generally as one part of a larger multidomain protein, and recently there were described three structures of very different proteins with distinct domain compositions: Neurospora crassa DIM-5, a member of the Su(var) family of HKMTs which methylate histone H3 on lysine 9,human SET7 (also called SET9), which methylates H3 on lysine 4 and garden pea Rubisco LSMT, an enzyme that does not modify histones, but instead methylates lysine 14 in the flexible tail of the large subunit of the enzyme Rubisco Back     alignment and domain information
>KOG1081 consensus Transcription factor NSD1 and related SET domain proteins [Transcription] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] Back     alignment and domain information
>KOG2461 consensus Transcription factor BLIMP-1/PRDI-BF1, contains C2H2-type Zn-finger and SET domains [Transcription] Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG2589 consensus Histone tail methylase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG1141 consensus Predicted histone methyl transferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1844 consensus PHD Zn-finger proteins [General function prediction only] Back     alignment and domain information
>KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG1246 consensus DNA-binding protein jumonji/RBP2/SMCY, contains JmjC domain [General function prediction only] Back     alignment and domain information
>PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13901 DUF4206: Domain of unknown function (DUF4206) Back     alignment and domain information
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF07227 DUF1423: Protein of unknown function (DUF1423); InterPro: IPR004082 A total of 715 potential protein-coding genes have been identified in the nucleotide sequence of Arabidopsis thaliana chromosome 5, with an average gene density of 1 gene per 4001 bp [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query342
2e6r_A92 Solution Structure Of The Phd Domain In Smcy Protei 3e-10
1f62_A51 Wstf-Phd Length = 51 9e-10
2ysm_A111 Solution Structure Of The First And Second Phd Doma 7e-09
3ask_A226 Structure Of Uhrf1 In Complex With Histone Tail Len 1e-08
4gy5_A241 Crystal Structure Of The Tandem Tudor Domain And Pl 1e-08
3zvz_B57 Phd Finger Of Human Uhrf1 Length = 57 3e-07
2kwj_A114 Solution Structures Of The Double Phd Fingers Of Hu 3e-07
3zvy_A72 Phd Finger Of Human Uhrf1 In Complex With Unmodifie 4e-07
3sou_A70 Structure Of Uhrf1 Phd Finger In Complex With Histo 5e-07
2lgg_A69 Structure Of Phd Domain Of Uhrf1 In Complex With H3 6e-07
3shb_A77 Crystal Structure Of Phd Domain Of Uhrf1 Length = 7 7e-07
2l5u_A61 Structure Of The First Phd Finger (Phd1) From Chd4 7e-07
3t6r_A72 Structure Of Uhrf1 In Complex With Unmodified H3 N- 8e-07
2yql_A56 Solution Structure Of The Phd Domain In Phd Finger 1e-06
2kft_A56 Nmr Solution Structure Of The First Phd Finger Doma 3e-06
1xwh_A66 Nmr Structure Of The First Phd Finger Of Autoimmune 3e-06
3ope_A222 Structural Basis Of Auto-Inhibitory Mechanism Of Hi 3e-06
3u5m_A207 Crystal Structure Of Trim33 Phd-Bromo In The Free S 6e-06
3o33_A184 Crystal Structure Of Trim24 Phd-Bromo In The Free S 1e-05
3v43_A112 Crystal Structure Of Moz Length = 112 1e-05
2ln0_A110 Structure Of Moz Length = 110 2e-05
1mm3_A61 Solution Structure Of The 2nd Phd Domain From Mi2b 2e-05
2puy_A60 Crystal Structure Of The Bhc80 Phd Finger Length = 2e-05
2e6s_A77 Solution Structure Of The Phd Domain In Ring Finger 2e-05
1mm2_A61 Solution Structure Of The 2nd Phd Domain From Mi2b 9e-05
1fp0_A88 Solution Structure Of The Phd Domain From The Kap-1 8e-04
>pdb|2E6R|A Chain A, Solution Structure Of The Phd Domain In Smcy Protein Length = 92 Back     alignment and structure 
Iteration: 1

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 24/49 (48%), Positives = 30/49 (61%)
Query: 26 DDSRCEKCGSGDFPDELLLCDKCDKGFHLFCLRPILVSVPKGSWFCPSC 74
          D   C+ C  GD  D+LL CD CD  +H+FCL P L  +P+G W CP C
Sbjct: 15 DSYICQVCSRGDEDDKLLFCDGCDDNYHIFCLLPPLPEIPRGIWRCPKC 63
>pdb|1F62|A Chain A, Wstf-Phd Length = 51 Back     alignment and structure
>pdb|2YSM|A Chain A, Solution Structure Of The First And Second Phd Domain From MyeloidLYMPHOID OR MIXED-Lineage Leukemia Protein 3 Homolog Length = 111 Back     alignment and structure
>pdb|3ASK|A Chain A, Structure Of Uhrf1 In Complex With Histone Tail Length = 226 Back     alignment and structure
>pdb|4GY5|A Chain A, Crystal Structure Of The Tandem Tudor Domain And Plant Homeodomain Of Uhrf1 With Histone H3k9me3 Length = 241 Back     alignment and structure
>pdb|3ZVZ|B Chain B, Phd Finger Of Human Uhrf1 Length = 57 Back     alignment and structure
>pdb|2KWJ|A Chain A, Solution Structures Of The Double Phd Fingers Of Human Transcriptional Protein Dpf3 Bound To A Histone Peptide Containing Acetylation At Lysine 14 Length = 114 Back     alignment and structure
>pdb|3ZVY|A Chain A, Phd Finger Of Human Uhrf1 In Complex With Unmodified Histone H3 N-Terminal Tail Length = 72 Back     alignment and structure
>pdb|3SOU|A Chain A, Structure Of Uhrf1 Phd Finger In Complex With Histone H3 1-9 Peptide Length = 70 Back     alignment and structure
>pdb|2LGG|A Chain A, Structure Of Phd Domain Of Uhrf1 In Complex With H3 Peptide Length = 69 Back     alignment and structure
>pdb|3SHB|A Chain A, Crystal Structure Of Phd Domain Of Uhrf1 Length = 77 Back     alignment and structure
>pdb|2L5U|A Chain A, Structure Of The First Phd Finger (Phd1) From Chd4 (Mi2b) Length = 61 Back     alignment and structure
>pdb|3T6R|A Chain A, Structure Of Uhrf1 In Complex With Unmodified H3 N-Terminal Tail Length = 72 Back     alignment and structure
>pdb|2YQL|A Chain A, Solution Structure Of The Phd Domain In Phd Finger Protein 21a Length = 56 Back     alignment and structure
>pdb|2KFT|A Chain A, Nmr Solution Structure Of The First Phd Finger Domain Of Human Autoimmune Regulator (Aire) In Complex With Histone H3(1-20cys) Peptide Length = 56 Back     alignment and structure
>pdb|1XWH|A Chain A, Nmr Structure Of The First Phd Finger Of Autoimmune Regulator Protein (Aire1): Insights Into Apeced Length = 66 Back     alignment and structure
>pdb|3OPE|A Chain A, Structural Basis Of Auto-Inhibitory Mechanism Of Histone Methyltransferase Length = 222 Back     alignment and structure
>pdb|3U5M|A Chain A, Crystal Structure Of Trim33 Phd-Bromo In The Free State Length = 207 Back     alignment and structure
>pdb|3O33|A Chain A, Crystal Structure Of Trim24 Phd-Bromo In The Free State Length = 184 Back     alignment and structure
>pdb|3V43|A Chain A, Crystal Structure Of Moz Length = 112 Back     alignment and structure
>pdb|2LN0|A Chain A, Structure Of Moz Length = 110 Back     alignment and structure
>pdb|1MM3|A Chain A, Solution Structure Of The 2nd Phd Domain From Mi2b With C- Terminal Loop Replaced By Corresponding Loop From Wstf Length = 61 Back     alignment and structure
>pdb|2PUY|A Chain A, Crystal Structure Of The Bhc80 Phd Finger Length = 60 Back     alignment and structure
>pdb|2E6S|A Chain A, Solution Structure Of The Phd Domain In Ring Finger Protein 107 Length = 77 Back     alignment and structure
>pdb|1MM2|A Chain A, Solution Structure Of The 2nd Phd Domain From Mi2b Length = 61 Back     alignment and structure
>pdb|1FP0|A Chain A, Solution Structure Of The Phd Domain From The Kap-1 Corepressor Length = 88 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query342
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 1e-23
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 4e-23
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 4e-21
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 9e-05
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 5e-21
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 6e-21
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 2e-20
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 3e-20
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 4e-20
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 5e-20
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 7e-20
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 7e-20
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 8e-20
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 5e-19
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 2e-18
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 4e-16
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 2e-17
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 2e-17
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 4e-07
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 2e-17
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 3e-17
2yt5_A66 Metal-response element-binding transcription facto 3e-16
2k16_A75 Transcription initiation factor TFIID subunit 3; p 8e-16
3ooi_A232 Histone-lysine N-methyltransferase, H3 lysine-36 l 2e-14
3f9x_A166 Histone-lysine N-methyltransferase SETD8; methyltr 2e-14
3h6l_A278 Histone-lysine N-methyltransferase SETD2; SET doma 1e-13
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 5e-13
1mvh_A299 Cryptic LOCI regulator 4; lysine methyltransferase 7e-13
3bo5_A290 Histone-lysine N-methyltransferase setmar; SET dom 1e-12
3ope_A222 Probable histone-lysine N-methyltransferase ASH1L; 7e-12
1ml9_A302 Histone H3 methyltransferase DIM-5; adoMet-depende 2e-11
3hna_A287 Histone-lysine N-methyltransferase, H3 lysine-9 sp 2e-11
2w5y_A192 Histone-lysine N-methyltransferase HRX; transcript 1e-10
2r3a_A300 Histone-lysine N-methyltransferase SUV39H2; histon 2e-10
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 3e-10
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 3e-10
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 3e-09
3rq4_A247 Histone-lysine N-methyltransferase SUV420H2; suppr 9e-09
1x4i_A70 Inhibitor of growth protein 3; structural genomics 2e-08
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 3e-08
3s8p_A273 Histone-lysine N-methyltransferase SUV420H1; SET d 3e-08
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 7e-08
1n3j_A119 A612L, histone H3 lysine methyltransferase; beta b 9e-08
2qpw_A149 PR domain zinc finger protein 2; methyltransferase 2e-07
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 2e-07
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 2e-07
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 4e-07
1wem_A76 Death associated transcription factor 1; structura 8e-07
1weu_A91 Inhibitor of growth family, member 4; structural g 9e-07
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 1e-06
2f69_A261 Histone-lysine N-methyltransferase, H3 lysine-4 sp 2e-06
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 2e-06
1we9_A64 PHD finger family protein; structural genomics, PH 9e-06
3dal_A196 PR domain zinc finger protein 1; methyltransferase 1e-05
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 1e-05
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 1e-05
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 3e-05
3ep0_A170 PR domain zinc finger protein 12; PR domain-contai 3e-05
2pv0_B386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 1e-04
3db5_A151 PR domain zinc finger protein 4; methyltransferase 2e-04
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 3e-04
1wee_A72 PHD finger family protein; structural genomics, PH 3e-04
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 Back     alignment and structure
 Score = 90.9 bits (226), Expect = 1e-23
 Identities = 26/48 (54%), Positives = 32/48 (66%)

Query: 29 RCEKCGSGDFPDELLLCDKCDKGFHLFCLRPILVSVPKGSWFCPSCSH 76
          RC+ C      D+L+LCD+C+K FHLFCLRP L  VP G W CP+C  
Sbjct: 2  RCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQP 49
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 Back     alignment and structure
>3ooi_A Histone-lysine N-methyltransferase, H3 lysine-36 lysine-20 specific; SET domain, S-adenosyl-L methionine; HET: SAM; 1.75A {Homo sapiens} Length = 232 Back     alignment and structure
>3f9x_A Histone-lysine N-methyltransferase SETD8; methyltransferase, SET, lysine, alternative splicing, cell cycle, cell division, chromatin regulator, chromosomal protein, coiled coil; HET: MLY SAH; 1.25A {Homo sapiens} PDB: 3f9w_A* 3f9y_A* 3f9z_A* 1zkk_A* 2bqz_A* Length = 166 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>1mvh_A Cryptic LOCI regulator 4; lysine methyltransferase, CLR4, SET-domain; 2.30A {Schizosaccharomyces pombe} SCOP: b.85.7.1 PDB: 1mvx_A Length = 299 Back     alignment and structure
>3bo5_A Histone-lysine N-methyltransferase setmar; SET domain, chromati regulator, DNA damage, DNA repair, DNA-binding, nucleus, ST genomics; HET: SAH; 1.59A {Homo sapiens} Length = 290 Back     alignment and structure
>3ope_A Probable histone-lysine N-methyltransferase ASH1L; SET, nucleus; HET: SAM; 2.90A {Homo sapiens} Length = 222 Back     alignment and structure
>1ml9_A Histone H3 methyltransferase DIM-5; adoMet-dependent methyltransferase histone H3 lysine- 9 methylation; 1.98A {Neurospora crassa} SCOP: b.85.7.1 PDB: 1peg_A* Length = 302 Back     alignment and structure
>3hna_A Histone-lysine N-methyltransferase, H3 lysine-9 specific 5; EHMT1, structural genomics, SGC, structural genomics consortium, alternative splicing, ANK repeat; HET: MLZ SAH; 1.50A {Homo sapiens} PDB: 2rfi_A* 2igq_A* 3mo0_A* 3mo2_A* 3mo5_A* 3sw9_A* 3swc_A* 3fpd_A* 3k5k_A* 3nni_A* 3rjw_A* 2o8j_A* Length = 287 Back     alignment and structure
>2w5y_A Histone-lysine N-methyltransferase HRX; transcription regulation, chromosomal rearrangement, protein lysine methyltransferase, proto-oncogene; HET: SAH; 2.00A {Homo sapiens} PDB: 2w5z_A* Length = 192 Back     alignment and structure
>2r3a_A Histone-lysine N-methyltransferase SUV39H2; histone H3-K9 methyltransferase 2, H3 lysine-9 specific 2, alternative splicing, cell cycle; HET: SAM; 2.00A {Homo sapiens} Length = 300 Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Length = 129 Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Length = 142 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>3rq4_A Histone-lysine N-methyltransferase SUV420H2; suppressor, variegation 4-20 homolog 2, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.80A {Homo sapiens} Length = 247 Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 Back     alignment and structure
>3s8p_A Histone-lysine N-methyltransferase SUV420H1; SET domain, histone methyltransferase, transcription regulat histone lysine, SAM, methylation, nucleus; HET: MSE SAM; 1.85A {Homo sapiens} Length = 273 Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Length = 62 Back     alignment and structure
>1n3j_A A612L, histone H3 lysine methyltransferase; beta barrel, homodimer; NMR {Paramecium bursaria chlorella virus 1} SCOP: b.85.7.2 PDB: 2g46_A* 3kma_A 3kmj_A 3kmt_A* Length = 119 Back     alignment and structure
>2qpw_A PR domain zinc finger protein 2; methyltransferase, activator, alternative initiation, alternative splicing, DNA-binding, metal-binding, nucleus; 1.79A {Homo sapiens} PDB: 2jv0_A* Length = 149 Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Length = 60 Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Length = 71 Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Length = 59 Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Length = 76 Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Length = 91 Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Length = 90 Back     alignment and structure
>2f69_A Histone-lysine N-methyltransferase, H3 lysine-4 specific SET7; SET domain, protein lysine methyltransferase, enzyme- peptide-adohcy complex; HET: MLZ SAH; 1.30A {Homo sapiens} SCOP: b.76.2.1 b.85.7.1 PDB: 3m53_A* 3m55_A* 3m54_A* 3m56_A* 3m58_A* 3m57_A* 3m59_A* 3m5a_A* 1xqh_A* 4e47_A* 1n6a_A* 1o9s_A* 3cbp_A* 3cbm_A* 3cbo_A* 3os5_A* Length = 261 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64 Back     alignment and structure
>3dal_A PR domain zinc finger protein 1; methyltransferase, PRDM1, structural genomics, structural genomics consortium, SGC, DNA-binding, metal-binding; 1.65A {Homo sapiens} Length = 196 Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Length = 159 Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Length = 105 Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Length = 79 Back     alignment and structure
>3ep0_A PR domain zinc finger protein 12; PR domain-containing protein 12, structural genomics, structural genomics consortium, SGC, DNA-binding; 2.10A {Homo sapiens} Length = 170 Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Length = 386 Back     alignment and structure
>3db5_A PR domain zinc finger protein 4; methyltransferase, PRDM4, structural genomics, structural GE consortium, SGC, DNA-binding, metal-binding, nucleus; 2.15A {Homo sapiens} Length = 151 Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} Length = 75 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Length = 65 Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 72 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query342
3ooi_A232 Histone-lysine N-methyltransferase, H3 lysine-36 l 100.0
3ope_A222 Probable histone-lysine N-methyltransferase ASH1L; 99.97
3h6l_A278 Histone-lysine N-methyltransferase SETD2; SET doma 99.97
3f9x_A166 Histone-lysine N-methyltransferase SETD8; methyltr 99.97
3hna_A287 Histone-lysine N-methyltransferase, H3 lysine-9 sp 99.96
2w5y_A192 Histone-lysine N-methyltransferase HRX; transcript 99.95
1mvh_A299 Cryptic LOCI regulator 4; lysine methyltransferase 99.95
3bo5_A290 Histone-lysine N-methyltransferase setmar; SET dom 99.95
1ml9_A302 Histone H3 methyltransferase DIM-5; adoMet-depende 99.94
2r3a_A300 Histone-lysine N-methyltransferase SUV39H2; histon 99.94
2qpw_A149 PR domain zinc finger protein 2; methyltransferase 99.93
1n3j_A119 A612L, histone H3 lysine methyltransferase; beta b 99.91
2f69_A261 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.9
1h3i_A293 Histone H3 lysine 4 specific methyltransferase; 2. 99.89
3ep0_A170 PR domain zinc finger protein 12; PR domain-contai 99.84
3s8p_A273 Histone-lysine N-methyltransferase SUV420H1; SET d 99.82
3db5_A151 PR domain zinc finger protein 4; methyltransferase 99.79
3rq4_A247 Histone-lysine N-methyltransferase SUV420H2; suppr 99.78
3dal_A196 PR domain zinc finger protein 1; methyltransferase 99.77
3ray_A237 PR domain-containing protein 11; structural genomi 99.63
3ihx_A152 PR domain zinc finger protein 10; PRDM10, methyltr 99.57
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 99.38
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 99.38
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 99.38
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 99.37
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 99.36
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 99.35
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 99.35
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 99.34
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 99.3
2yt5_A66 Metal-response element-binding transcription facto 99.29
2k16_A75 Transcription initiation factor TFIID subunit 3; p 99.28
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 99.28
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 99.28
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 99.24
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 99.22
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 99.19
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 99.18
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 99.17
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 99.17
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.15
1weu_A91 Inhibitor of growth family, member 4; structural g 99.12
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.11
3o70_A68 PHD finger protein 13; PHF13, structural genomics 99.08
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 99.07
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 99.06
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 99.06
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 99.06
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 99.03
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 99.03
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 98.99
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.96
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 98.93
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 98.9
1wee_A72 PHD finger family protein; structural genomics, PH 98.88
1wew_A78 DNA-binding family protein; structural genomics, P 98.87
1we9_A64 PHD finger family protein; structural genomics, PH 98.85
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 98.81
1wem_A76 Death associated transcription factor 1; structura 98.74
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 98.71
1x4i_A70 Inhibitor of growth protein 3; structural genomics 98.65
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 98.64
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.59
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 98.58
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 98.55
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 98.52
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 98.5
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 98.47
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 98.41
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 98.38
3kv5_D 488 JMJC domain-containing histone demethylation prote 98.1
3n71_A 490 Histone lysine methyltransferase SMYD1; heart deve 98.04
3qwp_A 429 SET and MYND domain-containing protein 3; SMYD3,SE 98.04
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 98.02
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 97.91
3qww_A 433 SET and MYND domain-containing protein 2; methyltr 97.87
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 97.83
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 97.7
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 97.6
1wil_A89 KIAA1045 protein; ring finger domain, structural g 97.21
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 96.82
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 96.13
3qxy_A 449 N-lysine methyltransferase SETD6; epigenetics, pro 95.96
2h21_A 440 Ribulose-1,5 bisphosphate carboxylase/oxygenase; S 95.88
3rsn_A177 SET1/ASH2 histone methyltransferase complex subun; 95.49
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 94.58
3smt_A 497 Histone-lysine N-methyltransferase SETD3; histone 94.05
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 92.15
2pv0_B386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 91.72
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 88.69
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 87.42
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 86.45
3n71_A 490 Histone lysine methyltransferase SMYD1; heart deve 85.62
3qww_A 433 SET and MYND domain-containing protein 2; methyltr 84.62
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 83.93
2ect_A78 Ring finger protein 126; metal binding protein, st 83.33
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 82.68
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 82.61
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 82.44
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 81.53
>3ooi_A Histone-lysine N-methyltransferase, H3 lysine-36 lysine-20 specific; SET domain, S-adenosyl-L methionine; HET: SAM; 1.75A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=3.7e-35  Score=263.89  Aligned_cols=190  Identities=25%  Similarity=0.365  Sum_probs=151.4

Q ss_pred             cccccCCC--CCCCChHHHhhhhhhhhhhhhcCCCccCCCccccCCCCcccccchhhccCCceecChHHHHHHHHhhHH-
Q 019353          125 KRRKLLPF--NPTEDPERRLQQMASLATALRASGTEFTDELTYVTGMAPRSANSAVLEKGGMQVLSKEDIETLNLCKHM-  201 (342)
Q Consensus       125 ~~~k~~p~--~~~~~~~~r~k~~~s~~sal~~~~~~~s~~~~~~~~~~~~~~n~~~~~~~~~~~~~~~~~~~~~~~~~~-  201 (342)
                      ..++++||  ++...+..+.+......+....++++.+++..+  +....|+|+++..+|+...++..     ..|+|+ 
T Consensus        13 ~~~~pp~y~~i~~n~~~~~~~~~~~~~~~~~~C~C~~~~~~~C--~~~~~C~nr~~~~EC~~~~C~c~-----~~C~Nr~   85 (232)
T 3ooi_A           13 NDKKPPPYKHIKVNRPIGRVQIFTADLSEIPRCNCKATDENPC--GIDSECINRMLLYECHPTVCPAG-----GRCQNQC   85 (232)
T ss_dssp             HCCSCCCCEECSSCEECTTCCCCCCCGGGSCCCSCCTTSSSTT--CTTSCCHHHHTTBCCCTTTCTTG-----GGCCCCH
T ss_pred             cCCCCCCceEeeccccccccccccCCcccCCcccccCCCCCCC--CCCCCCcCcCceeEeCCCCCCCC-----CCcCCcc
Confidence            34556666  344443333333333456678899988877666  66679999999999988777766     578765 


Q ss_pred             hhcCCCCccEEeecCCCceeEEEccCCCCCCeEEEccceeecccc---c-----ccCCCCceeeeecccCCCCcEEEeCC
Q 019353          202 MNRGEWPPLMVEYDPKEGFTVQADRFIKDLTIITEYVGDVDYLNN---R-----ENDDGDSTMTLLHASNPAQSLVVCPY  273 (342)
Q Consensus       202 ~~~~~~~~~~v~~~~~~G~Gv~a~~~i~~g~~I~ey~Gev~~~~~---~-----~~~~~~~~~~~~~~~~~~~~~~iDa~  273 (342)
                      +|++..++++|+.++.+||||||+++|++|++|+||+|||+....   +     .......|+..+   +  ..++|||+
T Consensus        86 ~q~~~~~~lev~~t~~kG~Gl~A~~~I~~G~~I~ey~Gevi~~~e~~~r~~~~~~~~~~~~y~~~l---~--~~~~IDa~  160 (232)
T 3ooi_A           86 FSKRQYPEVEIFRTLQRGWGLRTKTDIKKGEFVNEYVGELIDEEECRARIRYAQEHDITNFYMLTL---D--KDRIIDAG  160 (232)
T ss_dssp             HHHTCCCCEEEEECSSSSEEEEESSCBCTTCEEEECCEEEECHHHHHHHHHHHHHTTCCCCCEEEE---E--TTEEEEEE
T ss_pred             ccCCCCccEEEEEcCCceeEEEECceecCCceeeEeeeeccCHHHHHHHHHHHhhcCCCceeeeec---C--cceEEecc
Confidence            999999999999999999999999999999999999999976421   1     112233444333   2  57899999


Q ss_pred             CCCCeeeeccCCCCCCCCCCCCCCcEEEEEEECCeEEEEEEEcCCCCCCCeEEEecCCCCC
Q 019353          274 KHGNIARFVNGINNHTADGKKKQNLKCVRYNVNGECRVLLVANRDIAKGERLYYDYNGYEK  334 (342)
Q Consensus       274 ~~GN~aRfin~~~~hSC~~~~~pN~~~~~~~~~~~~~i~l~A~rdI~~GEELt~dY~~~~~  334 (342)
                      .+||+|||||    |||.    |||.++.|.+++..+|+|||+|||++||||||||+++++
T Consensus       161 ~~Gn~aRfiN----HSC~----PN~~~~~~~~~~~~~i~~~A~RdI~~GEELT~dY~~~~~  213 (232)
T 3ooi_A          161 PKGNYARFMN----HCCQ----PNCETQKWSVNGDTRVGLFALSDIKAGTELTFNYNLECL  213 (232)
T ss_dssp             EEECGGGGCE----ECSS----CSEEEEEEEETTEEEEEEEESSCBCTTCBCEECCTTCST
T ss_pred             cccccccccc----ccCC----CCeEEEEEEECCceEEEEEECCccCCCCEEEEECCCCcC
Confidence            9999999999    9999    999999999999999999999999999999999998664
>3ope_A Probable histone-lysine N-methyltransferase ASH1L; SET, nucleus; HET: SAM; 2.90A {Homo sapiens} Back     alignment and structure
>3f9x_A Histone-lysine N-methyltransferase SETD8; methyltransferase, SET, lysine, alternative splicing, cell cycle, cell division, chromatin regulator, chromosomal protein, coiled coil; HET: MLY SAH; 1.25A {Homo sapiens} PDB: 3f9w_A* 3f9y_A* 3f9z_A* 1zkk_A* 4ij8_A* 2bqz_A* Back     alignment and structure
>3hna_A Histone-lysine N-methyltransferase, H3 lysine-9 specific 5; EHMT1, structural genomics, SGC, structural genomics consortium, alternative splicing, ANK repeat; HET: MLZ SAH; 1.50A {Homo sapiens} PDB: 2rfi_A* 2igq_A* 3mo0_A* 3mo2_A* 3mo5_A* 3sw9_A* 3swc_A* 4h4h_A* 4i51_A* 3fpd_A* 3k5k_A* 3nni_A* 3rjw_A* 2o8j_A* Back     alignment and structure
>2w5y_A Histone-lysine N-methyltransferase HRX; transcription regulation, chromosomal rearrangement, protein lysine methyltransferase, proto-oncogene; HET: SAH; 2.00A {Homo sapiens} PDB: 2w5z_A* Back     alignment and structure
>1mvh_A Cryptic LOCI regulator 4; lysine methyltransferase, CLR4, SET-domain; 2.30A {Schizosaccharomyces pombe} SCOP: b.85.7.1 PDB: 1mvx_A Back     alignment and structure
>3bo5_A Histone-lysine N-methyltransferase setmar; SET domain, chromati regulator, DNA damage, DNA repair, DNA-binding, nucleus, ST genomics; HET: SAH; 1.59A {Homo sapiens} Back     alignment and structure
>1ml9_A Histone H3 methyltransferase DIM-5; adoMet-dependent methyltransferase histone H3 lysine- 9 methylation; 1.98A {Neurospora crassa} SCOP: b.85.7.1 PDB: 1peg_A* Back     alignment and structure
>2r3a_A Histone-lysine N-methyltransferase SUV39H2; histone H3-K9 methyltransferase 2, H3 lysine-9 specific 2, alternative splicing, cell cycle; HET: SAM; 2.00A {Homo sapiens} Back     alignment and structure
>2qpw_A PR domain zinc finger protein 2; methyltransferase, activator, alternative initiation, alternative splicing, DNA-binding, metal-binding, nucleus; 1.79A {Homo sapiens} PDB: 2jv0_A* Back     alignment and structure
>1n3j_A A612L, histone H3 lysine methyltransferase; beta barrel, homodimer; NMR {Paramecium bursaria chlorella virus 1} SCOP: b.85.7.2 PDB: 2g46_A* 3kma_A 3kmj_A 3kmt_A* Back     alignment and structure
>2f69_A Histone-lysine N-methyltransferase, H3 lysine-4 specific SET7; SET domain, protein lysine methyltransferase, enzyme- peptide-adohcy complex; HET: MLZ SAH; 1.30A {Homo sapiens} SCOP: b.76.2.1 b.85.7.1 PDB: 3m53_A* 3m55_A* 3m54_A* 3m56_A* 3m58_A* 3m57_A* 3m59_A* 3m5a_A* 1xqh_A* 4e47_A* 1n6a_A* 1o9s_A* 3cbp_A* 3cbm_A* 3cbo_A* 3os5_A* Back     alignment and structure
>1h3i_A Histone H3 lysine 4 specific methyltransferase; 2.1A {Homo sapiens} SCOP: b.76.2.1 b.85.7.1 PDB: 1mt6_A* 1n6c_A* 1muf_A Back     alignment and structure
>3ep0_A PR domain zinc finger protein 12; PR domain-containing protein 12, structural genomics, structural genomics consortium, SGC, DNA-binding; 2.10A {Homo sapiens} Back     alignment and structure
>3s8p_A Histone-lysine N-methyltransferase SUV420H1; SET domain, histone methyltransferase, transcription regulat histone lysine, SAM, methylation, nucleus; HET: MSE SAM; 1.85A {Homo sapiens} Back     alignment and structure
>3db5_A PR domain zinc finger protein 4; methyltransferase, PRDM4, structural genomics, structural GE consortium, SGC, DNA-binding, metal-binding, nucleus; 2.15A {Homo sapiens} Back     alignment and structure
>3rq4_A Histone-lysine N-methyltransferase SUV420H2; suppressor, variegation 4-20 homolog 2, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.80A {Homo sapiens} Back     alignment and structure
>3dal_A PR domain zinc finger protein 1; methyltransferase, PRDM1, structural genomics, structural genomics consortium, SGC, DNA-binding, metal-binding; 1.65A {Homo sapiens} Back     alignment and structure
>3ray_A PR domain-containing protein 11; structural genomics consortium, SGC, histone methylation, Zn transcriptional regulation, chromatin, transcription; 1.73A {Homo sapiens} Back     alignment and structure
>3ihx_A PR domain zinc finger protein 10; PRDM10, methyltransferase, structural genomics, structural G consortium, SGC, DNA-binding, metal-binding, nucleus; 2.50A {Homo sapiens} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>3qxy_A N-lysine methyltransferase SETD6; epigenetics, protein lysine methyltransferase, transferase, network VIA methyllysine signaling; HET: SAM; 2.09A {Homo sapiens} PDB: 3rc0_A* Back     alignment and structure
>2h21_A Ribulose-1,5 bisphosphate carboxylase/oxygenase; SET domain, protein lysine methyltransferase, transferase; HET: SAM; 2.45A {Pisum sativum} SCOP: a.166.1.1 b.85.7.3 PDB: 2h23_A* 2h2e_A* 2h2j_A* 1p0y_A* 1ozv_A* 1mlv_A* Back     alignment and structure
>3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure
>3smt_A Histone-lysine N-methyltransferase SETD3; histone methyltransferase, histone modification, LYSI translational modification, structural genomics; HET: SAM; 2.04A {Homo sapiens} Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 342
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 4e-17
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 1e-16
d1mvha_269 b.85.7.1 (A:) SET domain of Clr4 {Fission yeast (S 4e-16
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 3e-15
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 6e-15
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 6e-14
d1ml9a_284 b.85.7.1 (A:) Dim-5 {Fungus (Neurospora crassa) [T 8e-14
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 2e-13
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 4e-13
d2f69a2171 b.85.7.1 (A:194-364) Histone H3 K4-specific methyl 1e-10
d1wepa_79 g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus 3e-07
d1wesa_71 g.50.1.2 (A:) PHD Inhibitor of growth protein 2, I 2e-06
d2g46a1119 b.85.7.2 (A:1-119) Viral histone H3 Lysine 27 Meth 7e-06
d2pnxa151 g.50.1.2 (A:195-245) Inhibitor of growth protein 4 1e-05
d1wewa_78 g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale c 6e-05
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure

class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: Williams-Beuren syndrome transcription factor, WSTF
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 71.9 bits (176), Expect = 4e-17
 Identities = 26/48 (54%), Positives = 32/48 (66%)

Query: 29 RCEKCGSGDFPDELLLCDKCDKGFHLFCLRPILVSVPKGSWFCPSCSH 76
          RC+ C      D+L+LCD+C+K FHLFCLRP L  VP G W CP+C  
Sbjct: 2  RCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQP 49
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1mvha_ b.85.7.1 (A:) SET domain of Clr4 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 269 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1ml9a_ b.85.7.1 (A:) Dim-5 {Fungus (Neurospora crassa) [TaxId: 5141]} Length = 284 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d2f69a2 b.85.7.1 (A:194-364) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 71 Back     information, alignment and structure
>d2g46a1 b.85.7.2 (A:1-119) Viral histone H3 Lysine 27 Methyltransferase {Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId: 10506]} Length = 119 Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query342
d1mvha_269 SET domain of Clr4 {Fission yeast (Schizosaccharom 99.97
d1ml9a_284 Dim-5 {Fungus (Neurospora crassa) [TaxId: 5141]} 99.95
d2f69a2171 Histone H3 K4-specific methyltransferase SET7/9 ca 99.89
d2g46a1119 Viral histone H3 Lysine 27 Methyltransferase {Para 99.87
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 99.31
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 99.27
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 99.25
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 98.92
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 98.91
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 98.89
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 98.84
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 98.78
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 98.68
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 98.68
d1wema_76 Death associated transcription factor 1, Datf1 (DI 98.63
d2h2ja2261 RuBisCo LSMT catalytic domain {Garden pea (Pisum s 97.74
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 93.58
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 93.37
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 90.29
d2h2ja2 261 RuBisCo LSMT catalytic domain {Garden pea (Pisum s 85.45
d1weqa_85 PHD finger protein 7 (NYD-SP6) {Mouse (Mus musculu 82.88
>d1mvha_ b.85.7.1 (A:) SET domain of Clr4 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
class: All beta proteins
fold: beta-clip
superfamily: SET domain
family: Histone lysine methyltransferases
domain: SET domain of Clr4
species: Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]

Probab=99.97  E-value=3.5e-31  Score=240.61  Aligned_cols=135  Identities=28%  Similarity=0.405  Sum_probs=112.3

Q ss_pred             HhhH-HhhcCCCCccEEeecCCCceeEEEccCCCCCCeEEEccceeecccc---cc---cCCCCceeeeecccCCCCcEE
Q 019353          197 LCKH-MMNRGEWPPLMVEYDPKEGFTVQADRFIKDLTIITEYVGDVDYLNN---RE---NDDGDSTMTLLHASNPAQSLV  269 (342)
Q Consensus       197 ~~~~-~~~~~~~~~~~v~~~~~~G~Gv~a~~~i~~g~~I~ey~Gev~~~~~---~~---~~~~~~~~~~~~~~~~~~~~~  269 (342)
                      .|.| .+|++...+|+|++++.+||||||+++|++|++|+||.|||+....   +.   ......++..+........++
T Consensus       124 ~C~Nr~~q~g~~~~leV~~t~~~G~GvfA~~~I~kGt~I~eY~Gevi~~~e~~~R~~~y~~~~~~~~~~l~~~~~~~~~~  203 (269)
T d1mvha_         124 ECPNRVVQRGRTLPLEIFKTKEKGWGVRSLRFAPAGTFITCYLGEVITSAEAAKRDKNYDDDGITYLFDLDMFDDASEYT  203 (269)
T ss_dssp             TCTTCTGGGCCCSCEEEEECSSSSEEEEESSCBCTTCEEEECCCEEEEHHHHHHHHTTCCSCSCCCEEEECSSCSSSCEE
T ss_pred             CCCCeecCCCCccCEEEEEcCCCCeEEEeCcccCCCceEEEecceEEcHHHHHHHHHhHhhcCCcchhheecccccccce
Confidence            3654 4889999999999999999999999999999999999999986422   11   122334444444444456899


Q ss_pred             EeCCCCCCeeeeccCCCCCCCCCCCCCCcEEEEEEECCe----EEEEEEEcCCCCCCCeEEEecCCCCCCCCCC
Q 019353          270 VCPYKHGNIARFVNGINNHTADGKKKQNLKCVRYNVNGE----CRVLLVANRDIAKGERLYYDYNGYEKEYPTE  339 (342)
Q Consensus       270 iDa~~~GN~aRfin~~~~hSC~~~~~pN~~~~~~~~~~~----~~i~l~A~rdI~~GEELt~dY~~~~~~~~~~  339 (342)
                      |||+..||+|||||    |||+    |||.++.+.+++.    ++|+|||+|||++||||||||++.....|.+
T Consensus       204 iDa~~~GN~aRFiN----HSC~----PN~~~~~v~~~~~~~~~~~i~~fA~rdI~~GEELt~DYG~~~d~~P~~  269 (269)
T d1mvha_         204 VDAQNYGDVSRFFN----HSCS----PNIAIYSAVRNHGFRTIYDLAFFAIKDIQPLEELTFDYAGAKDFSPVQ  269 (269)
T ss_dssp             EECSSEECGGGGCE----ECSS----CSEEEEEEESCTTCTTSCEEEEEESSCBCTTCBCEECCCTTSSSSCCC
T ss_pred             eeeeecCcceEEee----cCCC----CCcEEEEEEecCCcCccceEEEEECCccCCCCEEEEecCCCcCCCCCC
Confidence            99999999999999    9999    9999999998753    7999999999999999999999887777764
>d1ml9a_ b.85.7.1 (A:) Dim-5 {Fungus (Neurospora crassa) [TaxId: 5141]} Back     information, alignment and structure
>d2f69a2 b.85.7.1 (A:194-364) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g46a1 b.85.7.2 (A:1-119) Viral histone H3 Lysine 27 Methyltransferase {Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId: 10506]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h2ja2 b.85.7.3 (A:50-310) RuBisCo LSMT catalytic domain {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h2ja2 b.85.7.3 (A:50-310) RuBisCo LSMT catalytic domain {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1weqa_ g.50.1.2 (A:) PHD finger protein 7 (NYD-SP6) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure