Citrus Sinensis ID: 019876
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 334 | ||||||
| 255573812 | 492 | NADPH:adrenodoxin oxidoreductase, mitoch | 0.997 | 0.676 | 0.819 | 1e-160 | |
| 356513151 | 484 | PREDICTED: NADPH:adrenodoxin oxidoreduct | 0.988 | 0.681 | 0.801 | 1e-154 | |
| 356553385 | 484 | PREDICTED: NADPH:adrenodoxin oxidoreduct | 0.988 | 0.681 | 0.795 | 1e-152 | |
| 225445178 | 486 | PREDICTED: NADPH:adrenodoxin oxidoreduct | 0.991 | 0.681 | 0.819 | 1e-152 | |
| 449432374 | 486 | PREDICTED: NADPH:adrenodoxin oxidoreduct | 1.0 | 0.687 | 0.763 | 1e-149 | |
| 449487548 | 486 | PREDICTED: NADPH:adrenodoxin oxidoreduct | 1.0 | 0.687 | 0.763 | 1e-149 | |
| 224065242 | 496 | predicted protein [Populus trichocarpa] | 0.949 | 0.639 | 0.839 | 1e-148 | |
| 297802792 | 484 | hypothetical protein ARALYDRAFT_913213 [ | 0.997 | 0.688 | 0.746 | 1e-141 | |
| 22329089 | 483 | ferredoxin--NADP+ reductase [Arabidopsis | 0.997 | 0.689 | 0.745 | 1e-137 | |
| 357520949 | 452 | NADPH:adrenodoxin oxidoreductase [Medica | 0.883 | 0.652 | 0.810 | 1e-135 |
| >gi|255573812|ref|XP_002527825.1| NADPH:adrenodoxin oxidoreductase, mitochondrial precursor, putative [Ricinus communis] gi|223532749|gb|EEF34528.1| NADPH:adrenodoxin oxidoreductase, mitochondrial precursor, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 571 bits (1471), Expect = e-160, Method: Compositional matrix adjust.
Identities = 273/333 (81%), Positives = 299/333 (89%)
Query: 2 YKARAWLSRSFTALSSNPLRVCVVGSGPAGFYTAEKTLKAHQEAQVDIIDRLPTPFGLVR 61
YKA WLSR F+ L+S+PLRVCVVGSGPAGFYTAEK LKAH+EA++DIIDRLPTPFGLVR
Sbjct: 10 YKAMKWLSRRFSNLTSHPLRVCVVGSGPAGFYTAEKMLKAHREAEIDIIDRLPTPFGLVR 69
Query: 62 SGVAPDHPETKIVINQFSRVVQHERCSFFGNVTLGSSVSLSELRQLYHVVVLAYGAESDR 121
SGVAPDHPETKIVINQFSR+VQ+ERCSFFGNVTLGSS+SL+ELR LYHVVVLAYGAESDR
Sbjct: 70 SGVAPDHPETKIVINQFSRLVQNERCSFFGNVTLGSSISLAELRDLYHVVVLAYGAESDR 129
Query: 122 ALGIPGEDLIGVHSAREFVWWYNGHPDGKNLSPDLKSTDTAVILGQGNVALDVARILLRP 181
ALGIPGEDL+G+HSAREFVWWYNGHPD KNL+PDLK TDTAVILGQGNVALD RILLRP
Sbjct: 130 ALGIPGEDLLGIHSAREFVWWYNGHPDCKNLNPDLKGTDTAVILGQGNVALDATRILLRP 189
Query: 182 TEELATTDIASYAWTALEGSSIRKVYLVGRRGPVQAACTAKELREILGIKNLYVHIREDD 241
T ELA TDIA +A ALE S IRKVYLVGRRGPVQAACTAKELRE+LGIK+L++HI+E D
Sbjct: 190 TAELARTDIACHALAALEQSCIRKVYLVGRRGPVQAACTAKELREVLGIKDLFIHIKEAD 249
Query: 242 LIKSPTDEEEMKNSRIQRRVYELLSKAAASASSQPMLGQRELHFVFFRKPDSFLESNERS 301
L+KS DEEE+K SRIQRR+Y+LLSKAAAS S P GQRELHFVFFRKPD FL+S R
Sbjct: 250 LLKSSDDEEELKGSRIQRRIYDLLSKAAASGPSHPSSGQRELHFVFFRKPDRFLDSEVRI 309
Query: 302 GHVSGVHFEKTALKGGGPGKQYAVGTGEFEDLD 334
GHV+GVHFEKT LKG PGKQ AVGTG+FEDLD
Sbjct: 310 GHVAGVHFEKTVLKGISPGKQVAVGTGKFEDLD 342
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356513151|ref|XP_003525277.1| PREDICTED: NADPH:adrenodoxin oxidoreductase, mitochondrial-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356553385|ref|XP_003545037.1| PREDICTED: NADPH:adrenodoxin oxidoreductase, mitochondrial-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225445178|ref|XP_002280736.1| PREDICTED: NADPH:adrenodoxin oxidoreductase, mitochondrial [Vitis vinifera] gi|297738792|emb|CBI28037.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449432374|ref|XP_004133974.1| PREDICTED: NADPH:adrenodoxin oxidoreductase, mitochondrial-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449487548|ref|XP_004157681.1| PREDICTED: NADPH:adrenodoxin oxidoreductase, mitochondrial-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224065242|ref|XP_002301734.1| predicted protein [Populus trichocarpa] gi|222843460|gb|EEE81007.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297802792|ref|XP_002869280.1| hypothetical protein ARALYDRAFT_913213 [Arabidopsis lyrata subsp. lyrata] gi|297315116|gb|EFH45539.1| hypothetical protein ARALYDRAFT_913213 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|22329089|ref|NP_194962.2| ferredoxin--NADP+ reductase [Arabidopsis thaliana] gi|17481351|dbj|BAB79228.1| MFDR [Arabidopsis thaliana] gi|28192433|gb|AAL82814.1| NADP adrenodoxin-like ferredoxin reductase [Arabidopsis thaliana] gi|332660646|gb|AEE86046.1| ferredoxin--NADP+ reductase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|357520949|ref|XP_003630763.1| NADPH:adrenodoxin oxidoreductase [Medicago truncatula] gi|355524785|gb|AET05239.1| NADPH:adrenodoxin oxidoreductase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 334 | ||||||
| TAIR|locus:2127811 | 483 | AT4G32360 [Arabidopsis thalian | 0.997 | 0.689 | 0.727 | 7.6e-128 | |
| UNIPROTKB|F1NRB1 | 466 | FDXR "NADPH:adrenodoxin oxidor | 0.955 | 0.684 | 0.473 | 2.1e-70 | |
| MGI|MGI:104724 | 494 | Fdxr "ferredoxin reductase" [M | 0.949 | 0.641 | 0.481 | 1.1e-69 | |
| RGD|621648 | 494 | Fdxr "ferredoxin reductase" [R | 0.949 | 0.641 | 0.472 | 3.5e-68 | |
| UNIPROTKB|P56522 | 494 | Fdxr "NADPH:adrenodoxin oxidor | 0.949 | 0.641 | 0.472 | 3.5e-68 | |
| UNIPROTKB|P08165 | 492 | FDXR "NADPH:adrenodoxin oxidor | 0.943 | 0.640 | 0.469 | 9.2e-68 | |
| UNIPROTKB|P22570 | 491 | FDXR "NADPH:adrenodoxin oxidor | 0.943 | 0.641 | 0.483 | 1.5e-67 | |
| UNIPROTKB|F1RV70 | 492 | FDXR "NADPH:adrenodoxin oxidor | 0.952 | 0.646 | 0.471 | 1.9e-67 | |
| UNIPROTKB|E7EQC1 | 522 | FDXR "NADPH:adrenodoxin oxidor | 0.919 | 0.588 | 0.490 | 3.1e-67 | |
| UNIPROTKB|J3QQX3 | 463 | FDXR "NADPH:adrenodoxin oxidor | 0.625 | 0.451 | 0.606 | 1.4e-66 |
| TAIR|locus:2127811 AT4G32360 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1255 (446.8 bits), Expect = 7.6e-128, P = 7.6e-128
Identities = 243/334 (72%), Positives = 279/334 (83%)
Query: 2 YKARAWLSRSFTALSSNPLRVCVVGSGPAGFYTAEKTLKAHQEAQVDIIDRLPTPFGLVR 61
Y AR +SR F++ SS PL VC+VGSGPAGFYTA+K LKAH+ A VDIIDRLPTPFGLVR
Sbjct: 4 YLARYMVSRYFSSASSRPLHVCIVGSGPAGFYTADKVLKAHEGAHVDIIDRLPTPFGLVR 63
Query: 62 SGVAPDHPETKIVINQFSRVVQHERCSFFGNVTLGSSVSLSELRQLYHVVVLAYGAESDR 121
SGVAPDHPETKI INQFSRV QHERCSF GNV LGS +SLSELR LYHVVVLAYGAESD+
Sbjct: 64 SGVAPDHPETKIAINQFSRVAQHERCSFIGNVKLGSDLSLSELRDLYHVVVLAYGAESDK 123
Query: 122 ALGIPGEDLIGVHSAREFVWWYNGHPDGKNLSPDLKSTDTAVILGQGNVALDVARILLRP 181
LGIPGE L G++SAREFVWWYNGHPD +L PDLK++D+AVILGQGNVALDVARILLRP
Sbjct: 124 DLGIPGESLSGIYSAREFVWWYNGHPDYSSLKPDLKTSDSAVILGQGNVALDVARILLRP 183
Query: 182 TEELATTDIASYAWTALEGSSIRKVYLVGRRGPVQAACTAKELREILGIKNLYVHIREDD 241
T ELA+TDIA++A +AL+ SSIRKVYL+GRRGPVQAA TAKELRE+LGIKNL++ I++ D
Sbjct: 184 TTELASTDIATHALSALKESSIRKVYLIGRRGPVQAALTAKELREVLGIKNLHIRIKQTD 243
Query: 242 LIKSPTDEEEMKNSRIQRRVYELLXXXXXXX-XXQPMLGQRELHFVFFRKPDSFLESNER 300
L +P DEEEMK SR ++R+YELL + QRELHFVFFR+PD FLES+ER
Sbjct: 244 LSVTPADEEEMKTSRARKRIYELLSKAAAAAKTSEADPDQRELHFVFFRQPDQFLESDER 303
Query: 301 SGHVSGVHFEKTALKGGGPGKQYAVGTGEFEDLD 334
GHVSGV+ +KT L+ G GKQ AVGTGEFEDL+
Sbjct: 304 KGHVSGVNLQKTILESVGTGKQIAVGTGEFEDLN 337
|
|
| UNIPROTKB|F1NRB1 FDXR "NADPH:adrenodoxin oxidoreductase, mitochondrial" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:104724 Fdxr "ferredoxin reductase" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|621648 Fdxr "ferredoxin reductase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P56522 Fdxr "NADPH:adrenodoxin oxidoreductase, mitochondrial" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P08165 FDXR "NADPH:adrenodoxin oxidoreductase, mitochondrial" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P22570 FDXR "NADPH:adrenodoxin oxidoreductase, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RV70 FDXR "NADPH:adrenodoxin oxidoreductase, mitochondrial" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7EQC1 FDXR "NADPH:adrenodoxin oxidoreductase, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3QQX3 FDXR "NADPH:adrenodoxin oxidoreductase, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 334 | |||
| PLN02852 | 491 | PLN02852, PLN02852, ferredoxin-NADP+ reductase | 0.0 | |
| PTZ00188 | 506 | PTZ00188, PTZ00188, adrenodoxin reductase; Provisi | 3e-48 | |
| COG0493 | 457 | COG0493, GltD, NADPH-dependent glutamate synthase | 1e-24 | |
| PRK11749 | 457 | PRK11749, PRK11749, dihydropyrimidine dehydrogenas | 3e-22 | |
| COG0493 | 457 | COG0493, GltD, NADPH-dependent glutamate synthase | 1e-19 | |
| TIGR01316 | 449 | TIGR01316, gltA, glutamate synthase (NADPH), homot | 2e-16 | |
| TIGR01317 | 485 | TIGR01317, GOGAT_sm_gam, glutamate synthases, NADH | 5e-16 | |
| PRK12770 | 352 | PRK12770, PRK12770, putative glutamate synthase su | 1e-15 | |
| PRK12810 | 471 | PRK12810, gltD, glutamate synthase subunit beta; R | 1e-15 | |
| PRK12814 | 652 | PRK12814, PRK12814, putative NADPH-dependent gluta | 4e-15 | |
| PRK12771 | 564 | PRK12771, PRK12771, putative glutamate synthase (N | 1e-13 | |
| PRK12831 | 464 | PRK12831, PRK12831, putative oxidoreductase; Provi | 3e-13 | |
| TIGR01318 | 467 | TIGR01318, gltD_gamma_fam, glutamate synthase smal | 5e-13 | |
| PRK13984 | 604 | PRK13984, PRK13984, putative oxidoreductase; Provi | 3e-12 | |
| PRK12778 | 752 | PRK12778, PRK12778, putative bifunctional 2-polypr | 1e-11 | |
| PRK12809 | 639 | PRK12809, PRK12809, putative oxidoreductase Fe-S b | 2e-11 | |
| PRK09853 | 1019 | PRK09853, PRK09853, putative selenate reductase su | 6e-09 | |
| PRK12779 | 944 | PRK12779, PRK12779, putative bifunctional glutamat | 1e-08 | |
| PRK12775 | 1006 | PRK12775, PRK12775, putative trifunctional 2-polyp | 6e-08 | |
| TIGR03315 | 1012 | TIGR03315, Se_ygfK, putative selenate reductase, Y | 1e-07 | |
| PRK12769 | 654 | PRK12769, PRK12769, putative oxidoreductase Fe-S b | 2e-07 | |
| pfam07992 | 283 | pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp | 6e-06 |
| >gnl|CDD|215457 PLN02852, PLN02852, ferredoxin-NADP+ reductase | Back alignment and domain information |
|---|
Score = 607 bits (1566), Expect = 0.0
Identities = 249/340 (73%), Positives = 278/340 (81%), Gaps = 6/340 (1%)
Query: 1 MYKARAWLSRSF-----TALSSNPLRVCVVGSGPAGFYTAEKTLKAHQEAQVDIIDRLPT 55
+AR WLSR+ ++ +S PL VCVVGSGPAGFYTA+K LKAH A+VDII+RLPT
Sbjct: 3 RLRARTWLSRALSFSNSSSSTSEPLHVCVVGSGPAGFYTADKLLKAHDGARVDIIERLPT 62
Query: 56 PFGLVRSGVAPDHPETKIVINQFSRVVQHERCSFFGNVTLGSSVSLSELRQLYHVVVLAY 115
PFGLVRSGVAPDHPETK V NQFSRV +R SFFGNVTLG VSLSELR LYHVVVLAY
Sbjct: 63 PFGLVRSGVAPDHPETKNVTNQFSRVATDDRVSFFGNVTLGRDVSLSELRDLYHVVVLAY 122
Query: 116 GAESDRALGIPGEDLIGVHSAREFVWWYNGHPDGKNLSPDLKSTDTAVILGQGNVALDVA 175
GAESDR LGIPGEDL GV SAREFVWWYNGHPD +L PDLKS+DTAV+LGQGNVALD A
Sbjct: 123 GAESDRRLGIPGEDLPGVLSAREFVWWYNGHPDCVHLPPDLKSSDTAVVLGQGNVALDCA 182
Query: 176 RILLRPTEELATTDIASYAWTALEGSSIRKVYLVGRRGPVQAACTAKELREILGIKNLYV 235
RILLRPT+ELA+TDIA +A AL GSS+RKVYLVGRRGPVQAACTAKELRE+LG+KN+ V
Sbjct: 183 RILLRPTDELASTDIAEHALEALRGSSVRKVYLVGRRGPVQAACTAKELRELLGLKNVRV 242
Query: 236 HIREDDLIKSPTDEEEMKNSRIQRRVYELLSKAAASASSQPMLGQRELHFVFFRKPDSFL 295
I+E DL SP DEEE+K SR +RRVYELLSKAAA+ P GQRELHFVFFR P FL
Sbjct: 243 RIKEADLTLSPEDEEELKASRPKRRVYELLSKAAAAGKCAPSGGQRELHFVFFRNPTRFL 302
Query: 296 ESNERSGHVSGVHFEKTALKG-GGPGKQYAVGTGEFEDLD 334
+S + +GHV+GV E+T L+G G GKQ AVGTGEFEDL
Sbjct: 303 DSGDGNGHVAGVKLERTVLEGAAGSGKQVAVGTGEFEDLP 342
|
Length = 491 |
| >gnl|CDD|240308 PTZ00188, PTZ00188, adrenodoxin reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223567 COG0493, GltD, NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|236967 PRK11749, PRK11749, dihydropyrimidine dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223567 COG0493, GltD, NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|130383 TIGR01316, gltA, glutamate synthase (NADPH), homotetrameric | Back alignment and domain information |
|---|
| >gnl|CDD|162300 TIGR01317, GOGAT_sm_gam, glutamate synthases, NADH/NADPH, small subunit | Back alignment and domain information |
|---|
| >gnl|CDD|237197 PRK12770, PRK12770, putative glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237213 PRK12810, gltD, glutamate synthase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|139246 PRK12814, PRK12814, putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237198 PRK12771, PRK12771, putative glutamate synthase (NADPH) small subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183780 PRK12831, PRK12831, putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130385 TIGR01318, gltD_gamma_fam, glutamate synthase small subunit family protein, proteobacterial | Back alignment and domain information |
|---|
| >gnl|CDD|172486 PRK13984, PRK13984, putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237200 PRK12778, PRK12778, putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183762 PRK12809, PRK12809, putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236630 PRK09853, PRK09853, putative selenate reductase subunit YgfK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183740 PRK12779, PRK12779, putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183738 PRK12775, PRK12775, putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132358 TIGR03315, Se_ygfK, putative selenate reductase, YgfK subunit | Back alignment and domain information |
|---|
| >gnl|CDD|183733 PRK12769, PRK12769, putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 334 | |||
| PLN02852 | 491 | ferredoxin-NADP+ reductase | 100.0 | |
| KOG1800 | 468 | consensus Ferredoxin/adrenodoxin reductase [Nucleo | 100.0 | |
| PTZ00188 | 506 | adrenodoxin reductase; Provisional | 100.0 | |
| PRK12779 | 944 | putative bifunctional glutamate synthase subunit b | 100.0 | |
| PRK12775 | 1006 | putative trifunctional 2-polyprenylphenol hydroxyl | 99.98 | |
| PRK12831 | 464 | putative oxidoreductase; Provisional | 99.98 | |
| TIGR01316 | 449 | gltA glutamate synthase (NADPH), homotetrameric. T | 99.97 | |
| PRK12778 | 752 | putative bifunctional 2-polyprenylphenol hydroxyla | 99.97 | |
| PRK12769 | 654 | putative oxidoreductase Fe-S binding subunit; Revi | 99.96 | |
| PRK12809 | 639 | putative oxidoreductase Fe-S binding subunit; Revi | 99.96 | |
| TIGR01318 | 467 | gltD_gamma_fam glutamate synthase small subunit fa | 99.96 | |
| PRK11749 | 457 | dihydropyrimidine dehydrogenase subunit A; Provisi | 99.96 | |
| PRK09853 | 1019 | putative selenate reductase subunit YgfK; Provisio | 99.95 | |
| PRK12814 | 652 | putative NADPH-dependent glutamate synthase small | 99.95 | |
| PRK06567 | 1028 | putative bifunctional glutamate synthase subunit b | 99.95 | |
| COG0493 | 457 | GltD NADPH-dependent glutamate synthase beta chain | 99.95 | |
| TIGR01317 | 485 | GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal | 99.95 | |
| PRK12810 | 471 | gltD glutamate synthase subunit beta; Reviewed | 99.94 | |
| TIGR03315 | 1012 | Se_ygfK putative selenate reductase, YgfK subunit. | 99.94 | |
| PRK13984 | 604 | putative oxidoreductase; Provisional | 99.93 | |
| PRK12770 | 352 | putative glutamate synthase subunit beta; Provisio | 99.93 | |
| PRK12771 | 564 | putative glutamate synthase (NADPH) small subunit; | 99.92 | |
| PRK06370 | 463 | mercuric reductase; Validated | 99.9 | |
| COG0492 | 305 | TrxB Thioredoxin reductase [Posttranslational modi | 99.9 | |
| TIGR01421 | 450 | gluta_reduc_1 glutathione-disulfide reductase, ani | 99.9 | |
| PRK07251 | 438 | pyridine nucleotide-disulfide oxidoreductase; Prov | 99.9 | |
| COG1249 | 454 | Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, | 99.89 | |
| TIGR02053 | 463 | MerA mercuric reductase. This model represents the | 99.89 | |
| KOG0399 | 2142 | consensus Glutamate synthase [Amino acid transport | 99.89 | |
| PRK05249 | 461 | soluble pyridine nucleotide transhydrogenase; Prov | 99.88 | |
| PRK09564 | 444 | coenzyme A disulfide reductase; Reviewed | 99.88 | |
| PRK08010 | 441 | pyridine nucleotide-disulfide oxidoreductase; Prov | 99.88 | |
| TIGR01424 | 446 | gluta_reduc_2 glutathione-disulfide reductase, pla | 99.88 | |
| PRK04965 | 377 | NADH:flavorubredoxin oxidoreductase; Provisional | 99.88 | |
| TIGR02374 | 785 | nitri_red_nirB nitrite reductase [NAD(P)H], large | 99.88 | |
| PRK14989 | 847 | nitrite reductase subunit NirD; Provisional | 99.87 | |
| KOG0404 | 322 | consensus Thioredoxin reductase [Posttranslational | 99.87 | |
| PTZ00058 | 561 | glutathione reductase; Provisional | 99.87 | |
| PRK06467 | 471 | dihydrolipoamide dehydrogenase; Reviewed | 99.87 | |
| PRK06416 | 462 | dihydrolipoamide dehydrogenase; Reviewed | 99.87 | |
| PRK06116 | 450 | glutathione reductase; Validated | 99.87 | |
| PRK09754 | 396 | phenylpropionate dioxygenase ferredoxin reductase | 99.87 | |
| PLN02546 | 558 | glutathione reductase | 99.87 | |
| PRK05976 | 472 | dihydrolipoamide dehydrogenase; Validated | 99.87 | |
| PRK10262 | 321 | thioredoxin reductase; Provisional | 99.87 | |
| PLN02507 | 499 | glutathione reductase | 99.86 | |
| PRK07845 | 466 | flavoprotein disulfide reductase; Reviewed | 99.86 | |
| PRK14694 | 468 | putative mercuric reductase; Provisional | 99.86 | |
| PRK06912 | 458 | acoL dihydrolipoamide dehydrogenase; Validated | 99.86 | |
| TIGR03143 | 555 | AhpF_homolog putative alkyl hydroperoxide reductas | 99.86 | |
| PRK06115 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 99.85 | |
| TIGR01292 | 300 | TRX_reduct thioredoxin-disulfide reductase. This m | 99.85 | |
| TIGR01350 | 461 | lipoamide_DH dihydrolipoamide dehydrogenase. The m | 99.85 | |
| TIGR01423 | 486 | trypano_reduc trypanothione-disulfide reductase. T | 99.85 | |
| COG1252 | 405 | Ndh NADH dehydrogenase, FAD-containing subunit [En | 99.85 | |
| PLN02172 | 461 | flavin-containing monooxygenase FMO GS-OX | 99.85 | |
| PRK07846 | 451 | mycothione reductase; Reviewed | 99.85 | |
| PRK13748 | 561 | putative mercuric reductase; Provisional | 99.85 | |
| PRK13512 | 438 | coenzyme A disulfide reductase; Provisional | 99.84 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 99.84 | |
| KOG1336 | 478 | consensus Monodehydroascorbate/ferredoxin reductas | 99.84 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 99.84 | |
| PF13738 | 203 | Pyr_redox_3: Pyridine nucleotide-disulphide oxidor | 99.84 | |
| PRK14727 | 479 | putative mercuric reductase; Provisional | 99.84 | |
| TIGR01372 | 985 | soxA sarcosine oxidase, alpha subunit family, hete | 99.84 | |
| PRK07818 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 99.83 | |
| PRK06292 | 460 | dihydrolipoamide dehydrogenase; Validated | 99.83 | |
| PF00743 | 531 | FMO-like: Flavin-binding monooxygenase-like; Inter | 99.83 | |
| TIGR01438 | 484 | TGR thioredoxin and glutathione reductase selenopr | 99.82 | |
| PRK06327 | 475 | dihydrolipoamide dehydrogenase; Validated | 99.82 | |
| COG1251 | 793 | NirB NAD(P)H-nitrite reductase [Energy production | 99.82 | |
| PTZ00153 | 659 | lipoamide dehydrogenase; Provisional | 99.82 | |
| PTZ00052 | 499 | thioredoxin reductase; Provisional | 99.82 | |
| TIGR03169 | 364 | Nterm_to_SelD pyridine nucleotide-disulfide oxidor | 99.82 | |
| PTZ00318 | 424 | NADH dehydrogenase-like protein; Provisional | 99.8 | |
| COG3634 | 520 | AhpF Alkyl hydroperoxide reductase, large subunit | 99.8 | |
| COG2072 | 443 | TrkA Predicted flavoprotein involved in K+ transpo | 99.78 | |
| TIGR03452 | 452 | mycothione_red mycothione reductase. Mycothiol, a | 99.78 | |
| KOG1399 | 448 | consensus Flavin-containing monooxygenase [Seconda | 99.74 | |
| KOG1335 | 506 | consensus Dihydrolipoamide dehydrogenase [Energy p | 99.71 | |
| KOG0405 | 478 | consensus Pyridine nucleotide-disulphide oxidoredu | 99.71 | |
| TIGR03385 | 427 | CoA_CoA_reduc CoA-disulfide reductase. Members of | 99.59 | |
| KOG4716 | 503 | consensus Thioredoxin reductase [Posttranslational | 99.58 | |
| KOG2495 | 491 | consensus NADH-dehydrogenase (ubiquinone) [Energy | 99.54 | |
| COG0446 | 415 | HcaD Uncharacterized NAD(FAD)-dependent dehydrogen | 99.51 | |
| PF13434 | 341 | K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi | 99.36 | |
| PRK09897 | 534 | hypothetical protein; Provisional | 99.27 | |
| PF07992 | 201 | Pyr_redox_2: Pyridine nucleotide-disulphide oxidor | 99.27 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 99.12 | |
| COG4529 | 474 | Uncharacterized protein conserved in bacteria [Fun | 99.11 | |
| COG2081 | 408 | Predicted flavoproteins [General function predicti | 99.01 | |
| KOG2755 | 334 | consensus Oxidoreductase [General function predict | 98.93 | |
| PF03486 | 409 | HI0933_like: HI0933-like protein; InterPro: IPR004 | 98.92 | |
| KOG1346 | 659 | consensus Programmed cell death 8 (apoptosis-induc | 98.84 | |
| COG3486 | 436 | IucD Lysine/ornithine N-monooxygenase [Secondary m | 98.82 | |
| PRK04176 | 257 | ribulose-1,5-biphosphate synthetase; Provisional | 98.73 | |
| TIGR00292 | 254 | thiazole biosynthesis enzyme. This enzyme is invol | 98.55 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 98.55 | |
| TIGR02032 | 295 | GG-red-SF geranylgeranyl reductase family. This mo | 98.54 | |
| COG0644 | 396 | FixC Dehydrogenases (flavoproteins) [Energy produc | 98.51 | |
| COG1635 | 262 | THI4 Ribulose 1,5-bisphosphate synthetase, convert | 98.51 | |
| COG1249 | 454 | Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, | 98.47 | |
| PLN02463 | 447 | lycopene beta cyclase | 98.47 | |
| PF01946 | 230 | Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. | 98.46 | |
| TIGR00275 | 400 | flavoprotein, HI0933 family. The model when search | 98.43 | |
| PF13450 | 68 | NAD_binding_8: NAD(P)-binding Rossmann-like domain | 98.43 | |
| PRK06847 | 375 | hypothetical protein; Provisional | 98.4 | |
| PLN02661 | 357 | Putative thiazole synthesis | 98.38 | |
| PRK10157 | 428 | putative oxidoreductase FixC; Provisional | 98.38 | |
| TIGR01790 | 388 | carotene-cycl lycopene cyclase family protein. Thi | 98.37 | |
| PRK07251 | 438 | pyridine nucleotide-disulfide oxidoreductase; Prov | 98.37 | |
| TIGR02028 | 398 | ChlP geranylgeranyl reductase. This model represen | 98.29 | |
| PRK10015 | 429 | oxidoreductase; Provisional | 98.29 | |
| PRK12842 | 574 | putative succinate dehydrogenase; Reviewed | 98.27 | |
| PRK05976 | 472 | dihydrolipoamide dehydrogenase; Validated | 98.27 | |
| TIGR01350 | 461 | lipoamide_DH dihydrolipoamide dehydrogenase. The m | 98.27 | |
| PRK07333 | 403 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio | 98.26 | |
| PF01266 | 358 | DAO: FAD dependent oxidoreductase; InterPro: IPR00 | 98.24 | |
| TIGR02053 | 463 | MerA mercuric reductase. This model represents the | 98.24 | |
| PRK04965 | 377 | NADH:flavorubredoxin oxidoreductase; Provisional | 98.23 | |
| PRK06912 | 458 | acoL dihydrolipoamide dehydrogenase; Validated | 98.23 | |
| PRK08255 | 765 | salicylyl-CoA 5-hydroxylase; Reviewed | 98.23 | |
| PRK09754 | 396 | phenylpropionate dioxygenase ferredoxin reductase | 98.22 | |
| KOG3851 | 446 | consensus Sulfide:quinone oxidoreductase/flavo-bin | 98.22 | |
| PRK06416 | 462 | dihydrolipoamide dehydrogenase; Reviewed | 98.21 | |
| PRK09564 | 444 | coenzyme A disulfide reductase; Reviewed | 98.21 | |
| PF12831 | 428 | FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 | 98.19 | |
| PRK13512 | 438 | coenzyme A disulfide reductase; Provisional | 98.18 | |
| TIGR03385 | 427 | CoA_CoA_reduc CoA-disulfide reductase. Members of | 98.18 | |
| TIGR02023 | 388 | BchP-ChlP geranylgeranyl reductase. This model rep | 98.17 | |
| PRK06834 | 488 | hypothetical protein; Provisional | 98.17 | |
| PF01494 | 356 | FAD_binding_3: FAD binding domain; InterPro: IPR00 | 98.17 | |
| PRK07608 | 388 | ubiquinone biosynthesis hydroxylase family protein | 98.16 | |
| PRK05714 | 405 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 98.16 | |
| PRK06327 | 475 | dihydrolipoamide dehydrogenase; Validated | 98.16 | |
| PF13454 | 156 | NAD_binding_9: FAD-NAD(P)-binding | 98.15 | |
| PRK08010 | 441 | pyridine nucleotide-disulfide oxidoreductase; Prov | 98.15 | |
| PRK06370 | 463 | mercuric reductase; Validated | 98.15 | |
| PRK07818 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 98.14 | |
| PRK06184 | 502 | hypothetical protein; Provisional | 98.14 | |
| COG1252 | 405 | Ndh NADH dehydrogenase, FAD-containing subunit [En | 98.14 | |
| PRK14694 | 468 | putative mercuric reductase; Provisional | 98.14 | |
| PRK08163 | 396 | salicylate hydroxylase; Provisional | 98.14 | |
| PRK08773 | 392 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 98.13 | |
| PRK07236 | 386 | hypothetical protein; Provisional | 98.13 | |
| TIGR01421 | 450 | gluta_reduc_1 glutathione-disulfide reductase, ani | 98.13 | |
| COG1232 | 444 | HemY Protoporphyrinogen oxidase [Coenzyme metaboli | 98.12 | |
| PLN00093 | 450 | geranylgeranyl diphosphate reductase; Provisional | 98.12 | |
| PRK11883 | 451 | protoporphyrinogen oxidase; Reviewed | 98.12 | |
| PF01134 | 392 | GIDA: Glucose inhibited division protein A; InterP | 98.11 | |
| TIGR01424 | 446 | gluta_reduc_2 glutathione-disulfide reductase, pla | 98.11 | |
| KOG0029 | 501 | consensus Amine oxidase [Secondary metabolites bio | 98.1 | |
| PRK11728 | 393 | hydroxyglutarate oxidase; Provisional | 98.09 | |
| PLN02697 | 529 | lycopene epsilon cyclase | 98.09 | |
| PRK05249 | 461 | soluble pyridine nucleotide transhydrogenase; Prov | 98.08 | |
| PRK05192 | 618 | tRNA uridine 5-carboxymethylaminomethyl modificati | 98.08 | |
| PRK14727 | 479 | putative mercuric reductase; Provisional | 98.08 | |
| PRK06115 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 98.08 | |
| PRK06116 | 450 | glutathione reductase; Validated | 98.07 | |
| COG1233 | 487 | Phytoene dehydrogenase and related proteins [Secon | 98.06 | |
| PRK08020 | 391 | ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin | 98.06 | |
| PRK13748 | 561 | putative mercuric reductase; Provisional | 98.05 | |
| TIGR03329 | 460 | Phn_aa_oxid putative aminophosphonate oxidoreducta | 98.04 | |
| PRK05329 | 422 | anaerobic glycerol-3-phosphate dehydrogenase subun | 98.04 | |
| PLN02507 | 499 | glutathione reductase | 98.03 | |
| PRK06617 | 374 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 98.02 | |
| PRK08244 | 493 | hypothetical protein; Provisional | 98.02 | |
| PRK07845 | 466 | flavoprotein disulfide reductase; Reviewed | 98.01 | |
| PRK07588 | 391 | hypothetical protein; Provisional | 98.01 | |
| PRK06183 | 538 | mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va | 98.0 | |
| PRK11445 | 351 | putative oxidoreductase; Provisional | 98.0 | |
| TIGR01438 | 484 | TGR thioredoxin and glutathione reductase selenopr | 97.98 | |
| COG0446 | 415 | HcaD Uncharacterized NAD(FAD)-dependent dehydrogen | 97.97 | |
| TIGR02374 | 785 | nitri_red_nirB nitrite reductase [NAD(P)H], large | 97.97 | |
| PTZ00318 | 424 | NADH dehydrogenase-like protein; Provisional | 97.97 | |
| PRK14989 | 847 | nitrite reductase subunit NirD; Provisional | 97.96 | |
| COG1148 | 622 | HdrA Heterodisulfide reductase, subunit A and rela | 97.95 | |
| PRK07846 | 451 | mycothione reductase; Reviewed | 97.94 | |
| PRK08401 | 466 | L-aspartate oxidase; Provisional | 97.94 | |
| PTZ00058 | 561 | glutathione reductase; Provisional | 97.93 | |
| PRK06467 | 471 | dihydrolipoamide dehydrogenase; Reviewed | 97.92 | |
| COG3349 | 485 | Uncharacterized conserved protein [Function unknow | 97.92 | |
| TIGR01423 | 486 | trypano_reduc trypanothione-disulfide reductase. T | 97.92 | |
| PRK13977 | 576 | myosin-cross-reactive antigen; Provisional | 97.91 | |
| PRK07208 | 479 | hypothetical protein; Provisional | 97.91 | |
| PRK05945 | 575 | sdhA succinate dehydrogenase flavoprotein subunit; | 97.9 | |
| KOG1336 | 478 | consensus Monodehydroascorbate/ferredoxin reductas | 97.89 | |
| PLN02576 | 496 | protoporphyrinogen oxidase | 97.89 | |
| PTZ00052 | 499 | thioredoxin reductase; Provisional | 97.89 | |
| PRK07233 | 434 | hypothetical protein; Provisional | 97.87 | |
| TIGR03452 | 452 | mycothione_red mycothione reductase. Mycothiol, a | 97.86 | |
| KOG1276 | 491 | consensus Protoporphyrinogen oxidase [Coenzyme tra | 97.86 | |
| PRK06292 | 460 | dihydrolipoamide dehydrogenase; Validated | 97.86 | |
| PTZ00153 | 659 | lipoamide dehydrogenase; Provisional | 97.86 | |
| TIGR00562 | 462 | proto_IX_ox protoporphyrinogen oxidase. This prote | 97.86 | |
| PRK12416 | 463 | protoporphyrinogen oxidase; Provisional | 97.85 | |
| KOG1335 | 506 | consensus Dihydrolipoamide dehydrogenase [Energy p | 97.85 | |
| PLN02268 | 435 | probable polyamine oxidase | 97.84 | |
| PRK01438 | 480 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 97.83 | |
| PLN02546 | 558 | glutathione reductase | 97.83 | |
| TIGR02733 | 492 | desat_CrtD C-3',4' desaturase CrtD. Members of thi | 97.83 | |
| PRK06996 | 398 | hypothetical protein; Provisional | 97.82 | |
| PF05834 | 374 | Lycopene_cycl: Lycopene cyclase protein; InterPro: | 97.8 | |
| TIGR03169 | 364 | Nterm_to_SelD pyridine nucleotide-disulfide oxidor | 97.78 | |
| TIGR02734 | 502 | crtI_fam phytoene desaturase. Phytoene is converte | 97.76 | |
| PRK07804 | 541 | L-aspartate oxidase; Provisional | 97.76 | |
| PRK10262 | 321 | thioredoxin reductase; Provisional | 97.76 | |
| PRK07364 | 415 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 97.75 | |
| COG3380 | 331 | Predicted NAD/FAD-dependent oxidoreductase [Genera | 97.71 | |
| PRK06753 | 373 | hypothetical protein; Provisional | 97.71 | |
| TIGR01789 | 370 | lycopene_cycl lycopene cyclase. This model represe | 97.7 | |
| TIGR00031 | 377 | UDP-GALP_mutase UDP-galactopyranose mutase. The ge | 97.7 | |
| TIGR02731 | 453 | phytoene_desat phytoene desaturase. Plants and cya | 97.69 | |
| PRK07045 | 388 | putative monooxygenase; Reviewed | 97.69 | |
| KOG0685 | 498 | consensus Flavin-containing amine oxidase [Coenzym | 97.68 | |
| TIGR00136 | 617 | gidA glucose-inhibited division protein A. GidA, t | 97.67 | |
| PRK06263 | 543 | sdhA succinate dehydrogenase flavoprotein subunit; | 97.67 | |
| PLN02568 | 539 | polyamine oxidase | 97.65 | |
| TIGR00551 | 488 | nadB L-aspartate oxidase. L-aspartate oxidase is t | 97.64 | |
| TIGR02730 | 493 | carot_isom carotene isomerase. Members of this fam | 97.62 | |
| COG2907 | 447 | Predicted NAD/FAD-binding protein [General functio | 97.6 | |
| PRK07494 | 388 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio | 97.58 | |
| PF03486 | 409 | HI0933_like: HI0933-like protein; InterPro: IPR004 | 97.57 | |
| TIGR03378 | 419 | glycerol3P_GlpB glycerol-3-phosphate dehydrogenase | 97.57 | |
| KOG2495 | 491 | consensus NADH-dehydrogenase (ubiquinone) [Energy | 97.56 | |
| PRK07538 | 413 | hypothetical protein; Provisional | 97.56 | |
| PRK08013 | 400 | oxidoreductase; Provisional | 97.56 | |
| PRK08849 | 384 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 97.55 | |
| PLN02529 | 738 | lysine-specific histone demethylase 1 | 97.54 | |
| TIGR01988 | 385 | Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub | 97.54 | |
| PRK05868 | 372 | hypothetical protein; Validated | 97.54 | |
| PRK09126 | 392 | hypothetical protein; Provisional | 97.53 | |
| COG0654 | 387 | UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and | 97.51 | |
| PRK05732 | 395 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 97.51 | |
| TIGR02360 | 390 | pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. | 97.49 | |
| TIGR01373 | 407 | soxB sarcosine oxidase, beta subunit family, heter | 97.48 | |
| PRK06475 | 400 | salicylate hydroxylase; Provisional | 97.47 | |
| KOG2415 | 621 | consensus Electron transfer flavoprotein ubiquinon | 97.47 | |
| PLN02676 | 487 | polyamine oxidase | 97.46 | |
| TIGR03219 | 414 | salicylate_mono salicylate 1-monooxygenase. Member | 97.45 | |
| TIGR02732 | 474 | zeta_caro_desat carotene 7,8-desaturase. Carotene | 97.45 | |
| PLN02487 | 569 | zeta-carotene desaturase | 97.45 | |
| PRK07190 | 487 | hypothetical protein; Provisional | 97.42 | |
| PRK06126 | 545 | hypothetical protein; Provisional | 97.42 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 97.42 | |
| PLN02328 | 808 | lysine-specific histone demethylase 1 homolog | 97.41 | |
| KOG2820 | 399 | consensus FAD-dependent oxidoreductase [General fu | 97.41 | |
| COG0493 | 457 | GltD NADPH-dependent glutamate synthase beta chain | 97.4 | |
| PRK08243 | 392 | 4-hydroxybenzoate 3-monooxygenase; Validated | 97.4 | |
| COG2081 | 408 | Predicted flavoproteins [General function predicti | 97.39 | |
| PRK12409 | 410 | D-amino acid dehydrogenase small subunit; Provisio | 97.37 | |
| PRK06185 | 407 | hypothetical protein; Provisional | 97.36 | |
| PLN02612 | 567 | phytoene desaturase | 97.36 | |
| PLN02985 | 514 | squalene monooxygenase | 97.35 | |
| PRK05335 | 436 | tRNA (uracil-5-)-methyltransferase Gid; Reviewed | 97.34 | |
| PRK08850 | 405 | 2-octaprenyl-6-methoxyphenol hydroxylase; Validate | 97.33 | |
| COG0562 | 374 | Glf UDP-galactopyranose mutase [Cell envelope biog | 97.33 | |
| PF00890 | 417 | FAD_binding_2: FAD binding domain of the Pfam fami | 97.33 | |
| COG1635 | 262 | THI4 Ribulose 1,5-bisphosphate synthetase, convert | 97.33 | |
| TIGR01989 | 437 | COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T | 97.3 | |
| PRK05257 | 494 | malate:quinone oxidoreductase; Validated | 97.3 | |
| TIGR01292 | 300 | TRX_reduct thioredoxin-disulfide reductase. This m | 97.3 | |
| TIGR01316 | 449 | gltA glutamate synthase (NADPH), homotetrameric. T | 97.29 | |
| PLN02927 | 668 | antheraxanthin epoxidase/zeaxanthin epoxidase | 97.28 | |
| COG1231 | 450 | Monoamine oxidase [Amino acid transport and metabo | 97.26 | |
| PRK06481 | 506 | fumarate reductase flavoprotein subunit; Validated | 97.26 | |
| COG1004 | 414 | Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en | 97.26 | |
| TIGR01984 | 382 | UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T | 97.25 | |
| PRK08132 | 547 | FAD-dependent oxidoreductase; Provisional | 97.25 | |
| COG0445 | 621 | GidA Flavin-dependent tRNA uridine 5-carboxymethyl | 97.22 | |
| PRK11259 | 376 | solA N-methyltryptophan oxidase; Provisional | 97.22 | |
| TIGR01377 | 380 | soxA_mon sarcosine oxidase, monomeric form. Sarcos | 97.21 | |
| COG0665 | 387 | DadA Glycine/D-amino acid oxidases (deaminating) [ | 97.21 | |
| PRK12831 | 464 | putative oxidoreductase; Provisional | 97.19 | |
| PRK12770 | 352 | putative glutamate synthase subunit beta; Provisio | 97.19 | |
| KOG2960 | 328 | consensus Protein involved in thiamine biosynthesi | 97.18 | |
| PRK08274 | 466 | tricarballylate dehydrogenase; Validated | 97.17 | |
| PRK00711 | 416 | D-amino acid dehydrogenase small subunit; Validate | 97.16 | |
| PLN03000 | 881 | amine oxidase | 97.16 | |
| PRK12266 | 508 | glpD glycerol-3-phosphate dehydrogenase; Reviewed | 97.15 | |
| PRK07121 | 492 | hypothetical protein; Validated | 97.15 | |
| PRK08294 | 634 | phenol 2-monooxygenase; Provisional | 97.13 | |
| TIGR01320 | 483 | mal_quin_oxido malate:quinone-oxidoreductase. This | 97.13 | |
| PRK12839 | 572 | hypothetical protein; Provisional | 97.13 | |
| COG0579 | 429 | Predicted dehydrogenase [General function predicti | 97.11 | |
| PTZ00367 | 567 | squalene epoxidase; Provisional | 97.11 | |
| PRK13369 | 502 | glycerol-3-phosphate dehydrogenase; Provisional | 97.11 | |
| PTZ00383 | 497 | malate:quinone oxidoreductase; Provisional | 97.11 | |
| KOG2404 | 477 | consensus Fumarate reductase, flavoprotein subunit | 97.11 | |
| TIGR03364 | 365 | HpnW_proposed FAD dependent oxidoreductase TIGR033 | 97.11 | |
| TIGR00137 | 433 | gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo | 97.08 | |
| PLN02976 | 1713 | amine oxidase | 97.07 | |
| PRK12837 | 513 | 3-ketosteroid-delta-1-dehydrogenase; Provisional | 97.04 | |
| PRK14106 | 450 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 97.04 | |
| PRK08641 | 589 | sdhA succinate dehydrogenase flavoprotein subunit; | 97.03 | |
| PF04820 | 454 | Trp_halogenase: Tryptophan halogenase; InterPro: I | 97.02 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 97.02 | |
| TIGR01813 | 439 | flavo_cyto_c flavocytochrome c. This model describ | 97.02 | |
| KOG0405 | 478 | consensus Pyridine nucleotide-disulphide oxidoredu | 97.01 | |
| PRK07057 | 591 | sdhA succinate dehydrogenase flavoprotein subunit; | 96.99 | |
| PRK11749 | 457 | dihydropyrimidine dehydrogenase subunit A; Provisi | 96.98 | |
| COG0029 | 518 | NadB Aspartate oxidase [Coenzyme metabolism] | 96.98 | |
| PRK11101 | 546 | glpA sn-glycerol-3-phosphate dehydrogenase subunit | 96.97 | |
| PF13434 | 341 | K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi | 96.97 | |
| PRK07843 | 557 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 96.96 | |
| TIGR01176 | 580 | fum_red_Fp fumarate reductase, flavoprotein subuni | 96.95 | |
| PRK09231 | 582 | fumarate reductase flavoprotein subunit; Validated | 96.95 | |
| PRK08275 | 554 | putative oxidoreductase; Provisional | 96.95 | |
| PRK12834 | 549 | putative FAD-binding dehydrogenase; Reviewed | 96.94 | |
| PRK01747 | 662 | mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans | 96.94 | |
| PRK04176 | 257 | ribulose-1,5-biphosphate synthetase; Provisional | 96.93 | |
| KOG2614 | 420 | consensus Kynurenine 3-monooxygenase and related f | 96.92 | |
| TIGR00292 | 254 | thiazole biosynthesis enzyme. This enzyme is invol | 96.92 | |
| TIGR01812 | 566 | sdhA_frdA_Gneg succinate dehydrogenase or fumarate | 96.88 | |
| PRK12844 | 557 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 96.87 | |
| PTZ00363 | 443 | rab-GDP dissociation inhibitor; Provisional | 96.86 | |
| PRK12835 | 584 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 96.85 | |
| PRK07803 | 626 | sdhA succinate dehydrogenase flavoprotein subunit; | 96.85 | |
| PRK12845 | 564 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 96.85 | |
| PRK13339 | 497 | malate:quinone oxidoreductase; Reviewed | 96.84 | |
| PLN02464 | 627 | glycerol-3-phosphate dehydrogenase | 96.84 | |
| PRK12778 | 752 | putative bifunctional 2-polyprenylphenol hydroxyla | 96.82 | |
| PRK06452 | 566 | sdhA succinate dehydrogenase flavoprotein subunit; | 96.8 | |
| PRK12810 | 471 | gltD glutamate synthase subunit beta; Reviewed | 96.78 | |
| COG3573 | 552 | Predicted oxidoreductase [General function predict | 96.76 | |
| PTZ00139 | 617 | Succinate dehydrogenase [ubiquinone] flavoprotein | 96.75 | |
| PRK07573 | 640 | sdhA succinate dehydrogenase flavoprotein subunit; | 96.73 | |
| PF00732 | 296 | GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 | 96.72 | |
| TIGR02462 | 544 | pyranose_ox pyranose oxidase. Pyranose oxidase (al | 96.71 | |
| PRK09078 | 598 | sdhA succinate dehydrogenase flavoprotein subunit; | 96.7 | |
| PRK06175 | 433 | L-aspartate oxidase; Provisional | 96.7 | |
| PLN00128 | 635 | Succinate dehydrogenase [ubiquinone] flavoprotein | 96.68 | |
| PRK06854 | 608 | adenylylsulfate reductase subunit alpha; Validated | 96.67 | |
| PRK06069 | 577 | sdhA succinate dehydrogenase flavoprotein subunit; | 96.66 | |
| PRK08958 | 588 | sdhA succinate dehydrogenase flavoprotein subunit; | 96.66 | |
| PF01946 | 230 | Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. | 96.65 | |
| PRK06134 | 581 | putative FAD-binding dehydrogenase; Reviewed | 96.65 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 96.65 | |
| TIGR01470 | 205 | cysG_Nterm siroheme synthase, N-terminal domain. T | 96.62 | |
| PRK02705 | 459 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 96.61 | |
| PRK07395 | 553 | L-aspartate oxidase; Provisional | 96.58 | |
| PRK08626 | 657 | fumarate reductase flavoprotein subunit; Provision | 96.58 | |
| PRK08071 | 510 | L-aspartate oxidase; Provisional | 96.56 | |
| PF03721 | 185 | UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen | 96.55 | |
| COG0654 | 387 | UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and | 96.51 | |
| PRK12843 | 578 | putative FAD-binding dehydrogenase; Reviewed | 96.51 | |
| PRK07236 | 386 | hypothetical protein; Provisional | 96.51 | |
| PTZ00306 | 1167 | NADH-dependent fumarate reductase; Provisional | 96.49 | |
| KOG4254 | 561 | consensus Phytoene desaturase [Coenzyme transport | 96.47 | |
| TIGR01811 | 603 | sdhA_Bsu succinate dehydrogenase or fumarate reduc | 96.46 | |
| TIGR03143 | 555 | AhpF_homolog putative alkyl hydroperoxide reductas | 96.46 | |
| COG1148 | 622 | HdrA Heterodisulfide reductase, subunit A and rela | 96.4 | |
| PF12831 | 428 | FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 | 96.38 | |
| PRK12779 | 944 | putative bifunctional glutamate synthase subunit b | 96.33 | |
| TIGR01318 | 467 | gltD_gamma_fam glutamate synthase small subunit fa | 96.33 | |
| TIGR02061 | 614 | aprA adenosine phosphosulphate reductase, alpha su | 96.32 | |
| PRK09077 | 536 | L-aspartate oxidase; Provisional | 96.31 | |
| PRK07045 | 388 | putative monooxygenase; Reviewed | 96.28 | |
| PRK08205 | 583 | sdhA succinate dehydrogenase flavoprotein subunit; | 96.22 | |
| PRK12769 | 654 | putative oxidoreductase Fe-S binding subunit; Revi | 96.21 | |
| PLN02815 | 594 | L-aspartate oxidase | 96.21 | |
| COG1251 | 793 | NirB NAD(P)H-nitrite reductase [Energy production | 96.14 | |
| KOG2311 | 679 | consensus NAD/FAD-utilizing protein possibly invol | 96.13 | |
| COG0578 | 532 | GlpA Glycerol-3-phosphate dehydrogenase [Energy pr | 96.12 | |
| PRK09853 | 1019 | putative selenate reductase subunit YgfK; Provisio | 96.1 | |
| PLN02172 | 461 | flavin-containing monooxygenase FMO GS-OX | 96.09 | |
| PRK07364 | 415 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 96.07 | |
| PRK12814 | 652 | putative NADPH-dependent glutamate synthase small | 96.07 | |
| PF01134 | 392 | GIDA: Glucose inhibited division protein A; InterP | 96.05 | |
| COG1053 | 562 | SdhA Succinate dehydrogenase/fumarate reductase, f | 96.04 | |
| KOG1298 | 509 | consensus Squalene monooxygenase [Lipid transport | 96.04 | |
| TIGR01372 | 985 | soxA sarcosine oxidase, alpha subunit family, hete | 95.99 | |
| PRK06847 | 375 | hypothetical protein; Provisional | 95.99 | |
| COG2509 | 486 | Uncharacterized FAD-dependent dehydrogenases [Gene | 95.88 | |
| PRK02106 | 560 | choline dehydrogenase; Validated | 95.87 | |
| PRK06126 | 545 | hypothetical protein; Provisional | 95.8 | |
| COG1086 | 588 | Predicted nucleoside-diphosphate sugar epimerases | 95.77 | |
| PLN02661 | 357 | Putative thiazole synthesis | 95.77 | |
| PRK06617 | 374 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 95.75 | |
| PRK13800 | 897 | putative oxidoreductase/HEAT repeat-containing pro | 95.75 | |
| TIGR00275 | 400 | flavoprotein, HI0933 family. The model when search | 95.73 | |
| PRK06185 | 407 | hypothetical protein; Provisional | 95.68 | |
| PF13241 | 103 | NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ | 95.65 | |
| PRK07512 | 513 | L-aspartate oxidase; Provisional | 95.64 | |
| COG0492 | 305 | TrxB Thioredoxin reductase [Posttranslational modi | 95.62 | |
| PLN02353 | 473 | probable UDP-glucose 6-dehydrogenase | 95.62 | |
| COG3075 | 421 | GlpB Anaerobic glycerol-3-phosphate dehydrogenase | 95.53 | |
| PRK01438 | 480 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 95.53 | |
| KOG1346 | 659 | consensus Programmed cell death 8 (apoptosis-induc | 95.5 | |
| PRK08773 | 392 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 95.49 | |
| PRK05335 | 436 | tRNA (uracil-5-)-methyltransferase Gid; Reviewed | 95.49 | |
| PF06100 | 500 | Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross | 95.48 | |
| PRK08244 | 493 | hypothetical protein; Provisional | 95.48 | |
| TIGR00137 | 433 | gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo | 95.47 | |
| COG0771 | 448 | MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas | 95.43 | |
| PRK07190 | 487 | hypothetical protein; Provisional | 95.38 | |
| PRK10015 | 429 | oxidoreductase; Provisional | 95.37 | |
| PRK12809 | 639 | putative oxidoreductase Fe-S binding subunit; Revi | 95.37 | |
| TIGR01317 | 485 | GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal | 95.37 | |
| PF01210 | 157 | NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate | 95.33 | |
| KOG0029 | 501 | consensus Amine oxidase [Secondary metabolites bio | 95.32 | |
| PF00743 | 531 | FMO-like: Flavin-binding monooxygenase-like; Inter | 95.32 | |
| PRK08850 | 405 | 2-octaprenyl-6-methoxyphenol hydroxylase; Validate | 95.29 | |
| PF13450 | 68 | NAD_binding_8: NAD(P)-binding Rossmann-like domain | 95.29 | |
| PF13241 | 103 | NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ | 95.26 | |
| PRK05192 | 618 | tRNA uridine 5-carboxymethylaminomethyl modificati | 95.22 | |
| PRK06834 | 488 | hypothetical protein; Provisional | 95.2 | |
| TIGR01810 | 532 | betA choline dehydrogenase. This enzyme is a membe | 95.12 | |
| PRK06719 | 157 | precorrin-2 dehydrogenase; Validated | 95.11 | |
| PLN02852 | 491 | ferredoxin-NADP+ reductase | 95.11 | |
| KOG2665 | 453 | consensus Predicted FAD-dependent oxidoreductase [ | 95.05 | |
| KOG2852 | 380 | consensus Possible oxidoreductase [General functio | 95.05 | |
| PRK10157 | 428 | putative oxidoreductase FixC; Provisional | 94.98 | |
| KOG4716 | 503 | consensus Thioredoxin reductase [Posttranslational | 94.97 | |
| KOG1298 | 509 | consensus Squalene monooxygenase [Lipid transport | 94.97 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 94.96 | |
| PRK07333 | 403 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio | 94.95 | |
| PRK08274 | 466 | tricarballylate dehydrogenase; Validated | 94.93 | |
| TIGR01470 | 205 | cysG_Nterm siroheme synthase, N-terminal domain. T | 94.9 | |
| TIGR03315 | 1012 | Se_ygfK putative selenate reductase, YgfK subunit. | 94.88 | |
| PRK06481 | 506 | fumarate reductase flavoprotein subunit; Validated | 94.87 | |
| PRK12775 | 1006 | putative trifunctional 2-polyprenylphenol hydroxyl | 94.85 | |
| TIGR02485 | 432 | CobZ_N-term precorrin 3B synthase CobZ. CobZ is es | 94.79 | |
| PLN02463 | 447 | lycopene beta cyclase | 94.78 | |
| KOG0399 | 2142 | consensus Glutamate synthase [Amino acid transport | 94.77 | |
| PRK07608 | 388 | ubiquinone biosynthesis hydroxylase family protein | 94.65 | |
| PRK01710 | 458 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 94.61 | |
| PRK06718 | 202 | precorrin-2 dehydrogenase; Reviewed | 94.6 | |
| KOG3923 | 342 | consensus D-aspartate oxidase [Amino acid transpor | 94.57 | |
| PF02254 | 116 | TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg | 94.55 | |
| PF06039 | 488 | Mqo: Malate:quinone oxidoreductase (Mqo); InterPro | 94.46 | |
| PRK06996 | 398 | hypothetical protein; Provisional | 94.44 | |
| PLN02785 | 587 | Protein HOTHEAD | 94.3 | |
| PF01262 | 168 | AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal | 94.19 | |
| COG2303 | 542 | BetA Choline dehydrogenase and related flavoprotei | 94.12 | |
| PF01494 | 356 | FAD_binding_3: FAD binding domain; InterPro: IPR00 | 94.09 | |
| PRK12771 | 564 | putative glutamate synthase (NADPH) small subunit; | 94.08 | |
| PTZ00188 | 506 | adrenodoxin reductase; Provisional | 94.07 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 94.02 | |
| PRK11883 | 451 | protoporphyrinogen oxidase; Reviewed | 93.96 | |
| PF02737 | 180 | 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind | 93.86 | |
| COG0644 | 396 | FixC Dehydrogenases (flavoproteins) [Energy produc | 93.85 | |
| PF00056 | 141 | Ldh_1_N: lactate/malate dehydrogenase, NAD binding | 93.8 | |
| PRK06719 | 157 | precorrin-2 dehydrogenase; Validated | 93.8 | |
| COG1893 | 307 | ApbA Ketopantoate reductase [Coenzyme metabolism] | 93.78 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 93.75 | |
| COG1206 | 439 | Gid NAD(FAD)-utilizing enzyme possibly involved in | 93.74 | |
| PRK12409 | 410 | D-amino acid dehydrogenase small subunit; Provisio | 93.74 | |
| KOG1399 | 448 | consensus Flavin-containing monooxygenase [Seconda | 93.7 | |
| KOG1238 | 623 | consensus Glucose dehydrogenase/choline dehydrogen | 93.68 | |
| PRK06475 | 400 | salicylate hydroxylase; Provisional | 93.68 | |
| PRK05562 | 223 | precorrin-2 dehydrogenase; Provisional | 93.66 | |
| PRK12475 | 338 | thiamine/molybdopterin biosynthesis MoeB-like prot | 93.64 | |
| PRK06249 | 313 | 2-dehydropantoate 2-reductase; Provisional | 93.62 | |
| cd05294 | 309 | LDH-like_MDH_nadp A lactate dehydrogenases-like st | 93.61 | |
| TIGR03026 | 411 | NDP-sugDHase nucleotide sugar dehydrogenase. All o | 93.59 | |
| PF00899 | 135 | ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a | 93.51 | |
| PLN02268 | 435 | probable polyamine oxidase | 93.48 | |
| PF07992 | 201 | Pyr_redox_2: Pyridine nucleotide-disulphide oxidor | 93.45 | |
| KOG0685 | 498 | consensus Flavin-containing amine oxidase [Coenzym | 93.44 | |
| PRK15116 | 268 | sulfur acceptor protein CsdL; Provisional | 93.41 | |
| PRK07233 | 434 | hypothetical protein; Provisional | 93.4 | |
| PRK06567 | 1028 | putative bifunctional glutamate synthase subunit b | 93.3 | |
| PRK08163 | 396 | salicylate hydroxylase; Provisional | 93.29 | |
| KOG3855 | 481 | consensus Monooxygenase involved in coenzyme Q (ub | 93.28 | |
| PRK06718 | 202 | precorrin-2 dehydrogenase; Reviewed | 93.27 | |
| PRK06184 | 502 | hypothetical protein; Provisional | 93.23 | |
| TIGR01812 | 566 | sdhA_frdA_Gneg succinate dehydrogenase or fumarate | 93.21 | |
| PRK05868 | 372 | hypothetical protein; Validated | 93.17 | |
| cd01483 | 143 | E1_enzyme_family Superfamily of activating enzymes | 93.14 | |
| PRK09424 | 509 | pntA NAD(P) transhydrogenase subunit alpha; Provis | 93.08 | |
| PRK13984 | 604 | putative oxidoreductase; Provisional | 92.92 | |
| PF13738 | 203 | Pyr_redox_3: Pyridine nucleotide-disulphide oxidor | 92.89 | |
| PRK10669 | 558 | putative cation:proton antiport protein; Provision | 92.88 | |
| PRK06753 | 373 | hypothetical protein; Provisional | 92.87 | |
| COG3349 | 485 | Uncharacterized conserved protein [Function unknow | 92.76 | |
| PRK06129 | 308 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 92.74 | |
| PRK12416 | 463 | protoporphyrinogen oxidase; Provisional | 92.71 | |
| PF01593 | 450 | Amino_oxidase: Flavin containing amine oxidoreduct | 92.7 | |
| PRK06522 | 304 | 2-dehydropantoate 2-reductase; Reviewed | 92.68 | |
| TIGR00551 | 488 | nadB L-aspartate oxidase. L-aspartate oxidase is t | 92.68 | |
| cd05292 | 308 | LDH_2 A subgroup of L-lactate dehydrogenases. L-la | 92.66 | |
| PF01266 | 358 | DAO: FAD dependent oxidoreductase; InterPro: IPR00 | 92.62 | |
| PRK05562 | 223 | precorrin-2 dehydrogenase; Provisional | 92.6 | |
| PF02558 | 151 | ApbA: Ketopantoate reductase PanE/ApbA; InterPro: | 92.59 | |
| TIGR00562 | 462 | proto_IX_ox protoporphyrinogen oxidase. This prote | 92.53 | |
| PLN02697 | 529 | lycopene epsilon cyclase | 92.52 | |
| PRK06175 | 433 | L-aspartate oxidase; Provisional | 92.52 | |
| PRK07819 | 286 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 92.48 | |
| PRK07208 | 479 | hypothetical protein; Provisional | 92.44 | |
| PRK15116 | 268 | sulfur acceptor protein CsdL; Provisional | 92.38 | |
| TIGR00518 | 370 | alaDH alanine dehydrogenase. The family of known L | 92.36 | |
| PRK07588 | 391 | hypothetical protein; Provisional | 92.35 | |
| PRK05708 | 305 | 2-dehydropantoate 2-reductase; Provisional | 92.33 | |
| cd05293 | 312 | LDH_1 A subgroup of L-lactate dehydrogenases. L-la | 92.28 | |
| cd00757 | 228 | ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 | 92.21 | |
| TIGR01377 | 380 | soxA_mon sarcosine oxidase, monomeric form. Sarcos | 92.21 | |
| TIGR02028 | 398 | ChlP geranylgeranyl reductase. This model represen | 92.2 | |
| PRK11259 | 376 | solA N-methyltryptophan oxidase; Provisional | 92.18 | |
| KOG0042 | 680 | consensus Glycerol-3-phosphate dehydrogenase [Ener | 92.17 |
| >PLN02852 ferredoxin-NADP+ reductase | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.5e-46 Score=358.31 Aligned_cols=317 Identities=77% Similarity=1.181 Sum_probs=270.3
Q ss_pred CCCCeEEEECCchHHHHHHHHHhhcCCCCeEEEEcCCCCCccccccccCCCCcchhHHHHHHHHHhhcCCcEEEeCeEEc
Q 019876 17 SNPLRVCVVGSGPAGFYTAEKTLKAHQEAQVDIIDRLPTPFGLVRSGVAPDHPETKIVINQFSRVVQHERCSFFGNVTLG 96 (334)
Q Consensus 17 ~~~~~vvIIGaG~aGl~aA~~l~~~~~~~~v~vie~~~~~gg~~~~~~~p~~~~~~~~~~~~~~~~~~~~i~~~~~~~v~ 96 (334)
...++|+||||||||++||..|++..++++|+|||+.+.+||+++|++.|+++..+.+...+.+++...+++|+.+..++
T Consensus 24 ~~~~~VaIVGaGPAGl~AA~~L~~~~~g~~Vtv~E~~p~pgGlvr~gvaP~~~~~k~v~~~~~~~~~~~~v~~~~nv~vg 103 (491)
T PLN02852 24 SEPLHVCVVGSGPAGFYTADKLLKAHDGARVDIIERLPTPFGLVRSGVAPDHPETKNVTNQFSRVATDDRVSFFGNVTLG 103 (491)
T ss_pred CCCCcEEEECccHHHHHHHHHHHhhCCCCeEEEEecCCCCcceEeeccCCCcchhHHHHHHHHHHHHHCCeEEEcCEEEC
Confidence 35689999999999999999998743459999999999999999999989998888888888888888899999999999
Q ss_pred eEEecccceeccCeEEEeccCCCCCCCCCCCccCCCccchhhHHHHhcCCCCCCCCCCCCCCCCeEEEEcCCHHHHHHHH
Q 019876 97 SSVSLSELRQLYHVVVLAYGAESDRALGIPGEDLIGVHSAREFVWWYNGHPDGKNLSPDLKSTDTAVILGQGNVALDVAR 176 (334)
Q Consensus 97 ~~v~~~~~~~~yd~lIlATGs~~p~~~~ipG~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~k~vvVIG~G~~g~e~A~ 176 (334)
.+++++++...||+||||||+..++.++|||.+.+||+++.+|+.+++.++++..+...+..+++|+|||+|++|+|+|+
T Consensus 104 ~dvtl~~L~~~yDaVIlAtGa~~~~~l~IpG~d~~gV~~a~~fl~~~ng~~d~~~~~~~~~~gk~VvVIGgGnvAlD~Ar 183 (491)
T PLN02852 104 RDVSLSELRDLYHVVVLAYGAESDRRLGIPGEDLPGVLSAREFVWWYNGHPDCVHLPPDLKSSDTAVVLGQGNVALDCAR 183 (491)
T ss_pred ccccHHHHhhhCCEEEEecCCCCCCCCCCCCCCCCCeEEHHHHHHHhhcchhhhhhhhcccCCCEEEEECCCHHHHHHHH
Confidence 88888888778999999999964578899999999999999999999887766544444457899999999999999999
Q ss_pred HHccCCcccccccccHHHHHHHhcCCcceEEEEeecCccccCCCHHHHHHHHcCCceEEEEccCccCCCCCchhhhhccH
Q 019876 177 ILLRPTEELATTDIASYAWTALEGSSIRKVYLVGRRGPVQAACTAKELREILGIKNLYVHIREDDLIKSPTDEEEMKNSR 256 (334)
Q Consensus 177 ~L~~~~~~~~~~~~~~~~~~~~~~~~~~~Vtiv~r~~~~~~~~~~~~~~~~l~~~gv~~~~~~~~~~~~~~~~~~~~~~~ 256 (334)
.|.+...++..|||++++++.|+..++++|+|++||++...+|+.+|++++++++++.+++++..+..++.+..+...++
T Consensus 184 ~L~~~~~~l~~tdi~~~~l~~l~~~~~~~V~iv~RRg~~~~~ft~~Elrel~~l~~~~~~~~~~~~~~~~~~~~~~~~~r 263 (491)
T PLN02852 184 ILLRPTDELASTDIAEHALEALRGSSVRKVYLVGRRGPVQAACTAKELRELLGLKNVRVRIKEADLTLSPEDEEELKASR 263 (491)
T ss_pred HHHhCccccccccccHHHHHHHhhCCCCEEEEEEcCChHhCCCCHHHHHHHhccCCCceeechhhhccccchhhhhccch
Confidence 99999999999999999999999999999999999999999999999999999999999999888765555555566788
Q ss_pred HHHHHHHHHHHHHhccCCCCCCCceEEEEEeccccceeeccccCCCCeeEEEEEEeeeecC-CCCcceeecCCceEeC
Q 019876 257 IQRRVYELLSKAAASASSQPMLGQRELHFVFFRKPDSFLESNERSGHVSGVHFEKTALKGG-GPGKQYAVGTGEFEDL 333 (334)
Q Consensus 257 ~~~~~~~~~~~~~~~~~~~~~~~~~gv~~~~~~~~~~i~~~~~~~~~v~~v~~~~~~~~~~-~~~~~~~~~~~~~~~~ 333 (334)
..+|..++|++.............++|+|+|..+|++|....+++++|++|++..+++..+ ++|+..+++||++++|
T Consensus 264 ~~~r~~~~l~~~a~~~~~~~~~~~~~v~~~f~~sP~ei~~~~~~~~~v~~l~~~~~~l~~~~~~g~~~~~~tge~~~i 341 (491)
T PLN02852 264 PKRRVYELLSKAAAAGKCAPSGGQRELHFVFFRNPTRFLDSGDGNGHVAGVKLERTVLEGAAGSGKQVAVGTGEFEDL 341 (491)
T ss_pred hhHHHHHHHHHHHhhcccccCCCCceEEEEccCCCeEEEccCCCCCcEEEEEEEEeecCCCcccCCcccCCCCCEEEE
Confidence 9999999998764310000011348999999999999982111137899999999998754 4788888999998775
|
|
| >KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00188 adrenodoxin reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PRK12831 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01316 gltA glutamate synthase (NADPH), homotetrameric | Back alignment and domain information |
|---|
| >PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial | Back alignment and domain information |
|---|
| >PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >PRK09853 putative selenate reductase subunit YgfK; Provisional | Back alignment and domain information |
|---|
| >PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated | Back alignment and domain information |
|---|
| >COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit | Back alignment and domain information |
|---|
| >PRK12810 gltD glutamate synthase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit | Back alignment and domain information |
|---|
| >PRK13984 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK12770 putative glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK06370 mercuric reductase; Validated | Back alignment and domain information |
|---|
| >COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial | Back alignment and domain information |
|---|
| >PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02053 MerA mercuric reductase | Back alignment and domain information |
|---|
| >KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09564 coenzyme A disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant | Back alignment and domain information |
|---|
| >PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit | Back alignment and domain information |
|---|
| >PRK14989 nitrite reductase subunit NirD; Provisional | Back alignment and domain information |
|---|
| >KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00058 glutathione reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06467 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06416 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06116 glutathione reductase; Validated | Back alignment and domain information |
|---|
| >PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional | Back alignment and domain information |
|---|
| >PLN02546 glutathione reductase | Back alignment and domain information |
|---|
| >PRK05976 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK10262 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02507 glutathione reductase | Back alignment and domain information |
|---|
| >PRK07845 flavoprotein disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK14694 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06912 acoL dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit | Back alignment and domain information |
|---|
| >PRK06115 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01292 TRX_reduct thioredoxin-disulfide reductase | Back alignment and domain information |
|---|
| >TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01423 trypano_reduc trypanothione-disulfide reductase | Back alignment and domain information |
|---|
| >COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02172 flavin-containing monooxygenase FMO GS-OX | Back alignment and domain information |
|---|
| >PRK07846 mycothione reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK13748 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PRK13512 coenzyme A disulfide reductase; Provisional | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A | Back alignment and domain information |
|---|
| >PRK14727 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >PRK07818 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06292 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] | Back alignment and domain information |
|---|
| >TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein | Back alignment and domain information |
|---|
| >PRK06327 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PTZ00153 lipoamide dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PTZ00052 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein | Back alignment and domain information |
|---|
| >PTZ00318 NADH dehydrogenase-like protein; Provisional | Back alignment and domain information |
|---|
| >COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03452 mycothione_red mycothione reductase | Back alignment and domain information |
|---|
| >KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >TIGR03385 CoA_CoA_reduc CoA-disulfide reductase | Back alignment and domain information |
|---|
| >KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B | Back alignment and domain information |
|---|
| >PRK09897 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >COG4529 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG2081 Predicted flavoproteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2755 consensus Oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases | Back alignment and domain information |
|---|
| >KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK04176 ribulose-1,5-biphosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR00292 thiazole biosynthesis enzyme | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >TIGR02032 GG-red-SF geranylgeranyl reductase family | Back alignment and domain information |
|---|
| >COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02463 lycopene beta cyclase | Back alignment and domain information |
|---|
| >PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K | Back alignment and domain information |
|---|
| >TIGR00275 flavoprotein, HI0933 family | Back alignment and domain information |
|---|
| >PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G | Back alignment and domain information |
|---|
| >PRK06847 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02661 Putative thiazole synthesis | Back alignment and domain information |
|---|
| >PRK10157 putative oxidoreductase FixC; Provisional | Back alignment and domain information |
|---|
| >TIGR01790 carotene-cycl lycopene cyclase family protein | Back alignment and domain information |
|---|
| >PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02028 ChlP geranylgeranyl reductase | Back alignment and domain information |
|---|
| >PRK10015 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK12842 putative succinate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK05976 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase | Back alignment and domain information |
|---|
| >PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 | Back alignment and domain information |
|---|
| >TIGR02053 MerA mercuric reductase | Back alignment and domain information |
|---|
| >PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06912 acoL dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional | Back alignment and domain information |
|---|
| >KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK06416 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK09564 coenzyme A disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A | Back alignment and domain information |
|---|
| >PRK13512 coenzyme A disulfide reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03385 CoA_CoA_reduc CoA-disulfide reductase | Back alignment and domain information |
|---|
| >TIGR02023 BchP-ChlP geranylgeranyl reductase | Back alignment and domain information |
|---|
| >PRK06834 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways | Back alignment and domain information |
|---|
| >PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional | Back alignment and domain information |
|---|
| >PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK06327 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF13454 NAD_binding_9: FAD-NAD(P)-binding | Back alignment and domain information |
|---|
| >PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06370 mercuric reductase; Validated | Back alignment and domain information |
|---|
| >PRK07818 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK14694 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08163 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK07236 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial | Back alignment and domain information |
|---|
| >COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PLN00093 geranylgeranyl diphosphate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK11883 protoporphyrinogen oxidase; Reviewed | Back alignment and domain information |
|---|
| >PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria | Back alignment and domain information |
|---|
| >TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant | Back alignment and domain information |
|---|
| >KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK11728 hydroxyglutarate oxidase; Provisional | Back alignment and domain information |
|---|
| >PLN02697 lycopene epsilon cyclase | Back alignment and domain information |
|---|
| >PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated | Back alignment and domain information |
|---|
| >PRK14727 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06115 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06116 glutathione reductase; Validated | Back alignment and domain information |
|---|
| >COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >PRK13748 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase | Back alignment and domain information |
|---|
| >PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated | Back alignment and domain information |
|---|
| >PLN02507 glutathione reductase | Back alignment and domain information |
|---|
| >PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK08244 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07845 flavoprotein disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK07588 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK11445 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein | Back alignment and domain information |
|---|
| >COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit | Back alignment and domain information |
|---|
| >PTZ00318 NADH dehydrogenase-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK14989 nitrite reductase subunit NirD; Provisional | Back alignment and domain information |
|---|
| >COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK07846 mycothione reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK08401 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PTZ00058 glutathione reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06467 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG3349 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01423 trypano_reduc trypanothione-disulfide reductase | Back alignment and domain information |
|---|
| >PRK13977 myosin-cross-reactive antigen; Provisional | Back alignment and domain information |
|---|
| >PRK07208 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02576 protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >PTZ00052 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03452 mycothione_red mycothione reductase | Back alignment and domain information |
|---|
| >KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06292 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PTZ00153 lipoamide dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00562 proto_IX_ox protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >PRK12416 protoporphyrinogen oxidase; Provisional | Back alignment and domain information |
|---|
| >KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02268 probable polyamine oxidase | Back alignment and domain information |
|---|
| >PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02546 glutathione reductase | Back alignment and domain information |
|---|
| >TIGR02733 desat_CrtD C-3',4' desaturase CrtD | Back alignment and domain information |
|---|
| >PRK06996 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins | Back alignment and domain information |
|---|
| >TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein | Back alignment and domain information |
|---|
| >TIGR02734 crtI_fam phytoene desaturase | Back alignment and domain information |
|---|
| >PRK07804 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK10262 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06753 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01789 lycopene_cycl lycopene cyclase | Back alignment and domain information |
|---|
| >TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase | Back alignment and domain information |
|---|
| >TIGR02731 phytoene_desat phytoene desaturase | Back alignment and domain information |
|---|
| >PRK07045 putative monooxygenase; Reviewed | Back alignment and domain information |
|---|
| >KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00136 gidA glucose-inhibited division protein A | Back alignment and domain information |
|---|
| >PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PLN02568 polyamine oxidase | Back alignment and domain information |
|---|
| >TIGR00551 nadB L-aspartate oxidase | Back alignment and domain information |
|---|
| >TIGR02730 carot_isom carotene isomerase | Back alignment and domain information |
|---|
| >COG2907 Predicted NAD/FAD-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases | Back alignment and domain information |
|---|
| >TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit | Back alignment and domain information |
|---|
| >KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK07538 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08013 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PLN02529 lysine-specific histone demethylase 1 | Back alignment and domain information |
|---|
| >TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family | Back alignment and domain information |
|---|
| >PRK05868 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK09126 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase | Back alignment and domain information |
|---|
| >TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >PRK06475 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02676 polyamine oxidase | Back alignment and domain information |
|---|
| >TIGR03219 salicylate_mono salicylate 1-monooxygenase | Back alignment and domain information |
|---|
| >TIGR02732 zeta_caro_desat carotene 7,8-desaturase | Back alignment and domain information |
|---|
| >PLN02487 zeta-carotene desaturase | Back alignment and domain information |
|---|
| >PRK07190 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06126 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >PLN02328 lysine-specific histone demethylase 1 homolog | Back alignment and domain information |
|---|
| >KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated | Back alignment and domain information |
|---|
| >COG2081 Predicted flavoproteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12409 D-amino acid dehydrogenase small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK06185 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02612 phytoene desaturase | Back alignment and domain information |
|---|
| >PLN02985 squalene monooxygenase | Back alignment and domain information |
|---|
| >PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed | Back alignment and domain information |
|---|
| >PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated | Back alignment and domain information |
|---|
| >COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF00890 FAD_binding_2: FAD binding domain of the Pfam family | Back alignment and domain information |
|---|
| >COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 | Back alignment and domain information |
|---|
| >PRK05257 malate:quinone oxidoreductase; Validated | Back alignment and domain information |
|---|
| >TIGR01292 TRX_reduct thioredoxin-disulfide reductase | Back alignment and domain information |
|---|
| >TIGR01316 gltA glutamate synthase (NADPH), homotetrameric | Back alignment and domain information |
|---|
| >PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase | Back alignment and domain information |
|---|
| >COG1231 Monoamine oxidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06481 fumarate reductase flavoprotein subunit; Validated | Back alignment and domain information |
|---|
| >COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase | Back alignment and domain information |
|---|
| >PRK08132 FAD-dependent oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK11259 solA N-methyltryptophan oxidase; Provisional | Back alignment and domain information |
|---|
| >TIGR01377 soxA_mon sarcosine oxidase, monomeric form | Back alignment and domain information |
|---|
| >COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12831 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK12770 putative glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08274 tricarballylate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK00711 D-amino acid dehydrogenase small subunit; Validated | Back alignment and domain information |
|---|
| >PLN03000 amine oxidase | Back alignment and domain information |
|---|
| >PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK07121 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK08294 phenol 2-monooxygenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase | Back alignment and domain information |
|---|
| >PRK12839 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0579 Predicted dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00367 squalene epoxidase; Provisional | Back alignment and domain information |
|---|
| >PRK13369 glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PTZ00383 malate:quinone oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 | Back alignment and domain information |
|---|
| >TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase | Back alignment and domain information |
|---|
| >PLN02976 amine oxidase | Back alignment and domain information |
|---|
| >PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >TIGR01813 flavo_cyto_c flavocytochrome c | Back alignment and domain information |
|---|
| >KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >COG0029 NadB Aspartate oxidase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B | Back alignment and domain information |
|---|
| >PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit | Back alignment and domain information |
|---|
| >PRK09231 fumarate reductase flavoprotein subunit; Validated | Back alignment and domain information |
|---|
| >PRK08275 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK12834 putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >PRK04176 ribulose-1,5-biphosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00292 thiazole biosynthesis enzyme | Back alignment and domain information |
|---|
| >TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup | Back alignment and domain information |
|---|
| >PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00363 rab-GDP dissociation inhibitor; Provisional | Back alignment and domain information |
|---|
| >PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK13339 malate:quinone oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >PLN02464 glycerol-3-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12810 gltD glutamate synthase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >COG3573 Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] | Back alignment and domain information |
|---|
| >TIGR02462 pyranose_ox pyranose oxidase | Back alignment and domain information |
|---|
| >PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK06175 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit | Back alignment and domain information |
|---|
| >PRK06854 adenylylsulfate reductase subunit alpha; Validated | Back alignment and domain information |
|---|
| >PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K | Back alignment and domain information |
|---|
| >PRK06134 putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain | Back alignment and domain information |
|---|
| >PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK07395 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK08626 fumarate reductase flavoprotein subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08071 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] | Back alignment and domain information |
|---|
| >COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK12843 putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK07236 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00306 NADH-dependent fumarate reductase; Provisional | Back alignment and domain information |
|---|
| >KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup | Back alignment and domain information |
|---|
| >TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit | Back alignment and domain information |
|---|
| >COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A | Back alignment and domain information |
|---|
| >PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial | Back alignment and domain information |
|---|
| >TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit | Back alignment and domain information |
|---|
| >PRK09077 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK07045 putative monooxygenase; Reviewed | Back alignment and domain information |
|---|
| >PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PLN02815 L-aspartate oxidase | Back alignment and domain information |
|---|
| >COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK09853 putative selenate reductase subunit YgfK; Provisional | Back alignment and domain information |
|---|
| >PLN02172 flavin-containing monooxygenase FMO GS-OX | Back alignment and domain information |
|---|
| >PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria | Back alignment and domain information |
|---|
| >COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >PRK06847 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK02106 choline dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06126 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02661 Putative thiazole synthesis | Back alignment and domain information |
|---|
| >PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00275 flavoprotein, HI0933 family | Back alignment and domain information |
|---|
| >PRK06185 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B | Back alignment and domain information |
|---|
| >PRK07512 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN02353 probable UDP-glucose 6-dehydrogenase | Back alignment and domain information |
|---|
| >COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed | Back alignment and domain information |
|---|
| >PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] | Back alignment and domain information |
|---|
| >PRK08244 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase | Back alignment and domain information |
|---|
| >COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK07190 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10015 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit | Back alignment and domain information |
|---|
| >PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate | Back alignment and domain information |
|---|
| >KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] | Back alignment and domain information |
|---|
| >PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated | Back alignment and domain information |
|---|
| >PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G | Back alignment and domain information |
|---|
| >PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B | Back alignment and domain information |
|---|
| >PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated | Back alignment and domain information |
|---|
| >PRK06834 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01810 betA choline dehydrogenase | Back alignment and domain information |
|---|
| >PRK06719 precorrin-2 dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02852 ferredoxin-NADP+ reductase | Back alignment and domain information |
|---|
| >KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] | Back alignment and domain information |
|---|
| >KOG2852 consensus Possible oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10157 putative oxidoreductase FixC; Provisional | Back alignment and domain information |
|---|
| >KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK08274 tricarballylate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain | Back alignment and domain information |
|---|
| >TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit | Back alignment and domain information |
|---|
| >PRK06481 fumarate reductase flavoprotein subunit; Validated | Back alignment and domain information |
|---|
| >PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02485 CobZ_N-term precorrin 3B synthase CobZ | Back alignment and domain information |
|---|
| >PLN02463 lycopene beta cyclase | Back alignment and domain information |
|---|
| >KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional | Back alignment and domain information |
|---|
| >PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK06718 precorrin-2 dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >KOG3923 consensus D-aspartate oxidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus | Back alignment and domain information |
|---|
| >PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle | Back alignment and domain information |
|---|
| >PRK06996 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02785 Protein HOTHEAD | Back alignment and domain information |
|---|
| >PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 | Back alignment and domain information |
|---|
| >COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways | Back alignment and domain information |
|---|
| >PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional | Back alignment and domain information |
|---|
| >PTZ00188 adrenodoxin reductase; Provisional | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >PRK11883 protoporphyrinogen oxidase; Reviewed | Back alignment and domain information |
|---|
| >PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 | Back alignment and domain information |
|---|
| >COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] | Back alignment and domain information |
|---|
| >PRK06719 precorrin-2 dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK12409 D-amino acid dehydrogenase small subunit; Provisional | Back alignment and domain information |
|---|
| >KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG1238 consensus Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06475 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK05562 precorrin-2 dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK06249 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity | Back alignment and domain information |
|---|
| >TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase | Back alignment and domain information |
|---|
| >PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >PLN02268 probable polyamine oxidase | Back alignment and domain information |
|---|
| >PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15116 sulfur acceptor protein CsdL; Provisional | Back alignment and domain information |
|---|
| >PRK07233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK08163 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK06718 precorrin-2 dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup | Back alignment and domain information |
|---|
| >PRK05868 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins | Back alignment and domain information |
|---|
| >PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK13984 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A | Back alignment and domain information |
|---|
| >PRK10669 putative cation:proton antiport protein; Provisional | Back alignment and domain information |
|---|
| >PRK06753 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG3349 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12416 protoporphyrinogen oxidase; Provisional | Back alignment and domain information |
|---|
| >PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) | Back alignment and domain information |
|---|
| >PRK06522 2-dehydropantoate 2-reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00551 nadB L-aspartate oxidase | Back alignment and domain information |
|---|
| >cd05292 LDH_2 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK05562 precorrin-2 dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 | Back alignment and domain information |
|---|
| >TIGR00562 proto_IX_ox protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >PLN02697 lycopene epsilon cyclase | Back alignment and domain information |
|---|
| >PRK06175 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07208 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK15116 sulfur acceptor protein CsdL; Provisional | Back alignment and domain information |
|---|
| >TIGR00518 alaDH alanine dehydrogenase | Back alignment and domain information |
|---|
| >PRK07588 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05708 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >cd05293 LDH_1 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA | Back alignment and domain information |
|---|
| >TIGR01377 soxA_mon sarcosine oxidase, monomeric form | Back alignment and domain information |
|---|
| >TIGR02028 ChlP geranylgeranyl reductase | Back alignment and domain information |
|---|
| >PRK11259 solA N-methyltryptophan oxidase; Provisional | Back alignment and domain information |
|---|
| >KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 334 | ||||
| 1cjc_A | 460 | Structure Of Adrenodoxin Reductase Of Mitochondrial | 4e-71 | ||
| 1lqt_A | 456 | A Covalent Modification Of Nadp+ Revealed By The At | 2e-57 | ||
| 2c7g_A | 456 | Fpra From Mycobacterium Tuberculosis: His57gln Muta | 1e-56 |
| >pdb|1CJC|A Chain A, Structure Of Adrenodoxin Reductase Of Mitochondrial P450 Systems Length = 460 | Back alignment and structure |
|
| >pdb|1LQT|A Chain A, A Covalent Modification Of Nadp+ Revealed By The Atomic Resolution Structure Of Fpra, A Mycobacterium Tuberculosis Oxidoreductase Length = 456 | Back alignment and structure |
| >pdb|2C7G|A Chain A, Fpra From Mycobacterium Tuberculosis: His57gln Mutant Length = 456 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 334 | |||
| 1lqt_A | 456 | FPRA; NADP+ derivative, oxidoreductase, structural | 1e-121 | |
| 1cjc_A | 460 | Protein (adrenodoxin reductase); flavoenzyme, MAD | 1e-121 | |
| 2vdc_G | 456 | Glutamate synthase [NADPH] small chain; oxidoreduc | 1e-19 | |
| 1gte_A | 1025 | Dihydropyrimidine dehydrogenase; electron transfer | 4e-16 | |
| 1ps9_A | 671 | 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel | 8e-08 | |
| 3k30_A | 690 | Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi | 8e-06 |
| >1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Length = 456 | Back alignment and structure |
|---|
Score = 356 bits (914), Expect = e-121
Identities = 133/321 (41%), Positives = 180/321 (56%), Gaps = 14/321 (4%)
Query: 19 PLRVCVVGSGPAGFYTAEKTLKAHQEA-----QVDIIDRLPTPFGLVRSGVAPDHPETKI 73
P + +VGSGP+ F+ A LKA VD+++ LPTP+GLVRSGVAPDHP+ K
Sbjct: 3 PYYIAIVGSGPSAFFAAASLLKAADTTEDLDMAVDMLEMLPTPWGLVRSGVAPDHPKIKS 62
Query: 74 VINQFSRVVQHERCSFFGNVTLGSSVSLSELRQLYHVVVLAYGAESDRALGIPGEDLIGV 133
+ QF + + R FFGNV +G V EL + Y V+ A GA+SDR L IPGEDL G
Sbjct: 63 ISKQFEKTAEDPRFRFFGNVVVGEHVQPGELSERYDAVIYAVGAQSDRMLNIPGEDLPGS 122
Query: 134 HSAREFVWWYNGHPDGKNLSPDLKSTDTAVILGQGNVALDVARILLRPTEELATTDIASY 193
+A +FV WYN HP + +SPDL S AV++G GNVALDVARILL + LA TDIA +
Sbjct: 123 IAAVDFVGWYNAHPHFEQVSPDL-SGARAVVIGNGNVALDVARILLTDPDVLARTDIADH 181
Query: 194 AWTALEGSSIRKVYLVGRRGPVQAACTAKELREILGIKNLYVHIREDDLIKSPTDEEEMK 253
A +L I++V +VGRRGP+QAA T ELRE+ + + V I + + TDE+
Sbjct: 182 ALESLRPRGIQEVVIVGRRGPLQAAFTTLELRELADLDGVDVVIDPAE-LDGITDEDAAA 240
Query: 254 NSRIQRRVYELLSKAAASASSQPMLGQRELHFVFFRKPDSFLESNERSGHVSGVHFEKTA 313
++ ++ ++L A +P G R + F F P V + +
Sbjct: 241 VGKVCKQNIKVLRGYAD---REPRPGHRRMVFRFLTSPIEIKG----KRKVERIVLGRNE 293
Query: 314 LKGGGPGKQYAVGTGEFEDLD 334
L G G+ A TGE E+L
Sbjct: 294 LVSDGSGRVAAKDTGEREELP 314
|
| >1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Length = 460 | Back alignment and structure |
|---|
| >2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Length = 456 | Back alignment and structure |
|---|
| >1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Length = 1025 | Back alignment and structure |
|---|
| >1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Length = 671 | Back alignment and structure |
|---|
| >3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Length = 690 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 334 | |||
| 1cjc_A | 460 | Protein (adrenodoxin reductase); flavoenzyme, MAD | 100.0 | |
| 1lqt_A | 456 | FPRA; NADP+ derivative, oxidoreductase, structural | 100.0 | |
| 2vdc_G | 456 | Glutamate synthase [NADPH] small chain; oxidoreduc | 99.97 | |
| 1gte_A | 1025 | Dihydropyrimidine dehydrogenase; electron transfer | 99.92 | |
| 3oc4_A | 452 | Oxidoreductase, pyridine nucleotide-disulfide FAM; | 99.9 | |
| 4gcm_A | 312 | TRXR, thioredoxin reductase; FAD/NAD-linked reduct | 99.9 | |
| 4a5l_A | 314 | Thioredoxin reductase; oxidoreductase, redox metab | 99.89 | |
| 3lxd_A | 415 | FAD-dependent pyridine nucleotide-disulphide oxido | 99.89 | |
| 3ef6_A | 410 | Toluene 1,2-dioxygenase system ferredoxin--NAD(+) | 99.89 | |
| 3fg2_P | 404 | Putative rubredoxin reductase; ferredoxin reductas | 99.88 | |
| 3r9u_A | 315 | Thioredoxin reductase; structural genomics, center | 99.88 | |
| 3kd9_A | 449 | Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o | 99.88 | |
| 3itj_A | 338 | Thioredoxin reductase 1; disulfide B flavoprotein, | 99.88 | |
| 2bc0_A | 490 | NADH oxidase; flavoprotein, pyridine nucleotide di | 99.88 | |
| 3klj_A | 385 | NAD(FAD)-dependent dehydrogenase, NIRB-family (N- | 99.88 | |
| 1mo9_A | 523 | ORF3; nucleotide binding motifs, nucleotide bindin | 99.88 | |
| 2qae_A | 468 | Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin | 99.87 | |
| 1zk7_A | 467 | HGII, reductase, mercuric reductase; mercuric ION | 99.87 | |
| 1nhp_A | 447 | NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA | 99.87 | |
| 3f8d_A | 323 | Thioredoxin reductase (TRXB-3); redox protein, nuc | 99.87 | |
| 1zmd_A | 474 | Dihydrolipoyl dehydrogenase; lipoamide dehydrogena | 99.87 | |
| 2q7v_A | 325 | Thioredoxin reductase; rossman fold, FAD, flavopro | 99.87 | |
| 1vdc_A | 333 | NTR, NADPH dependent thioredoxin reductase; hypoth | 99.86 | |
| 1trb_A | 320 | Thioredoxin reductase; oxidoreductase(flavoenzyme) | 99.86 | |
| 1q1r_A | 431 | Putidaredoxin reductase; glutathione reductase fol | 99.86 | |
| 1fl2_A | 310 | Alkyl hydroperoxide reductase subunit F; reactive | 99.86 | |
| 2wpf_A | 495 | Trypanothione reductase; oxidoreductase, trypanoso | 99.86 | |
| 1dxl_A | 470 | Dihydrolipoamide dehydrogenase; oxidoreductase, mu | 99.86 | |
| 2a87_A | 335 | TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL | 99.86 | |
| 2cdu_A | 452 | NADPH oxidase; flavoenzyme, oxidoreductase; HET: F | 99.86 | |
| 2v3a_A | 384 | Rubredoxin reductase; alkane degradation, NADH oxi | 99.86 | |
| 2q0l_A | 311 | TRXR, thioredoxin reductase; bacterial thiredoxin | 99.86 | |
| 1onf_A | 500 | GR, grase, glutathione reductase; oxidoreductase; | 99.86 | |
| 3lzw_A | 332 | Ferredoxin--NADP reductase 2; ferredoxin reductase | 99.86 | |
| 1fec_A | 490 | Trypanothione reductase; redox-active center, oxid | 99.86 | |
| 3iwa_A | 472 | FAD-dependent pyridine nucleotide-disulphide oxido | 99.86 | |
| 2yqu_A | 455 | 2-oxoglutarate dehydrogenase E3 component; lipoami | 99.86 | |
| 2zbw_A | 335 | Thioredoxin reductase; redox protein, oxidoreducta | 99.86 | |
| 1ges_A | 450 | Glutathione reductase; oxidoreductase(flavoenzyme) | 99.86 | |
| 1ebd_A | 455 | E3BD, dihydrolipoamide dehydrogenase; redox-active | 99.86 | |
| 3cgb_A | 480 | Pyridine nucleotide-disulfide oxidoreductase, CLA; | 99.85 | |
| 2r9z_A | 463 | Glutathione amide reductase; NAD, FAD, substrate s | 99.85 | |
| 3dk9_A | 478 | Grase, GR, glutathione reductase; flavoenzyme, nic | 99.85 | |
| 2hqm_A | 479 | GR, grase, glutathione reductase; glutathione redu | 99.85 | |
| 1ps9_A | 671 | 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel | 99.85 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 99.85 | |
| 2gag_A | 965 | Heterotetrameric sarcosine oxidase alpha-subunit; | 99.85 | |
| 3cty_A | 319 | Thioredoxin reductase; FAD, oxidoreductase, flavin | 99.85 | |
| 4dna_A | 463 | Probable glutathione reductase; structural genomic | 99.85 | |
| 2eq6_A | 464 | Pyruvate dehydrogenase complex, dihydrolipoamide d | 99.84 | |
| 1xhc_A | 367 | NADH oxidase /nitrite reductase; southe collaborat | 99.84 | |
| 2gqw_A | 408 | Ferredoxin reductase; flavoprotein, oxidoreductase | 99.84 | |
| 4eqs_A | 437 | Coenzyme A disulfide reductase; oxidoreductase; HE | 99.84 | |
| 3lad_A | 476 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 99.84 | |
| 2a8x_A | 464 | Dihydrolipoyl dehydrogenase, E3 component of alpha | 99.84 | |
| 1xdi_A | 499 | RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun | 99.84 | |
| 3l8k_A | 466 | Dihydrolipoyl dehydrogenase; redox-active center, | 99.84 | |
| 3urh_A | 491 | Dihydrolipoyl dehydrogenase; PSI-biology, structur | 99.84 | |
| 1ojt_A | 482 | Surface protein; redox-active center, glycolysis, | 99.84 | |
| 1o94_A | 729 | Tmadh, trimethylamine dehydrogenase; electron tran | 99.84 | |
| 3ab1_A | 360 | Ferredoxin--NADP reductase; oxidoreductase, electr | 99.84 | |
| 1v59_A | 478 | Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog | 99.84 | |
| 4b1b_A | 542 | TRXR, thioredoxin reductase; oxidoreductase, FAD, | 99.83 | |
| 3k30_A | 690 | Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi | 99.83 | |
| 4fk1_A | 304 | Putative thioredoxin reductase; structural genomic | 99.83 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 99.83 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 99.83 | |
| 3o0h_A | 484 | Glutathione reductase; ssgcid, structur genomics, | 99.83 | |
| 1lvl_A | 458 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 99.83 | |
| 3dgz_A | 488 | Thioredoxin reductase 2; oxidoreductase, rossmann, | 99.83 | |
| 3d1c_A | 369 | Flavin-containing putative monooxygenase; NP_37310 | 99.82 | |
| 3qfa_A | 519 | Thioredoxin reductase 1, cytoplasmic; protein-prot | 99.82 | |
| 3ic9_A | 492 | Dihydrolipoamide dehydrogenase; APC62701, colwelli | 99.82 | |
| 2xve_A | 464 | Flavin-containing monooxygenase; oxidoreductase; H | 99.82 | |
| 3fbs_A | 297 | Oxidoreductase; structural genomics, PSI2, MCSG, p | 99.82 | |
| 3dgh_A | 483 | TRXR-1, thioredoxin reductase 1, mitochondrial; ox | 99.81 | |
| 2gv8_A | 447 | Monooxygenase; FMO, FAD, NADPH, cofactor complex, | 99.81 | |
| 3gwf_A | 540 | Cyclohexanone monooxygenase; flavoprotein biocatal | 99.81 | |
| 3s5w_A | 463 | L-ornithine 5-monooxygenase; class B flavin depend | 99.81 | |
| 4ap3_A | 549 | Steroid monooxygenase; oxidoreductase, baeyer-vill | 99.8 | |
| 3uox_A | 545 | Otemo; baeyer-villiger monooxygenase, oxidoreducta | 99.79 | |
| 4g6h_A | 502 | Rotenone-insensitive NADH-ubiquinone oxidoreducta | 99.79 | |
| 4a9w_A | 357 | Monooxygenase; baeyer-villiger, FAD, oxidoreductas | 99.79 | |
| 2x8g_A | 598 | Thioredoxin glutathione reductase; redox-active ce | 99.79 | |
| 1m6i_A | 493 | Programmed cell death protein 8; apoptosis, AIF, o | 99.74 | |
| 1w4x_A | 542 | Phenylacetone monooxygenase; baeyer-villiger, FAD; | 99.72 | |
| 3sx6_A | 437 | Sulfide-quinone reductase, putative; sulfide:quino | 99.72 | |
| 1y56_A | 493 | Hypothetical protein PH1363; dehydrogenase, protei | 99.68 | |
| 3h8l_A | 409 | NADH oxidase; membrane protein, complete form, ros | 99.67 | |
| 3vrd_B | 401 | FCCB subunit, flavocytochrome C flavin subunit; su | 99.66 | |
| 3hyw_A | 430 | Sulfide-quinone reductase; monotopic membrane prot | 99.65 | |
| 3h28_A | 430 | Sulfide-quinone reductase; monotopic membrane prot | 99.62 | |
| 4b63_A | 501 | L-ornithine N5 monooxygenase; oxidoreductase, side | 99.57 | |
| 3fpz_A | 326 | Thiazole biosynthetic enzyme; FAD, mitochondrion, | 99.29 | |
| 2gqf_A | 401 | Hypothetical protein HI0933; structural genomics, | 99.12 | |
| 3v76_A | 417 | Flavoprotein; structural genomics, PSI-biology, NE | 99.0 | |
| 2ywl_A | 180 | Thioredoxin reductase related protein; uncharacter | 99.0 | |
| 2bry_A | 497 | NEDD9 interacting protein with calponin homology a | 98.79 | |
| 2cul_A | 232 | Glucose-inhibited division protein A-related PROT | 98.76 | |
| 2e5v_A | 472 | L-aspartate oxidase; archaea, oxidoreductase; HET: | 98.75 | |
| 1rp0_A | 284 | ARA6, thiazole biosynthetic enzyme; protein ligand | 98.74 | |
| 3ces_A | 651 | MNMG, tRNA uridine 5-carboxymethylaminomethyl modi | 98.73 | |
| 3alj_A | 379 | 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; | 98.66 | |
| 2i0z_A | 447 | NAD(FAD)-utilizing dehydrogenases; structural geno | 98.61 | |
| 3kkj_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 98.57 | |
| 1y0p_A | 571 | Fumarate reductase flavoprotein subunit; flavocyto | 98.55 | |
| 3nlc_A | 549 | Uncharacterized protein VP0956; FAD-binding protei | 98.54 | |
| 3jsk_A | 344 | Cypbp37 protein; octameric thiazole synthase, bios | 98.5 | |
| 3nix_A | 421 | Flavoprotein/dehydrogenase; structural genomics, P | 98.5 | |
| 3oz2_A | 397 | Digeranylgeranylglycerophospholipid reductase; str | 98.47 | |
| 1ryi_A | 382 | Glycine oxidase; flavoprotein, protein-inhibitor c | 98.46 | |
| 3qj4_A | 342 | Renalase; FAD/NAD(P)-binding rossmann fold superfa | 98.46 | |
| 1yvv_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 98.45 | |
| 1nhp_A | 447 | NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA | 98.42 | |
| 1xhc_A | 367 | NADH oxidase /nitrite reductase; southe collaborat | 98.4 | |
| 2x3n_A | 399 | Probable FAD-dependent monooxygenase; oxidoreducta | 98.4 | |
| 3ihg_A | 535 | RDME; flavoenzyme, anthracycline, polyketide biosy | 98.39 | |
| 3dme_A | 369 | Conserved exported protein; structural genomics, P | 98.39 | |
| 3cgv_A | 397 | Geranylgeranyl reductase related protein; NP_39399 | 98.38 | |
| 3rp8_A | 407 | Flavoprotein monooxygenase; FAD-binding protein, o | 98.36 | |
| 1qo8_A | 566 | Flavocytochrome C3 fumarate reductase; oxidoreduct | 98.36 | |
| 3e1t_A | 512 | Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro | 98.35 | |
| 2uzz_A | 372 | N-methyl-L-tryptophan oxidase; N-methyltryptophan | 98.35 | |
| 3ps9_A | 676 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 98.34 | |
| 2gjc_A | 326 | Thiazole biosynthetic enzyme, mitochondrial; gluta | 98.34 | |
| 3i3l_A | 591 | Alkylhalidase CMLS; flavin-dependent halogenase, c | 98.33 | |
| 3c4a_A | 381 | Probable tryptophan hydroxylase VIOD; alpha-beta p | 98.33 | |
| 2zxi_A | 637 | TRNA uridine 5-carboxymethylaminomethyl modificat | 98.32 | |
| 1lvl_A | 458 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 98.32 | |
| 2vou_A | 397 | 2,6-dihydroxypyridine hydroxylase; oxidoreductase, | 98.31 | |
| 3fmw_A | 570 | Oxygenase; mithramycin, baeyer-villiger, flavin bi | 98.31 | |
| 4b1b_A | 542 | TRXR, thioredoxin reductase; oxidoreductase, FAD, | 98.31 | |
| 2gqw_A | 408 | Ferredoxin reductase; flavoprotein, oxidoreductase | 98.31 | |
| 1y56_B | 382 | Sarcosine oxidase; dehydrogenase, protein-protein | 98.31 | |
| 2eq6_A | 464 | Pyruvate dehydrogenase complex, dihydrolipoamide d | 98.3 | |
| 2yqu_A | 455 | 2-oxoglutarate dehydrogenase E3 component; lipoami | 98.3 | |
| 2v3a_A | 384 | Rubredoxin reductase; alkane degradation, NADH oxi | 98.29 | |
| 2qa1_A | 500 | PGAE, polyketide oxygenase PGAE; FAD, angucycline, | 98.29 | |
| 1k0i_A | 394 | P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h | 98.28 | |
| 3pvc_A | 689 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 98.28 | |
| 2bc0_A | 490 | NADH oxidase; flavoprotein, pyridine nucleotide di | 98.28 | |
| 2xdo_A | 398 | TETX2 protein; tetracycline degradation, tigecycli | 98.27 | |
| 3nyc_A | 381 | D-arginine dehydrogenase; FAD, imino-arginine, oxi | 98.26 | |
| 4dgk_A | 501 | Phytoene dehydrogenase; the FAD/NAD(P)-binding ros | 98.26 | |
| 3klj_A | 385 | NAD(FAD)-dependent dehydrogenase, NIRB-family (N- | 98.25 | |
| 2r9z_A | 463 | Glutathione amide reductase; NAD, FAD, substrate s | 98.24 | |
| 4eqs_A | 437 | Coenzyme A disulfide reductase; oxidoreductase; HE | 98.23 | |
| 3oc4_A | 452 | Oxidoreductase, pyridine nucleotide-disulfide FAM; | 98.23 | |
| 1zk7_A | 467 | HGII, reductase, mercuric reductase; mercuric ION | 98.22 | |
| 3c4n_A | 405 | Uncharacterized protein DR_0571; alpha-beta protei | 98.22 | |
| 2qa2_A | 499 | CABE, polyketide oxygenase CABE; FAD, angucycline, | 98.22 | |
| 1d4d_A | 572 | Flavocytochrome C fumarate reductase; oxidoreducta | 98.21 | |
| 2gag_B | 405 | Heterotetrameric sarcosine oxidase beta-subunit; f | 98.2 | |
| 2gf3_A | 389 | MSOX, monomeric sarcosine oxidase; flavoprotein ox | 98.2 | |
| 3atr_A | 453 | Conserved archaeal protein; saturating double bond | 98.2 | |
| 3cp8_A | 641 | TRNA uridine 5-carboxymethylaminomethyl modificati | 98.2 | |
| 1ebd_A | 455 | E3BD, dihydrolipoamide dehydrogenase; redox-active | 98.2 | |
| 2gmh_A | 584 | Electron transfer flavoprotein-ubiquinone oxidored | 98.19 | |
| 3lxd_A | 415 | FAD-dependent pyridine nucleotide-disulphide oxido | 98.18 | |
| 4gde_A | 513 | UDP-galactopyranose mutase; flavin adenine dinucle | 98.17 | |
| 3ef6_A | 410 | Toluene 1,2-dioxygenase system ferredoxin--NAD(+) | 98.17 | |
| 3cgb_A | 480 | Pyridine nucleotide-disulfide oxidoreductase, CLA; | 98.17 | |
| 1v59_A | 478 | Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog | 98.16 | |
| 3c96_A | 410 | Flavin-containing monooxygenase; FAD, oxidoreducta | 98.16 | |
| 2hqm_A | 479 | GR, grase, glutathione reductase; glutathione redu | 98.16 | |
| 1ojt_A | 482 | Surface protein; redox-active center, glycolysis, | 98.15 | |
| 3fg2_P | 404 | Putative rubredoxin reductase; ferredoxin reductas | 98.14 | |
| 1onf_A | 500 | GR, grase, glutathione reductase; oxidoreductase; | 98.14 | |
| 1ges_A | 450 | Glutathione reductase; oxidoreductase(flavoenzyme) | 98.13 | |
| 2a8x_A | 464 | Dihydrolipoyl dehydrogenase, E3 component of alpha | 98.12 | |
| 2cdu_A | 452 | NADPH oxidase; flavoenzyme, oxidoreductase; HET: F | 98.12 | |
| 1zmd_A | 474 | Dihydrolipoyl dehydrogenase; lipoamide dehydrogena | 98.11 | |
| 1mo9_A | 523 | ORF3; nucleotide binding motifs, nucleotide bindin | 98.11 | |
| 3urh_A | 491 | Dihydrolipoyl dehydrogenase; PSI-biology, structur | 98.09 | |
| 2qae_A | 468 | Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin | 98.08 | |
| 3dk9_A | 478 | Grase, GR, glutathione reductase; flavoenzyme, nic | 98.08 | |
| 2wpf_A | 495 | Trypanothione reductase; oxidoreductase, trypanoso | 98.08 | |
| 1fec_A | 490 | Trypanothione reductase; redox-active center, oxid | 98.08 | |
| 3ic9_A | 492 | Dihydrolipoamide dehydrogenase; APC62701, colwelli | 98.06 | |
| 3lad_A | 476 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 98.06 | |
| 1q1r_A | 431 | Putidaredoxin reductase; glutathione reductase fol | 98.06 | |
| 1xdi_A | 499 | RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun | 98.05 | |
| 4dna_A | 463 | Probable glutathione reductase; structural genomic | 98.04 | |
| 1trb_A | 320 | Thioredoxin reductase; oxidoreductase(flavoenzyme) | 98.04 | |
| 1dxl_A | 470 | Dihydrolipoamide dehydrogenase; oxidoreductase, mu | 98.04 | |
| 3nrn_A | 421 | Uncharacterized protein PF1083; alpha-beta protein | 98.03 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 98.02 | |
| 2e1m_A | 376 | L-glutamate oxidase; L-amino acid oxidase, FAD, L- | 98.02 | |
| 3ka7_A | 425 | Oxidoreductase; structural genomics, PSI-2, protei | 98.01 | |
| 3i6d_A | 470 | Protoporphyrinogen oxidase; protein-inhibitor comp | 98.0 | |
| 3kd9_A | 449 | Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o | 98.0 | |
| 3o0h_A | 484 | Glutathione reductase; ssgcid, structur genomics, | 97.99 | |
| 3k7m_X | 431 | 6-hydroxy-L-nicotine oxidase; enantiomeric substra | 97.98 | |
| 3iwa_A | 472 | FAD-dependent pyridine nucleotide-disulphide oxido | 97.98 | |
| 3nks_A | 477 | Protoporphyrinogen oxidase; FAD containing protein | 97.97 | |
| 2jae_A | 489 | L-amino acid oxidase; oxidoreductase, dimerisation | 97.96 | |
| 4hb9_A | 412 | Similarities with probable monooxygenase; flavin, | 97.95 | |
| 3dgh_A | 483 | TRXR-1, thioredoxin reductase 1, mitochondrial; ox | 97.94 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 97.94 | |
| 1kf6_A | 602 | Fumarate reductase flavoprotein; respiration, fuma | 97.93 | |
| 1s3e_A | 520 | Amine oxidase [flavin-containing] B; human monoami | 97.93 | |
| 1m6i_A | 493 | Programmed cell death protein 8; apoptosis, AIF, o | 97.92 | |
| 1pj5_A | 830 | N,N-dimethylglycine oxidase; channelling, FAD bind | 97.91 | |
| 3dgz_A | 488 | Thioredoxin reductase 2; oxidoreductase, rossmann, | 97.91 | |
| 3qfa_A | 519 | Thioredoxin reductase 1, cytoplasmic; protein-prot | 97.91 | |
| 3lov_A | 475 | Protoporphyrinogen oxidase; structural genomics, J | 97.91 | |
| 2b9w_A | 424 | Putative aminooxidase; isomerase, conjugated linol | 97.9 | |
| 2zbw_A | 335 | Thioredoxin reductase; redox protein, oxidoreducta | 97.89 | |
| 2bcg_G | 453 | Secretory pathway GDP dissociation inhibitor; RABG | 97.89 | |
| 1rsg_A | 516 | FMS1 protein; FAD binding motif, oxidoreductase; H | 97.88 | |
| 3d1c_A | 369 | Flavin-containing putative monooxygenase; NP_37310 | 97.87 | |
| 2yg5_A | 453 | Putrescine oxidase; oxidoreductase, flavin; HET: F | 97.87 | |
| 4g6h_A | 502 | Rotenone-insensitive NADH-ubiquinone oxidoreducta | 97.86 | |
| 1v0j_A | 399 | UDP-galactopyranose mutase; flavoprotein, isomeras | 97.85 | |
| 2ivd_A | 478 | PPO, PPOX, protoporphyrinogen oxidase; porphyrin b | 97.85 | |
| 3hdq_A | 397 | UDP-galactopyranose mutase; substrate and inhibito | 97.84 | |
| 3s5w_A | 463 | L-ornithine 5-monooxygenase; class B flavin depend | 97.81 | |
| 2vvm_A | 495 | Monoamine oxidase N; FAD, peroxisome, flavoprotein | 97.81 | |
| 3itj_A | 338 | Thioredoxin reductase 1; disulfide B flavoprotein, | 97.8 | |
| 1sez_A | 504 | Protoporphyrinogen oxidase, mitochondrial; FAD-bin | 97.78 | |
| 2bi7_A | 384 | UDP-galactopyranose mutase; FAD, flavoprotein, iso | 97.78 | |
| 2iid_A | 498 | L-amino-acid oxidase; flavoenzyme, FAD binding dom | 97.76 | |
| 1i8t_A | 367 | UDP-galactopyranose mutase; rossman fold, FAD, con | 97.74 | |
| 2bry_A | 497 | NEDD9 interacting protein with calponin homology a | 97.73 | |
| 3ab1_A | 360 | Ferredoxin--NADP reductase; oxidoreductase, electr | 97.68 | |
| 2q7v_A | 325 | Thioredoxin reductase; rossman fold, FAD, flavopro | 97.67 | |
| 4dsg_A | 484 | UDP-galactopyranose mutase; rossmann fold, flavin | 97.66 | |
| 2ywl_A | 180 | Thioredoxin reductase related protein; uncharacter | 97.66 | |
| 3ihm_A | 430 | Styrene monooxygenase A; rossman fold, anti-parall | 97.65 | |
| 3dje_A | 438 | Fructosyl amine: oxygen oxidoreductase; fructosyl- | 97.64 | |
| 2z3y_A | 662 | Lysine-specific histone demethylase 1; chromatin, | 97.63 | |
| 2x8g_A | 598 | Thioredoxin glutathione reductase; redox-active ce | 97.62 | |
| 3r9u_A | 315 | Thioredoxin reductase; structural genomics, center | 97.62 | |
| 3g3e_A | 351 | D-amino-acid oxidase; FAD, flavoprotein, oxidoredu | 97.61 | |
| 2a87_A | 335 | TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL | 97.61 | |
| 2q0l_A | 311 | TRXR, thioredoxin reductase; bacterial thiredoxin | 97.61 | |
| 1fl2_A | 310 | Alkyl hydroperoxide reductase subunit F; reactive | 97.6 | |
| 1vdc_A | 333 | NTR, NADPH dependent thioredoxin reductase; hypoth | 97.6 | |
| 3k30_A | 690 | Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi | 97.57 | |
| 2xag_A | 852 | Lysine-specific histone demethylase 1; amine oxida | 97.56 | |
| 3l8k_A | 466 | Dihydrolipoyl dehydrogenase; redox-active center, | 97.55 | |
| 1c0p_A | 363 | D-amino acid oxidase; alpha-beta-alpha motif, flav | 97.51 | |
| 3cty_A | 319 | Thioredoxin reductase; FAD, oxidoreductase, flavin | 97.5 | |
| 3f8d_A | 323 | Thioredoxin reductase (TRXB-3); redox protein, nuc | 97.5 | |
| 1d5t_A | 433 | Guanine nucleotide dissociation inhibitor; ultra-h | 97.5 | |
| 2oln_A | 397 | NIKD protein; flavoprotein, rossmann fold, oxidore | 97.48 | |
| 1b37_A | 472 | Protein (polyamine oxidase); flavin-dependent amin | 97.47 | |
| 4at0_A | 510 | 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore | 97.45 | |
| 2aqj_A | 538 | Tryptophan halogenase, pRNA; flavin-dependent halo | 97.43 | |
| 2e4g_A | 550 | Tryptophan halogenase; flavin-binding, rebeccamyci | 97.4 | |
| 2pyx_A | 526 | Tryptophan halogenase; structural genomics, JOI fo | 97.39 | |
| 3fbs_A | 297 | Oxidoreductase; structural genomics, PSI2, MCSG, p | 97.38 | |
| 3lzw_A | 332 | Ferredoxin--NADP reductase 2; ferredoxin reductase | 97.38 | |
| 2gv8_A | 447 | Monooxygenase; FMO, FAD, NADPH, cofactor complex, | 97.35 | |
| 4a5l_A | 314 | Thioredoxin reductase; oxidoreductase, redox metab | 97.32 | |
| 4gut_A | 776 | Lysine-specific histone demethylase 1B; histone de | 97.31 | |
| 3da1_A | 561 | Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 | 97.31 | |
| 3g5s_A | 443 | Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy | 97.31 | |
| 2r0c_A | 549 | REBC; flavin adenine dinucleotide, monooxygenase, | 97.3 | |
| 1chu_A | 540 | Protein (L-aspartate oxidase); flavoenzyme, NAD bi | 97.29 | |
| 2xve_A | 464 | Flavin-containing monooxygenase; oxidoreductase; H | 97.27 | |
| 1ps9_A | 671 | 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel | 97.27 | |
| 2weu_A | 511 | Tryptophan 5-halogenase; regioselectivity, antifun | 97.25 | |
| 3p1w_A | 475 | Rabgdi protein; GDI RAB, malaria, structural genom | 97.25 | |
| 3gwf_A | 540 | Cyclohexanone monooxygenase; flavoprotein biocatal | 97.23 | |
| 2qcu_A | 501 | Aerobic glycerol-3-phosphate dehydrogenase; glycer | 97.22 | |
| 4gcm_A | 312 | TRXR, thioredoxin reductase; FAD/NAD-linked reduct | 97.2 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 97.18 | |
| 1pn0_A | 665 | Phenol 2-monooxygenase; two dimers, TLS refinement | 97.18 | |
| 2dkh_A | 639 | 3-hydroxybenzoate hydroxylase; flavoprotein, monoo | 97.18 | |
| 3pl8_A | 623 | Pyranose 2-oxidase; substrate complex, H167A mutan | 97.18 | |
| 3v76_A | 417 | Flavoprotein; structural genomics, PSI-biology, NE | 97.16 | |
| 1rp0_A | 284 | ARA6, thiazole biosynthetic enzyme; protein ligand | 97.15 | |
| 2vdc_G | 456 | Glutamate synthase [NADPH] small chain; oxidoreduc | 97.14 | |
| 1o94_A | 729 | Tmadh, trimethylamine dehydrogenase; electron tran | 97.12 | |
| 2wdq_A | 588 | Succinate dehydrogenase flavoprotein subunit; succ | 97.11 | |
| 3nlc_A | 549 | Uncharacterized protein VP0956; FAD-binding protei | 97.1 | |
| 4ap3_A | 549 | Steroid monooxygenase; oxidoreductase, baeyer-vill | 97.06 | |
| 2rgh_A | 571 | Alpha-glycerophosphate oxidase; flavoprotein oxida | 97.06 | |
| 3uox_A | 545 | Otemo; baeyer-villiger monooxygenase, oxidoreducta | 97.05 | |
| 2h88_A | 621 | Succinate dehydrogenase flavoprotein subunit; comp | 97.04 | |
| 2i0z_A | 447 | NAD(FAD)-utilizing dehydrogenases; structural geno | 97.03 | |
| 3e1t_A | 512 | Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro | 97.0 | |
| 2bs2_A | 660 | Quinol-fumarate reductase flavoprotein subunit A; | 96.98 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 96.97 | |
| 4a9w_A | 357 | Monooxygenase; baeyer-villiger, FAD, oxidoreductas | 96.95 | |
| 3axb_A | 448 | Putative oxidoreductase; dinucleotide-binding fold | 96.93 | |
| 3ayj_A | 721 | Pro-enzyme of L-phenylalanine oxidase; amino acid | 96.92 | |
| 2gag_A | 965 | Heterotetrameric sarcosine oxidase alpha-subunit; | 96.89 | |
| 2cul_A | 232 | Glucose-inhibited division protein A-related PROT | 96.88 | |
| 3lk7_A | 451 | UDP-N-acetylmuramoylalanine--D-glutamate ligase; a | 96.86 | |
| 3gyx_A | 662 | Adenylylsulfate reductase; oxidoreductase; HET: FA | 96.8 | |
| 1jnr_A | 643 | Adenylylsulfate reductase; oxidoreductase; HET: FA | 96.78 | |
| 3sx6_A | 437 | Sulfide-quinone reductase, putative; sulfide:quino | 96.7 | |
| 2x5o_A | 439 | UDP-N-acetylmuramoylalanine--D-glutamate ligase; A | 96.67 | |
| 3h28_A | 430 | Sulfide-quinone reductase; monotopic membrane prot | 96.62 | |
| 2gqf_A | 401 | Hypothetical protein HI0933; structural genomics, | 96.61 | |
| 1lqt_A | 456 | FPRA; NADP+ derivative, oxidoreductase, structural | 96.58 | |
| 3dfz_A | 223 | SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase | 96.57 | |
| 1gte_A | 1025 | Dihydropyrimidine dehydrogenase; electron transfer | 96.57 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 96.57 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 96.57 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 96.56 | |
| 1cjc_A | 460 | Protein (adrenodoxin reductase); flavoenzyme, MAD | 96.55 | |
| 3cgv_A | 397 | Geranylgeranyl reductase related protein; NP_39399 | 96.42 | |
| 1y0p_A | 571 | Fumarate reductase flavoprotein subunit; flavocyto | 96.36 | |
| 3h8l_A | 409 | NADH oxidase; membrane protein, complete form, ros | 96.36 | |
| 1kdg_A | 546 | CDH, cellobiose dehydrogenase; GMC oxidoreductase, | 96.34 | |
| 1ju2_A | 536 | HydroxynitrIle lyase; flavin, GMC oxidoreductase, | 96.28 | |
| 3oz2_A | 397 | Digeranylgeranylglycerophospholipid reductase; str | 96.21 | |
| 2x3n_A | 399 | Probable FAD-dependent monooxygenase; oxidoreducta | 96.19 | |
| 3i3l_A | 591 | Alkylhalidase CMLS; flavin-dependent halogenase, c | 96.18 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 96.16 | |
| 3t37_A | 526 | Probable dehydrogenase; BET alpha beta fold, ADP b | 96.14 | |
| 3eag_A | 326 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME | 96.08 | |
| 2qa1_A | 500 | PGAE, polyketide oxygenase PGAE; FAD, angucycline, | 96.05 | |
| 2gjc_A | 326 | Thiazole biosynthetic enzyme, mitochondrial; gluta | 96.05 | |
| 1qo8_A | 566 | Flavocytochrome C3 fumarate reductase; oxidoreduct | 96.03 | |
| 3q9t_A | 577 | Choline dehydrogenase and related flavoproteins; g | 95.99 | |
| 3kkj_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 95.97 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 95.94 | |
| 2gmh_A | 584 | Electron transfer flavoprotein-ubiquinone oxidored | 95.9 | |
| 1d4d_A | 572 | Flavocytochrome C fumarate reductase; oxidoreducta | 95.89 | |
| 2qa2_A | 499 | CABE, polyketide oxygenase CABE; FAD, angucycline, | 95.87 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 95.78 | |
| 1pzg_A | 331 | LDH, lactate dehydrogenase; apicomplexa, APAD, tet | 95.74 | |
| 3qvp_A | 583 | Glucose oxidase; oxidoreductase; HET: NAG BMA MAN | 95.69 | |
| 1n4w_A | 504 | CHOD, cholesterol oxidase; flavoenzyme, steroid me | 95.61 | |
| 4dgk_A | 501 | Phytoene dehydrogenase; the FAD/NAD(P)-binding ros | 95.48 | |
| 1coy_A | 507 | Cholesterol oxidase; oxidoreductase(oxygen recepto | 95.46 | |
| 3vrd_B | 401 | FCCB subunit, flavocytochrome C flavin subunit; su | 95.41 | |
| 3jsk_A | 344 | Cypbp37 protein; octameric thiazole synthase, bios | 95.4 | |
| 3fmw_A | 570 | Oxygenase; mithramycin, baeyer-villiger, flavin bi | 95.19 | |
| 3nep_X | 314 | Malate dehydrogenase; halophIle, molecular adpatat | 95.15 | |
| 1pjq_A | 457 | CYSG, siroheme synthase; rossman fold, nucleotide | 95.15 | |
| 3l9w_A | 413 | Glutathione-regulated potassium-efflux system Pro | 95.08 | |
| 4fk1_A | 304 | Putative thioredoxin reductase; structural genomic | 95.04 | |
| 2jbv_A | 546 | Choline oxidase; alcohol oxidation, flavoenyzme ox | 95.04 | |
| 1gpe_A | 587 | Protein (glucose oxidase); oxidoreductase(flavopro | 95.02 | |
| 3fim_B | 566 | ARYL-alcohol oxidase; AAO, lignin degradation, oxi | 94.86 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 94.85 | |
| 1vg0_A | 650 | RAB proteins geranylgeranyltransferase component A | 94.84 | |
| 3doj_A | 310 | AT3G25530, dehydrogenase-like protein; gamma-hydro | 94.75 | |
| 3vtf_A | 444 | UDP-glucose 6-dehydrogenase; two discrete alpha/be | 94.72 | |
| 3dfz_A | 223 | SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase | 94.72 | |
| 1oju_A | 294 | MDH, malate dehydrogenase; hyperthermophilic, oxid | 94.7 | |
| 4hb9_A | 412 | Similarities with probable monooxygenase; flavin, | 94.67 | |
| 1yvv_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 94.47 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 94.46 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 94.27 | |
| 1kyq_A | 274 | Met8P, siroheme biosynthesis protein Met8; homodim | 94.24 | |
| 4dio_A | 405 | NAD(P) transhydrogenase subunit alpha PART 1; stru | 94.19 | |
| 3hyw_A | 430 | Sulfide-quinone reductase; monotopic membrane prot | 94.15 | |
| 2jae_A | 489 | L-amino acid oxidase; oxidoreductase, dimerisation | 94.01 | |
| 3nrn_A | 421 | Uncharacterized protein PF1083; alpha-beta protein | 94.0 | |
| 2e5v_A | 472 | L-aspartate oxidase; archaea, oxidoreductase; HET: | 94.0 | |
| 3p2y_A | 381 | Alanine dehydrogenase/pyridine nucleotide transhy; | 93.79 | |
| 1f0y_A | 302 | HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive | 93.78 | |
| 2iid_A | 498 | L-amino-acid oxidase; flavoenzyme, FAD binding dom | 93.77 | |
| 3ka7_A | 425 | Oxidoreductase; structural genomics, PSI-2, protei | 93.73 | |
| 3nks_A | 477 | Protoporphyrinogen oxidase; FAD containing protein | 93.72 | |
| 2xdo_A | 398 | TETX2 protein; tetracycline degradation, tigecycli | 93.7 | |
| 1lld_A | 319 | L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N | 93.6 | |
| 3alj_A | 379 | 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; | 93.58 | |
| 3c96_A | 410 | Flavin-containing monooxygenase; FAD, oxidoreducta | 93.5 | |
| 4a7p_A | 446 | UDP-glucose dehydrogenase; oxidoreductase, carbohy | 93.5 | |
| 3g5s_A | 443 | Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy | 93.46 | |
| 2vou_A | 397 | 2,6-dihydroxypyridine hydroxylase; oxidoreductase, | 93.43 | |
| 4gde_A | 513 | UDP-galactopyranose mutase; flavin adenine dinucle | 93.43 | |
| 3rp8_A | 407 | Flavoprotein monooxygenase; FAD-binding protein, o | 93.42 | |
| 3ihm_A | 430 | Styrene monooxygenase A; rossman fold, anti-parall | 93.41 | |
| 4hv4_A | 494 | UDP-N-acetylmuramate--L-alanine ligase; MURC, yers | 93.41 | |
| 3k7m_X | 431 | 6-hydroxy-L-nicotine oxidase; enantiomeric substra | 93.41 | |
| 2a9f_A | 398 | Putative malic enzyme ((S)-malate:NAD+ oxidoreduct | 93.38 | |
| 3c4a_A | 381 | Probable tryptophan hydroxylase VIOD; alpha-beta p | 93.32 | |
| 3dme_A | 369 | Conserved exported protein; structural genomics, P | 93.28 | |
| 1x13_A | 401 | NAD(P) transhydrogenase subunit alpha; NAD(H)-bind | 93.19 | |
| 2oln_A | 397 | NIKD protein; flavoprotein, rossmann fold, oxidore | 93.17 | |
| 3nyc_A | 381 | D-arginine dehydrogenase; FAD, imino-arginine, oxi | 93.15 | |
| 2b9w_A | 424 | Putative aminooxidase; isomerase, conjugated linol | 93.14 | |
| 1l7d_A | 384 | Nicotinamide nucleotide transhydrogenase, subunit | 93.13 | |
| 1ryi_A | 382 | Glycine oxidase; flavoprotein, protein-inhibitor c | 93.12 | |
| 1ks9_A | 291 | KPA reductase;, 2-dehydropantoate 2-reductase; PAN | 93.08 | |
| 1rsg_A | 516 | FMS1 protein; FAD binding motif, oxidoreductase; H | 93.05 | |
| 3nix_A | 421 | Flavoprotein/dehydrogenase; structural genomics, P | 93.0 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 92.95 | |
| 3i83_A | 320 | 2-dehydropantoate 2-reductase; structural genomics | 92.91 | |
| 3slk_A | 795 | Polyketide synthase extender module 2; rossmann fo | 92.9 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 92.89 | |
| 2ew2_A | 316 | 2-dehydropantoate 2-reductase, putative; alpha-str | 92.89 | |
| 2uzz_A | 372 | N-methyl-L-tryptophan oxidase; N-methyltryptophan | 92.88 | |
| 2raf_A | 209 | Putative dinucleotide-binding oxidoreductase; NP_7 | 92.81 | |
| 1vl6_A | 388 | Malate oxidoreductase; TM0542, NAD-dependent malic | 92.79 | |
| 2gf3_A | 389 | MSOX, monomeric sarcosine oxidase; flavoprotein ox | 92.76 | |
| 3i6d_A | 470 | Protoporphyrinogen oxidase; protein-inhibitor comp | 92.69 | |
| 4e12_A | 283 | Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 | 92.64 | |
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 92.6 | |
| 4ffl_A | 363 | PYLC; amino acid, biosynthesis of pyrrolysine, iso | 92.59 | |
| 1y56_B | 382 | Sarcosine oxidase; dehydrogenase, protein-protein | 92.54 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 92.53 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 92.51 | |
| 1c0p_A | 363 | D-amino acid oxidase; alpha-beta-alpha motif, flav | 92.5 | |
| 3k96_A | 356 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA | 92.46 | |
| 1k0i_A | 394 | P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h | 92.4 | |
| 2ivd_A | 478 | PPO, PPOX, protoporphyrinogen oxidase; porphyrin b | 92.38 | |
| 2e1m_A | 376 | L-glutamate oxidase; L-amino acid oxidase, FAD, L- | 92.38 | |
| 3ghy_A | 335 | Ketopantoate reductase protein; oxidoreductase, NA | 92.37 | |
| 1guz_A | 310 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 92.35 | |
| 3dje_A | 438 | Fructosyl amine: oxygen oxidoreductase; fructosyl- | 92.33 | |
| 2v6b_A | 304 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ra | 92.24 | |
| 1s3e_A | 520 | Amine oxidase [flavin-containing] B; human monoami | 92.23 | |
| 1kyq_A | 274 | Met8P, siroheme biosynthesis protein Met8; homodim | 92.2 | |
| 2bcg_G | 453 | Secretory pathway GDP dissociation inhibitor; RABG | 92.17 | |
| 3dtt_A | 245 | NADP oxidoreductase; structural genomics, joint ce | 92.15 | |
| 1y6j_A | 318 | L-lactate dehydrogenase; southeast collaboratory f | 92.12 | |
| 3hn2_A | 312 | 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str | 92.09 | |
| 3atr_A | 453 | Conserved archaeal protein; saturating double bond | 92.07 | |
| 2ewd_A | 317 | Lactate dehydrogenase,; protein-substrate_cofactor | 91.91 | |
| 1pjc_A | 361 | Protein (L-alanine dehydrogenase); oxidoreductase, | 91.89 | |
| 1jw9_B | 249 | Molybdopterin biosynthesis MOEB protein; MOEB: mod | 91.89 | |
| 2o3j_A | 481 | UDP-glucose 6-dehydrogenase; structural genomics, | 91.88 | |
| 2y0c_A | 478 | BCEC, UDP-glucose dehydrogenase; oxidoreductase, c | 91.88 | |
| 3qj4_A | 342 | Renalase; FAD/NAD(P)-binding rossmann fold superfa | 91.85 | |
| 3ado_A | 319 | Lambda-crystallin; L-gulonate 3-dehydrogenase, str | 91.83 | |
| 1sez_A | 504 | Protoporphyrinogen oxidase, mitochondrial; FAD-bin | 91.82 | |
| 3g79_A | 478 | NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; | 91.79 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 91.79 | |
| 1bg6_A | 359 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L | 91.77 | |
| 3pqe_A | 326 | L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas | 91.69 | |
| 3k6j_A | 460 | Protein F01G10.3, confirmed by transcript evidenc; | 91.62 | |
| 2bi7_A | 384 | UDP-galactopyranose mutase; FAD, flavoprotein, iso | 91.56 | |
| 3gg2_A | 450 | Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd | 91.52 | |
| 3ps9_A | 676 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 91.52 | |
| 2vns_A | 215 | Metalloreductase steap3; metal-binding, transmembr | 91.51 | |
| 2hjr_A | 328 | Malate dehydrogenase; malaria, structural genomics | 91.48 | |
| 2yg5_A | 453 | Putrescine oxidase; oxidoreductase, flavin; HET: F | 91.45 | |
| 3ggo_A | 314 | Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b | 91.45 | |
| 3ihg_A | 535 | RDME; flavoenzyme, anthracycline, polyketide biosy | 91.42 | |
| 1t2d_A | 322 | LDH-P, L-lactate dehydrogenase; ternary complex, o | 91.35 | |
| 3g17_A | 294 | Similar to 2-dehydropantoate 2-reductase; structur | 91.32 | |
| 3q2o_A | 389 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 91.29 | |
| 3g3e_A | 351 | D-amino-acid oxidase; FAD, flavoprotein, oxidoredu | 91.29 | |
| 3gvi_A | 324 | Malate dehydrogenase; NAD, oxidoreductase, tricarb | 91.25 | |
| 3pef_A | 287 | 6-phosphogluconate dehydrogenase, NAD-binding; gam | 91.23 | |
| 3g0o_A | 303 | 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine | 91.22 | |
| 2eez_A | 369 | Alanine dehydrogenase; TTHA0216, structural genomi | 91.21 | |
| 3tl2_A | 315 | Malate dehydrogenase; center for structural genomi | 91.17 | |
| 2vhw_A | 377 | Alanine dehydrogenase; NAD, secreted, oxidoreducta | 91.13 | |
| 3c4n_A | 405 | Uncharacterized protein DR_0571; alpha-beta protei | 91.12 | |
| 3ces_A | 651 | MNMG, tRNA uridine 5-carboxymethylaminomethyl modi | 91.11 | |
| 2r0c_A | 549 | REBC; flavin adenine dinucleotide, monooxygenase, | 91.06 | |
| 3pvc_A | 689 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 91.06 | |
| 1jw9_B | 249 | Molybdopterin biosynthesis MOEB protein; MOEB: mod | 91.0 | |
| 2vvm_A | 495 | Monoamine oxidase N; FAD, peroxisome, flavoprotein | 91.0 | |
| 3ego_A | 307 | Probable 2-dehydropantoate 2-reductase; structural | 90.97 | |
| 2q3e_A | 467 | UDP-glucose 6-dehydrogenase; hexamer, structural g | 90.96 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 90.95 | |
| 2dpo_A | 319 | L-gulonate 3-dehydrogenase; structural genomics, N | 90.88 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 90.85 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 90.84 | |
| 2qcu_A | 501 | Aerobic glycerol-3-phosphate dehydrogenase; glycer | 90.79 | |
| 4dsg_A | 484 | UDP-galactopyranose mutase; rossmann fold, flavin | 90.79 | |
| 3phh_A | 269 | Shikimate dehydrogenase; shikimate pathway, helico | 90.77 | |
| 2zxi_A | 637 | TRNA uridine 5-carboxymethylaminomethyl modificat | 90.76 | |
| 3p7m_A | 321 | Malate dehydrogenase; putative dehydrogenase, enzy | 90.75 | |
| 2i6t_A | 303 | Ubiquitin-conjugating enzyme E2-like isoform A; L- | 90.75 | |
| 1z82_A | 335 | Glycerol-3-phosphate dehydrogenase; TM0378, struct | 90.72 | |
| 1mv8_A | 436 | GMD, GDP-mannose 6-dehydrogenase; rossman fold, do | 90.7 | |
| 3ojo_A | 431 | CAP5O; rossmann fold, complex with cofactor NAD an | 90.67 | |
| 2h78_A | 302 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 | 90.66 | |
| 3cp8_A | 641 | TRNA uridine 5-carboxymethylaminomethyl modificati | 90.65 | |
| 3hdq_A | 397 | UDP-galactopyranose mutase; substrate and inhibito | 90.61 | |
| 1a5z_A | 319 | L-lactate dehydrogenase; oxidoreductase, glycolysi | 90.6 | |
| 1nyt_A | 271 | Shikimate 5-dehydrogenase; alpha/beta domains, WID | 90.54 | |
| 4dll_A | 320 | 2-hydroxy-3-oxopropionate reductase; structural ge | 90.48 | |
| 1txg_A | 335 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid | 90.46 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 90.46 | |
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 90.44 | |
| 1jay_A | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma | 90.44 | |
| 3lov_A | 475 | Protoporphyrinogen oxidase; structural genomics, J | 90.41 | |
| 4huj_A | 220 | Uncharacterized protein; PSI-biology, nysgrc, stru | 90.39 | |
| 1ldn_A | 316 | L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA | 90.36 | |
| 2uyy_A | 316 | N-PAC protein; long-chain dehydrogenase, cytokine; | 90.36 | |
| 3ldh_A | 330 | Lactate dehydrogenase; oxidoreductase, CHOH donor, | 90.36 | |
| 3pdu_A | 287 | 3-hydroxyisobutyrate dehydrogenase family protein; | 90.33 | |
| 3d0o_A | 317 | L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly | 90.32 | |
| 3hwr_A | 318 | 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A | 90.27 | |
| 1v0j_A | 399 | UDP-galactopyranose mutase; flavoprotein, isomeras | 90.26 | |
| 2pv7_A | 298 | T-protein [includes: chorismate mutase (EC 5.4.99 | 90.25 | |
| 2egg_A | 297 | AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff | 90.24 | |
| 3hn7_A | 524 | UDP-N-acetylmuramate-L-alanine ligase; ATP-binding | 90.24 | |
| 3vku_A | 326 | L-LDH, L-lactate dehydrogenase; rossmann fold, NAD | 90.22 | |
| 4aj2_A | 331 | L-lactate dehydrogenase A chain; oxidoreductase-in | 90.21 | |
| 3pid_A | 432 | UDP-glucose 6-dehydrogenase; rossmann fold, oxidor | 90.16 | |
| 3qha_A | 296 | Putative oxidoreductase; seattle structural genomi | 90.13 | |
| 1i8t_A | 367 | UDP-galactopyranose mutase; rossman fold, FAD, con | 90.11 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 90.1 | |
| 2z3y_A | 662 | Lysine-specific histone demethylase 1; chromatin, | 90.06 | |
| 1dlj_A | 402 | UDP-glucose dehydrogenase; rossmann fold, ternary | 90.04 | |
| 2aqj_A | 538 | Tryptophan halogenase, pRNA; flavin-dependent halo | 90.04 |
| >1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.4e-38 Score=308.60 Aligned_cols=306 Identities=48% Similarity=0.809 Sum_probs=245.5
Q ss_pred CCCeEEEECCchHHHHHHHHHhhcCCCCeEEEEcCCCCCccccccccCCCCcchhHHHHHHHHHhhcCCcEEEeCeEEce
Q 019876 18 NPLRVCVVGSGPAGFYTAEKTLKAHQEAQVDIIDRLPTPFGLVRSGVAPDHPETKIVINQFSRVVQHERCSFFGNVTLGS 97 (334)
Q Consensus 18 ~~~~vvIIGaG~aGl~aA~~l~~~~~~~~v~vie~~~~~gg~~~~~~~p~~~~~~~~~~~~~~~~~~~~i~~~~~~~v~~ 97 (334)
.+++|+||||||||+++|..|++.+++.+|+|||+++.+||++++++.|+++..+++..++.+++++.+++++.++.++.
T Consensus 5 ~~~~vvIIG~G~aGl~aA~~l~~~g~~~~V~vie~~~~~gg~~~~g~~p~~~~~~~~~~~~~~~~~~~gv~~~~~~~v~~ 84 (460)
T 1cjc_A 5 QTPQICVVGSGPAGFYTAQHLLKHHSRAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTQTARSDRCAFYGNVEVGR 84 (460)
T ss_dssp -CCEEEEECCSHHHHHHHHHHHHHCSSCEEEEECSSSSSCTHHHHTSCTTCGGGGGHHHHHHHHHTSTTEEEEBSCCBTT
T ss_pred CCceEEEECcCHHHHHHHHHHHhcCCCCCEEEEeCCCcCCceeecccCCCCccHHHHHHHHHHHHHhCCcEEEeeeEEee
Confidence 46799999999999999999999877799999999999999999999888877788888888899999999999988766
Q ss_pred EEecccceeccCeEEEeccCCCCCCCCCCCccCCCccchhhHHHHhcCCCCCCCCCCCCCCCCeEEEEcCCHHHHHHHHH
Q 019876 98 SVSLSELRQLYHVVVLAYGAESDRALGIPGEDLIGVHSAREFVWWYNGHPDGKNLSPDLKSTDTAVILGQGNVALDVARI 177 (334)
Q Consensus 98 ~v~~~~~~~~yd~lIlATGs~~p~~~~ipG~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~k~vvVIG~G~~g~e~A~~ 177 (334)
++++.+....||+||||||+..++.|++||.+.+++++++++..+++..+++......+ .+++|+|||+|++|+|+|..
T Consensus 85 ~V~~~~~~~~~d~lVlAtGs~~~~~~~ipG~~~~gv~~~~~~~~~~~~~~d~~~~~~~~-~~~~vvVIGgG~~g~e~A~~ 163 (460)
T 1cjc_A 85 DVTVQELQDAYHAVVLSYGAEDHQALDIPGEELPGVFSARAFVGWYNGLPENRELAPDL-SCDTAVILGQGNVALDVARI 163 (460)
T ss_dssp TBCHHHHHHHSSEEEECCCCCEECCCCCTTTTSTTEEEHHHHHHHHTTCGGGTTCCCCT-TSSEEEEESCSHHHHHHHHH
T ss_pred EEEeccceEEcCEEEEecCcCCCCCCCCCCCCCCcEEEHHHHHHHhhcCccccccccCC-CCCEEEEECCCHHHHHHHHH
Confidence 66666555689999999999535888999998899999999998888776665443334 68999999999999999999
Q ss_pred HccCCcccccccccHHHHHHHhcCCcceEEEEeecCccccCCCHHHHHHHHcCCceEEEEccCccCCCCCchhhhhccHH
Q 019876 178 LLRPTEELATTDIASYAWTALEGSSIRKVYLVGRRGPVQAACTAKELREILGIKNLYVHIREDDLIKSPTDEEEMKNSRI 257 (334)
Q Consensus 178 L~~~~~~~~~~~~~~~~~~~~~~~~~~~Vtiv~r~~~~~~~~~~~~~~~~l~~~gv~~~~~~~~~~~~~~~~~~~~~~~~ 257 (334)
|++..+++..|||++++++.+++.++++|+|++|++++...|+.+++++++..+++++.+++.+++. ........++.
T Consensus 164 L~~~~~~l~~tdi~~~a~~~l~~~g~~~V~lv~r~~~~~~~ft~~el~~l~~lp~~~~~~~~~~~~~--~~~~~~~~~~~ 241 (460)
T 1cjc_A 164 LLTPPDHLEKTDITEAALGALRQSRVKTVWIVGRRGPLQVAFTIKELREMIQLPGTRPMLDPADFLG--LQDRIKEAARP 241 (460)
T ss_dssp HHSCGGGGTTSCCCHHHHHHHHTCCCCEEEEECSSCGGGCCCCHHHHHHHHTCTTEEEECCGGGGTT--HHHHTTTSCHH
T ss_pred HhhchhhhccccccHHHHHHHhhCCCcEEEEEEcCChHhhccCHHHHHHhhcCCCceeEechhhhcc--hhhhhhhccHH
Confidence 9999999999999999999999999988999999999999999999999988999999988877642 11111124566
Q ss_pred HHHHHHHHHHHHhcc-C--C--CCCCCceEEEEEeccccceeeccccCCC-CeeEEEEEEeeeecCCCCcceeecCCc
Q 019876 258 QRRVYELLSKAAASA-S--S--QPMLGQRELHFVFFRKPDSFLESNERSG-HVSGVHFEKTALKGGGPGKQYAVGTGE 329 (334)
Q Consensus 258 ~~~~~~~~~~~~~~~-~--~--~~~~~~~gv~~~~~~~~~~i~~~~~~~~-~v~~v~~~~~~~~~~~~~~~~~~~~~~ 329 (334)
.+++.++|++.+.+. + . ......+||+|+++++|++|. +++++ ++++|++.++.+..+ +|+..++++|+
T Consensus 242 ~~~~~~~l~~~~~~~~~~~~~~~~~~~~~gv~~~~~~~~~~i~--~~~~~~~v~~v~~~~~~l~~~-~~~~~~~~~g~ 316 (460)
T 1cjc_A 242 RKRLMELLLRTATEKPGVEEAARRASASRAWGLRFFRSPQQVL--PSPDGRRAAGIRLAVTRLEGI-GEATRAVPTGD 316 (460)
T ss_dssp HHHHHHHHHHHHHSCCCHHHHHHHHTCSEEEEEECSEEEEEEE--ECTTSSSEEEEEEEEEEEESS-GGGCEEEEEEE
T ss_pred HHHHHHHHHHHHHhccccccccCCCCCCceEEEECCCChheEE--cCCCCceEEEEEEEEEEEccc-cCCCcccCCCc
Confidence 677777777665300 0 0 000123899999999999998 52126 899999987766432 23333444554
|
| >1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* | Back alignment and structure |
|---|
| >2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} | Back alignment and structure |
|---|
| >1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* | Back alignment and structure |
|---|
| >3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* | Back alignment and structure |
|---|
| >3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* | Back alignment and structure |
|---|
| >3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* | Back alignment and structure |
|---|
| >3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* | Back alignment and structure |
|---|
| >2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* | Back alignment and structure |
|---|
| >1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* | Back alignment and structure |
|---|
| >3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* | Back alignment and structure |
|---|
| >1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* | Back alignment and structure |
|---|
| >2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* | Back alignment and structure |
|---|
| >1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* | Back alignment and structure |
|---|
| >1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* | Back alignment and structure |
|---|
| >1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 | Back alignment and structure |
|---|
| >2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* | Back alignment and structure |
|---|
| >1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} | Back alignment and structure |
|---|
| >2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* | Back alignment and structure |
|---|
| >2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* | Back alignment and structure |
|---|
| >1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* | Back alignment and structure |
|---|
| >1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* | Back alignment and structure |
|---|
| >3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} | Back alignment and structure |
|---|
| >2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* | Back alignment and structure |
|---|
| >2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* | Back alignment and structure |
|---|
| >1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* | Back alignment and structure |
|---|
| >2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* | Back alignment and structure |
|---|
| >3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... | Back alignment and structure |
|---|
| >2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* | Back alignment and structure |
|---|
| >2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* | Back alignment and structure |
|---|
| >3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* | Back alignment and structure |
|---|
| >1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* | Back alignment and structure |
|---|
| >4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* | Back alignment and structure |
|---|
| >3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* | Back alignment and structure |
|---|
| >2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* | Back alignment and structure |
|---|
| >1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* | Back alignment and structure |
|---|
| >1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* | Back alignment and structure |
|---|
| >3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* | Back alignment and structure |
|---|
| >4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} | Back alignment and structure |
|---|
| >4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* | Back alignment and structure |
|---|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} | Back alignment and structure |
|---|
| >1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* | Back alignment and structure |
|---|
| >3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* | Back alignment and structure |
|---|
| >3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* | Back alignment and structure |
|---|
| >3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* | Back alignment and structure |
|---|
| >2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* | Back alignment and structure |
|---|
| >3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* | Back alignment and structure |
|---|
| >3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* | Back alignment and structure |
|---|
| >4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* | Back alignment and structure |
|---|
| >3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* | Back alignment and structure |
|---|
| >4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* | Back alignment and structure |
|---|
| >4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* | Back alignment and structure |
|---|
| >1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* | Back alignment and structure |
|---|
| >1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* | Back alignment and structure |
|---|
| >3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* | Back alignment and structure |
|---|
| >1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* | Back alignment and structure |
|---|
| >3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* | Back alignment and structure |
|---|
| >3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* | Back alignment and structure |
|---|
| >4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* | Back alignment and structure |
|---|
| >3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 | Back alignment and structure |
|---|
| >3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* | Back alignment and structure |
|---|
| >2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* | Back alignment and structure |
|---|
| >2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 | Back alignment and structure |
|---|
| >2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 | Back alignment and structure |
|---|
| >3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A | Back alignment and structure |
|---|
| >3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* | Back alignment and structure |
|---|
| >2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 | Back alignment and structure |
|---|
| >3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* | Back alignment and structure |
|---|
| >3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} | Back alignment and structure |
|---|
| >3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* | Back alignment and structure |
|---|
| >3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* | Back alignment and structure |
|---|
| >1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} | Back alignment and structure |
|---|
| >3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} | Back alignment and structure |
|---|
| >3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* | Back alignment and structure |
|---|
| >1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 | Back alignment and structure |
|---|
| >3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} | Back alignment and structure |
|---|
| >2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} | Back alignment and structure |
|---|
| >3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* | Back alignment and structure |
|---|
| >2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* | Back alignment and structure |
|---|
| >3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} | Back alignment and structure |
|---|
| >2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* | Back alignment and structure |
|---|
| >1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 | Back alignment and structure |
|---|
| >3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} | Back alignment and structure |
|---|
| >4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* | Back alignment and structure |
|---|
| >1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* | Back alignment and structure |
|---|
| >2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* | Back alignment and structure |
|---|
| >2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* | Back alignment and structure |
|---|
| >2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} | Back alignment and structure |
|---|
| >1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... | Back alignment and structure |
|---|
| >3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* | Back alignment and structure |
|---|
| >2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* | Back alignment and structure |
|---|
| >2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* | Back alignment and structure |
|---|
| >3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* | Back alignment and structure |
|---|
| >4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} | Back alignment and structure |
|---|
| >3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* | Back alignment and structure |
|---|
| >4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* | Back alignment and structure |
|---|
| >3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* | Back alignment and structure |
|---|
| >3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} | Back alignment and structure |
|---|
| >1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* | Back alignment and structure |
|---|
| >2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* | Back alignment and structure |
|---|
| >2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* | Back alignment and structure |
|---|
| >3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* | Back alignment and structure |
|---|
| >3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} | Back alignment and structure |
|---|
| >1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* | Back alignment and structure |
|---|
| >3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* | Back alignment and structure |
|---|
| >3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* | Back alignment and structure |
|---|
| >3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* | Back alignment and structure |
|---|
| >1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* | Back alignment and structure |
|---|
| >3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* | Back alignment and structure |
|---|
| >2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* | Back alignment and structure |
|---|
| >3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* | Back alignment and structure |
|---|
| >2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* | Back alignment and structure |
|---|
| >2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} | Back alignment and structure |
|---|
| >1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* | Back alignment and structure |
|---|
| >1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* | Back alignment and structure |
|---|
| >3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... | Back alignment and structure |
|---|
| >2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* | Back alignment and structure |
|---|
| >1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* | Back alignment and structure |
|---|
| >3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* | Back alignment and structure |
|---|
| >1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* | Back alignment and structure |
|---|
| >1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* | Back alignment and structure |
|---|
| >1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* | Back alignment and structure |
|---|
| >2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} | Back alignment and structure |
|---|
| >3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} | Back alignment and structure |
|---|
| >3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* | Back alignment and structure |
|---|
| >3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} | Back alignment and structure |
|---|
| >3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* | Back alignment and structure |
|---|
| >4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} | Back alignment and structure |
|---|
| >3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* | Back alignment and structure |
|---|
| >1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* | Back alignment and structure |
|---|
| >1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... | Back alignment and structure |
|---|
| >1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* | Back alignment and structure |
|---|
| >1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* | Back alignment and structure |
|---|
| >3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* | Back alignment and structure |
|---|
| >3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* | Back alignment and structure |
|---|
| >3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* | Back alignment and structure |
|---|
| >2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* | Back alignment and structure |
|---|
| >1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* | Back alignment and structure |
|---|
| >3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* | Back alignment and structure |
|---|
| >4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* | Back alignment and structure |
|---|
| >1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* | Back alignment and structure |
|---|
| >3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* | Back alignment and structure |
|---|
| >3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* | Back alignment and structure |
|---|
| >2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* | Back alignment and structure |
|---|
| >3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* | Back alignment and structure |
|---|
| >1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 | Back alignment and structure |
|---|
| >2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* | Back alignment and structure |
|---|
| >2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* | Back alignment and structure |
|---|
| >1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 | Back alignment and structure |
|---|
| >2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* | Back alignment and structure |
|---|
| >3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* | Back alignment and structure |
|---|
| >2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* | Back alignment and structure |
|---|
| >3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* | Back alignment and structure |
|---|
| >2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A | Back alignment and structure |
|---|
| >2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* | Back alignment and structure |
|---|
| >3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* | Back alignment and structure |
|---|
| >2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* | Back alignment and structure |
|---|
| >1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 | Back alignment and structure |
|---|
| >1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* | Back alignment and structure |
|---|
| >3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} | Back alignment and structure |
|---|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A | Back alignment and structure |
|---|
| >3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* | Back alignment and structure |
|---|
| >3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* | Back alignment and structure |
|---|
| >1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A | Back alignment and structure |
|---|
| >2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* | Back alignment and structure |
|---|
| >1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* | Back alignment and structure |
|---|
| >4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* | Back alignment and structure |
|---|
| >2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* | Back alignment and structure |
|---|
| >2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A | Back alignment and structure |
|---|
| >2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} | Back alignment and structure |
|---|
| >3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* | Back alignment and structure |
|---|
| >2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* | Back alignment and structure |
|---|
| >4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* | Back alignment and structure |
|---|
| >4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* | Back alignment and structure |
|---|
| >3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* | Back alignment and structure |
|---|
| >2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* | Back alignment and structure |
|---|
| >1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* | Back alignment and structure |
|---|
| >2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* | Back alignment and structure |
|---|
| >1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 | Back alignment and structure |
|---|
| >2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* | Back alignment and structure |
|---|
| >3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* | Back alignment and structure |
|---|
| >2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* | Back alignment and structure |
|---|
| >4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* | Back alignment and structure |
|---|
| >2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* | Back alignment and structure |
|---|
| >3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... | Back alignment and structure |
|---|
| >3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 | Back alignment and structure |
|---|
| >2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} | Back alignment and structure |
|---|
| >1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* | Back alignment and structure |
|---|
| >2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* | Back alignment and structure |
|---|
| >3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* | Back alignment and structure |
|---|
| >2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* | Back alignment and structure |
|---|
| >3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* | Back alignment and structure |
|---|
| >2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... | Back alignment and structure |
|---|
| >2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 | Back alignment and structure |
|---|
| >3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} | Back alignment and structure |
|---|
| >2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* | Back alignment and structure |
|---|
| >3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* | Back alignment and structure |
|---|
| >2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* | Back alignment and structure |
|---|
| >2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 | Back alignment and structure |
|---|
| >3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} | Back alignment and structure |
|---|
| >1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* | Back alignment and structure |
|---|
| >3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* | Back alignment and structure |
|---|
| >2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* | Back alignment and structure |
|---|
| >2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 | Back alignment and structure |
|---|
| >1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* | Back alignment and structure |
|---|
| >3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} | Back alignment and structure |
|---|
| >1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* | Back alignment and structure |
|---|
| >1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* | Back alignment and structure |
|---|
| >3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* | Back alignment and structure |
|---|
| >1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* | Back alignment and structure |
|---|
| >1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* | Back alignment and structure |
|---|
| >3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} | Back alignment and structure |
|---|
| >2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* | Back alignment and structure |
|---|
| >1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 | Back alignment and structure |
|---|
| >3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} | Back alignment and structure |
|---|
| >3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* | Back alignment and structure |
|---|
| >1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* | Back alignment and structure |
|---|
| >2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* | Back alignment and structure |
|---|
| >3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* | Back alignment and structure |
|---|
| >1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* | Back alignment and structure |
|---|
| >4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} | Back alignment and structure |
|---|
| >1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* | Back alignment and structure |
|---|
| >3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* | Back alignment and structure |
|---|
| >3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} | Back alignment and structure |
|---|
| >3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} | Back alignment and structure |
|---|
| >3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} | Back alignment and structure |
|---|
| >1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* | Back alignment and structure |
|---|
| >3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* | Back alignment and structure |
|---|
| >4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* | Back alignment and structure |
|---|
| >2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* | Back alignment and structure |
|---|
| >1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 | Back alignment and structure |
|---|
| >3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* | Back alignment and structure |
|---|
| >3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} | Back alignment and structure |
|---|
| >3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} | Back alignment and structure |
|---|
| >1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* | Back alignment and structure |
|---|
| >4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 | Back alignment and structure |
|---|
| >4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* | Back alignment and structure |
|---|
| >2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* | Back alignment and structure |
|---|
| >3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} | Back alignment and structure |
|---|
| >1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* | Back alignment and structure |
|---|
| >2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* | Back alignment and structure |
|---|
| >3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* | Back alignment and structure |
|---|
| >1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* | Back alignment and structure |
|---|
| >3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* | Back alignment and structure |
|---|
| >3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* | Back alignment and structure |
|---|
| >4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} | Back alignment and structure |
|---|
| >3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* | Back alignment and structure |
|---|
| >2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 | Back alignment and structure |
|---|
| >4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* | Back alignment and structure |
|---|
| >3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* | Back alignment and structure |
|---|
| >3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} | Back alignment and structure |
|---|
| >4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A | Back alignment and structure |
|---|
| >3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* | Back alignment and structure |
|---|
| >2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} | Back alignment and structure |
|---|
| >3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} | Back alignment and structure |
|---|
| >1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* | Back alignment and structure |
|---|
| >2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* | Back alignment and structure |
|---|
| >3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* | Back alignment and structure |
|---|
| >2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* | Back alignment and structure |
|---|
| >1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* | Back alignment and structure |
|---|
| >1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* | Back alignment and structure |
|---|
| >1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* | Back alignment and structure |
|---|
| >1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* | Back alignment and structure |
|---|
| >3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} | Back alignment and structure |
|---|
| >3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} | Back alignment and structure |
|---|
| >2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* | Back alignment and structure |
|---|
| >2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* | Back alignment and structure |
|---|
| >3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* | Back alignment and structure |
|---|
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* | Back alignment and structure |
|---|
| >1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* | Back alignment and structure |
|---|
| >3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... | Back alignment and structure |
|---|
| >2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* | Back alignment and structure |
|---|
| >2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} | Back alignment and structure |
|---|
| >3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* | Back alignment and structure |
|---|
| >3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* | Back alignment and structure |
|---|
| >2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... | Back alignment and structure |
|---|
| >1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 | Back alignment and structure |
|---|
| >2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* | Back alignment and structure |
|---|
| >3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} | Back alignment and structure |
|---|
| >1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* | Back alignment and structure |
|---|
| >2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A | Back alignment and structure |
|---|
| >1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* | Back alignment and structure |
|---|
| >2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* | Back alignment and structure |
|---|
| >3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* | Back alignment and structure |
|---|
| >1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 | Back alignment and structure |
|---|
| >3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 | Back alignment and structure |
|---|
| >3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* | Back alignment and structure |
|---|
| >3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* | Back alignment and structure |
|---|
| >3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* | Back alignment and structure |
|---|
| >2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* | Back alignment and structure |
|---|
| >2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* | Back alignment and structure |
|---|
| >3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* | Back alignment and structure |
|---|
| >3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} | Back alignment and structure |
|---|
| >1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* | Back alignment and structure |
|---|
| >3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* | Back alignment and structure |
|---|
| >3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* | Back alignment and structure |
|---|
| >3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* | Back alignment and structure |
|---|
| >3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* | Back alignment and structure |
|---|
| >3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A | Back alignment and structure |
|---|
| >2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* | Back alignment and structure |
|---|
| >3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* | Back alignment and structure |
|---|
| >2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* | Back alignment and structure |
|---|
| >3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* | Back alignment and structure |
|---|
| >4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* | Back alignment and structure |
|---|
| >3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* | Back alignment and structure |
|---|
| >2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* | Back alignment and structure |
|---|
| >3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} | Back alignment and structure |
|---|
| >2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A | Back alignment and structure |
|---|
| >1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* | Back alignment and structure |
|---|
| >3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* | Back alignment and structure |
|---|
| >3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} | Back alignment and structure |
|---|
| >3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* | Back alignment and structure |
|---|
| >1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} | Back alignment and structure |
|---|
| >1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* | Back alignment and structure |
|---|
| >3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* | Back alignment and structure |
|---|
| >2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 | Back alignment and structure |
|---|
| >3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* | Back alignment and structure |
|---|
| >3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3hn7_A UDP-N-acetylmuramate-L-alanine ligase; ATP-binding, nucleotide-binding, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} | Back alignment and structure |
|---|
| >3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... | Back alignment and structure |
|---|
| >3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* | Back alignment and structure |
|---|
| >3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} | Back alignment and structure |
|---|
| >1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A | Back alignment and structure |
|---|
| >1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* | Back alignment and structure |
|---|
| >2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 334 | ||||
| d1lqta1 | 216 | c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA | 4e-51 | |
| d1cjca1 | 225 | c.3.1.1 (A:107-331) Adrenodoxin reductase of mitoc | 6e-51 | |
| d1lqta2 | 239 | c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reduct | 2e-28 | |
| d1cjca2 | 230 | c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase | 1e-23 | |
| d1ps9a3 | 179 | c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA redu | 3e-09 | |
| d1gtea4 | 196 | c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine de | 4e-09 | |
| d2gjca1 | 311 | c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th | 6e-07 | |
| d1rp0a1 | 278 | c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi | 5e-06 | |
| d1ps9a2 | 162 | c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-t | 1e-05 | |
| d1xdia1 | 233 | c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehyd | 3e-04 | |
| d1djqa3 | 233 | c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehyd | 3e-04 | |
| d1gtea3 | 153 | c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenas | 4e-04 | |
| d1b5qa1 | 347 | c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai | 0.001 | |
| d2iida1 | 370 | c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M | 0.002 | |
| d3c96a1 | 288 | c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps | 0.003 | |
| d2gv8a1 | 335 | c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monox | 0.003 | |
| d1nhpa1 | 198 | c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enter | 0.004 |
| >d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 216 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: FAD/NAD(P)-binding domain superfamily: FAD/NAD(P)-binding domain family: C-terminal domain of adrenodoxin reductase-like domain: Ferredoxin:NADP reductase FprA species: Mycobacterium tuberculosis [TaxId: 1773]
Score = 166 bits (422), Expect = 4e-51
Identities = 85/215 (39%), Positives = 117/215 (54%), Gaps = 9/215 (4%)
Query: 120 DRALGIPGEDLIGVHSAREFVWWYNGHPDGKNLSPDLKSTDTAVILGQGNVALDVARILL 179
DR L IPGEDL G +A +FV WYN HP + +SPDL S AV++G GNVALDVARILL
Sbjct: 1 DRMLNIPGEDLPGSIAAVDFVGWYNAHPHFEQVSPDL-SGARAVVIGNGNVALDVARILL 59
Query: 180 RPTEELATTDIASYAWTALEGSSIRKVYLVGRRGPVQAACTAKELREILGIKNLYVHIRE 239
+ LA TDIA +A +L I++V +VGRRGP+QAA T ELRE+ + + V I
Sbjct: 60 TDPDVLARTDIADHALESLRPRGIQEVVIVGRRGPLQAAFTTLELRELADLDGVDVVIDP 119
Query: 240 DDLIKSPTDEEEMKNSRIQRRVYELLSKAAASASSQPMLGQRELHFVFFRKPDSFLESNE 299
+ + TDE+ ++ ++ ++L A +P G R + F F P +
Sbjct: 120 AE-LDGITDEDAAAVGKVCKQNIKVLRGY---ADREPRPGHRRMVFRFLTSP----IEIK 171
Query: 300 RSGHVSGVHFEKTALKGGGPGKQYAVGTGEFEDLD 334
V + + L G G+ A TGE E+L
Sbjct: 172 GKRKVERIVLGRNELVSDGSGRVAAKDTGEREELP 206
|
| >d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Length = 225 | Back information, alignment and structure |
|---|
| >d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 239 | Back information, alignment and structure |
|---|
| >d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Length = 230 | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Length = 179 | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Length = 196 | Back information, alignment and structure |
|---|
| >d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 | Back information, alignment and structure |
|---|
| >d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 | Back information, alignment and structure |
|---|
| >d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 162 | Back information, alignment and structure |
|---|
| >d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 233 | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Length = 233 | Back information, alignment and structure |
|---|
| >d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Length = 153 | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 335 | Back information, alignment and structure |
|---|
| >d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 198 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 334 | |||
| d1lqta1 | 216 | Ferredoxin:NADP reductase FprA {Mycobacterium tube | 99.95 | |
| d1cjca1 | 225 | Adrenodoxin reductase of mitochondrial p450 system | 99.94 | |
| d1ps9a3 | 179 | 2,4-dienoyl-CoA reductase, middle domain {Escheric | 99.82 | |
| d1lqta2 | 239 | Ferredoxin:NADP reductase FprA {Mycobacterium tube | 99.8 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 99.78 | |
| d1cjca2 | 230 | Adrenodoxin reductase of mitochondrial p450 system | 99.76 | |
| d1gesa1 | 217 | Glutathione reductase {Escherichia coli [TaxId: 56 | 99.55 | |
| d2gv8a1 | 335 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 99.45 | |
| d1onfa1 | 259 | Glutathione reductase {Plasmodium falciparum [TaxI | 99.42 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 99.38 | |
| d1gtea4 | 196 | Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su | 99.35 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 99.33 | |
| d1fl2a2 | 126 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 99.33 | |
| d1w4xa1 | 298 | Phenylacetone monooxygenase {Thermobifida fusca [T | 99.32 | |
| d1gtea3 | 153 | Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su | 99.28 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 99.26 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 99.23 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 99.23 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 99.23 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 99.22 | |
| d1vdca2 | 130 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 99.21 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 99.2 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 99.18 | |
| d1trba2 | 126 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 99.18 | |
| d1fcda1 | 186 | Flavocytochrome c sulfide dehydrogenase, FCSD, fla | 99.18 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 99.15 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 99.13 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 99.12 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 99.11 | |
| d2gqfa1 | 253 | Hypothetical protein HI0933 {Haemophilus influenza | 99.11 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 99.1 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 99.1 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 99.09 | |
| d1aoga2 | 117 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 99.09 | |
| d2i0za1 | 251 | Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] | 99.08 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 99.08 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 99.08 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 99.07 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 99.06 | |
| d1feca2 | 117 | Trypanothione reductase {Crithidia fasciculata [Ta | 99.06 | |
| d1lvla1 | 220 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 99.06 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 99.05 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 99.04 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 99.04 | |
| d1dxla1 | 221 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 99.04 | |
| d1trba1 | 190 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 99.04 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 99.0 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 98.99 | |
| d1nhpa1 | 198 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 98.98 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 98.98 | |
| d1xhca1 | 167 | NADH oxidase /nitrite reductase {Pyrococcus furios | 98.97 | |
| d1mo9a1 | 261 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 98.97 | |
| d1feca2 | 117 | Trypanothione reductase {Crithidia fasciculata [Ta | 98.96 | |
| d1aoga2 | 117 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 98.96 | |
| d1djqa2 | 156 | Trimethylamine dehydrogenase, C-terminal domain {M | 98.94 | |
| d1m6ia2 | 137 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 98.91 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 98.91 | |
| d1m6ia1 | 213 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 98.91 | |
| d3grsa1 | 221 | Glutathione reductase {Human (Homo sapiens) [TaxId | 98.9 | |
| d1fl2a1 | 184 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 98.86 | |
| d1vdca1 | 192 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 98.86 | |
| d1xdia1 | 233 | Dihydrolipoamide dehydrogenase {Mycobacterium tube | 98.86 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 98.84 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 98.83 | |
| d2gf3a1 | 281 | Sarcosine oxidase {Bacillus sp., strain b0618 [Tax | 98.82 | |
| d1ryia1 | 276 | Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | 98.8 | |
| d2cula1 | 230 | GidA-related protein TTHA1897 {Thermus thermophilu | 98.77 | |
| d1m6ia2 | 137 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 98.76 | |
| d3lada1 | 229 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 98.71 | |
| d1y0pa2 | 308 | Flavocytochrome c3 (respiratory fumarate reductase | 98.7 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 98.7 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 98.7 | |
| d1h6va1 | 235 | Mammalian thioredoxin reductase {Rat (Rattus norve | 98.69 | |
| d1v59a1 | 233 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 98.69 | |
| d1ps9a2 | 162 | 2,4-dienoyl-CoA reductase, C-terminal domain {Esch | 98.66 | |
| d1d4ca2 | 322 | Flavocytochrome c3 (respiratory fumarate reductase | 98.64 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 98.63 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 98.63 | |
| d1ebda1 | 223 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 98.62 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 98.62 | |
| d1qo8a2 | 317 | Flavocytochrome c3 (respiratory fumarate reductase | 98.62 | |
| d2dw4a2 | 449 | Lysine-specific histone demethylase 1, LSD1 {Human | 98.59 | |
| d1c0pa1 | 268 | D-aminoacid oxidase, N-terminal domain {Rhodotorul | 98.57 | |
| d2ivda1 | 347 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 98.57 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 98.57 | |
| d1rp0a1 | 278 | Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara | 98.56 | |
| d1d7ya1 | 183 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 98.55 | |
| d1d5ta1 | 336 | Guanine nucleotide dissociation inhibitor, GDI {Co | 98.55 | |
| d2bcgg1 | 297 | Guanine nucleotide dissociation inhibitor, GDI {Ba | 98.54 | |
| d2bi7a1 | 314 | UDP-galactopyranose mutase, N-terminal domain {Kle | 98.46 | |
| d1i8ta1 | 298 | UDP-galactopyranose mutase, N-terminal domain {Esc | 98.42 | |
| d1kf6a2 | 311 | Fumarate reductase {Escherichia coli [TaxId: 562]} | 98.36 | |
| d2v5za1 | 383 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 98.31 | |
| d1ojta1 | 229 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 98.31 | |
| d1q1ra1 | 185 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 98.26 | |
| d1djqa2 | 156 | Trimethylamine dehydrogenase, C-terminal domain {M | 98.25 | |
| d1k0ia1 | 292 | p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a | 98.23 | |
| d2gjca1 | 311 | Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( | 98.19 | |
| d1neka2 | 330 | Succinate dehydogenase {Escherichia coli [TaxId: 5 | 98.07 | |
| d3c96a1 | 288 | Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: | 98.07 | |
| d1feca1 | 240 | Trypanothione reductase {Crithidia fasciculata [Ta | 98.02 | |
| d1ps9a2 | 162 | 2,4-dienoyl-CoA reductase, C-terminal domain {Esch | 97.99 | |
| d2gmha1 | 380 | Electron transfer flavoprotein-ubiquinone oxidored | 97.99 | |
| d2gv8a2 | 107 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 97.98 | |
| d1ps9a3 | 179 | 2,4-dienoyl-CoA reductase, middle domain {Escheric | 97.98 | |
| d2bs2a2 | 336 | Fumarate reductase {Wolinella succinogenes [TaxId: | 97.81 | |
| d1w4xa2 | 235 | Phenylacetone monooxygenase {Thermobifida fusca [T | 97.79 | |
| d1aoga1 | 238 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 97.79 | |
| d1pn0a1 | 360 | Phenol hydroxylase {Soil-living yeast (Trichosporo | 97.78 | |
| d1gtea4 | 196 | Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su | 97.77 | |
| d1gtea3 | 153 | Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su | 97.76 | |
| d1nhpa1 | 198 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 97.59 | |
| d1fcda1 | 186 | Flavocytochrome c sulfide dehydrogenase, FCSD, fla | 97.58 | |
| d1xhca1 | 167 | NADH oxidase /nitrite reductase {Pyrococcus furios | 97.55 | |
| d1chua2 | 305 | L-aspartate oxidase {Escherichia coli [TaxId: 562] | 97.53 | |
| d2i0za1 | 251 | Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] | 97.53 | |
| d1trba2 | 126 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 97.5 | |
| d1jnra2 | 356 | Adenylylsulfate reductase A subunit {Archaeon Arch | 97.5 | |
| d2f5va1 | 379 | Pyranose 2-oxidase {White-rot fungus (Peniophora s | 97.45 | |
| d1kifa1 | 246 | D-aminoacid oxidase, N-terminal domain {Pig (Sus s | 97.26 | |
| d2gqfa1 | 253 | Hypothetical protein HI0933 {Haemophilus influenza | 97.24 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 97.2 | |
| d1q1ra1 | 185 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 97.19 | |
| d1d7ya1 | 183 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 97.18 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 97.07 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 97.06 | |
| d1fl2a2 | 126 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 97.02 | |
| d1n4wa1 | 367 | Cholesterol oxidase of GMC family {Streptomyces sp | 97.0 | |
| d1trba1 | 190 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 96.93 | |
| d3coxa1 | 370 | Cholesterol oxidase of GMC family {Brevibacterium | 96.9 | |
| d1kdga1 | 360 | Flavoprotein domain of flavocytochrome cellobiose | 96.88 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 96.85 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 96.8 | |
| d1d4ca2 | 322 | Flavocytochrome c3 (respiratory fumarate reductase | 96.8 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 96.8 | |
| d1y0pa2 | 308 | Flavocytochrome c3 (respiratory fumarate reductase | 96.73 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 96.65 | |
| d1gpea1 | 391 | Glucose oxidase {Penicillium amagasakiense [TaxId: | 96.64 | |
| d1mv8a2 | 202 | GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos | 96.63 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 96.56 | |
| d2dw4a2 | 449 | Lysine-specific histone demethylase 1, LSD1 {Human | 96.53 | |
| d1m6ia1 | 213 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 96.53 | |
| d1ks9a2 | 167 | Ketopantoate reductase PanE {Escherichia coli [Tax | 96.52 | |
| d1cf3a1 | 385 | Glucose oxidase {Aspergillus niger [TaxId: 5061]} | 96.52 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 96.47 | |
| d2bi7a1 | 314 | UDP-galactopyranose mutase, N-terminal domain {Kle | 96.46 | |
| d1vdca2 | 130 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 96.43 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 96.42 | |
| d1c0pa1 | 268 | D-aminoacid oxidase, N-terminal domain {Rhodotorul | 96.32 | |
| d1l7da1 | 183 | Nicotinamide nucleotide transhydrogenase dI compon | 96.32 | |
| d1ju2a1 | 351 | Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI | 96.32 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 96.27 | |
| d1lqta2 | 239 | Ferredoxin:NADP reductase FprA {Mycobacterium tube | 96.26 | |
| d2ivda1 | 347 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 96.23 | |
| d2gv8a1 | 335 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 96.23 | |
| d1kyqa1 | 150 | Bifunctional dehydrogenase/ferrochelatase Met8p, N | 96.22 | |
| d1kyqa1 | 150 | Bifunctional dehydrogenase/ferrochelatase Met8p, N | 96.22 | |
| d1vdca1 | 192 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 96.15 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 96.15 | |
| d1hyea1 | 145 | MJ0490, lactate/malate dehydrogenase {Archaeon Met | 96.15 | |
| d1fl2a1 | 184 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 96.14 | |
| d2bcgg1 | 297 | Guanine nucleotide dissociation inhibitor, GDI {Ba | 95.99 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 95.92 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 95.83 | |
| d3c96a1 | 288 | Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: | 95.81 | |
| d1d5ta1 | 336 | Guanine nucleotide dissociation inhibitor, GDI {Co | 95.7 | |
| d1qo8a2 | 317 | Flavocytochrome c3 (respiratory fumarate reductase | 95.67 | |
| d2cula1 | 230 | GidA-related protein TTHA1897 {Thermus thermophilu | 95.65 | |
| d1id1a_ | 153 | Rck domain from putative potassium channel Kch {Es | 95.61 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 95.6 | |
| d1cjca2 | 230 | Adrenodoxin reductase of mitochondrial p450 system | 95.57 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 95.54 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 95.53 | |
| d1i8ta1 | 298 | UDP-galactopyranose mutase, N-terminal domain {Esc | 95.5 | |
| d1dxla1 | 221 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 95.36 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 95.34 | |
| d1pzga1 | 154 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 95.33 | |
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 95.27 | |
| d1txga2 | 180 | Glycerol-3- phosphate dehydrogenase {Archaeoglobus | 95.1 | |
| d2v5za1 | 383 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 95.08 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 95.06 | |
| d1guza1 | 142 | Malate dehydrogenase {Chlorobium vibrioforme [TaxI | 95.05 | |
| d1wdka3 | 186 | Fatty oxidation complex alpha subunit, middle doma | 95.0 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 95.0 | |
| d2ldxa1 | 159 | Lactate dehydrogenase {Mouse (Mus musculus) [TaxId | 94.93 | |
| d1gesa1 | 217 | Glutathione reductase {Escherichia coli [TaxId: 56 | 94.92 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 94.78 | |
| d1hyha1 | 146 | L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La | 94.71 | |
| d1n1ea2 | 189 | Glycerol-3- phosphate dehydrogenase {Trypanosome ( | 94.68 | |
| d1ryia1 | 276 | Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | 94.65 | |
| d1v59a1 | 233 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 94.61 | |
| d1ebda1 | 223 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 94.6 | |
| d1lvla1 | 220 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 94.55 | |
| d1rp0a1 | 278 | Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara | 94.55 | |
| d1ojta1 | 229 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 94.54 | |
| d1k0ia1 | 292 | p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a | 94.49 | |
| d1a9xa3 | 127 | Carbamoyl phosphate synthetase (CPS), large subuni | 94.47 | |
| d1kjqa2 | 111 | Glycinamide ribonucleotide transformylase PurT, N- | 94.41 | |
| d1y6ja1 | 142 | Lactate dehydrogenase {Clostridium thermocellum [T | 94.4 | |
| d1llda1 | 143 | Lactate dehydrogenase {Bifidobacterium longum, str | 94.34 | |
| d1jaya_ | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae | 94.34 | |
| d1i0za1 | 160 | Lactate dehydrogenase {Human (Homo sapiens), heart | 94.31 | |
| d1ojua1 | 142 | Malate dehydrogenase {Archaeon Archaeoglobus fulgi | 94.29 | |
| d1dlja2 | 196 | UDP-glucose dehydrogenase (UDPGDH) {Streptococcus | 94.28 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 94.26 | |
| d1a5za1 | 140 | Lactate dehydrogenase {Thermotoga maritima [TaxId: | 94.25 | |
| d1uxja1 | 142 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 94.22 | |
| d2gv8a2 | 107 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 94.21 | |
| d2gf3a1 | 281 | Sarcosine oxidase {Bacillus sp., strain b0618 [Tax | 94.1 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 94.09 | |
| d1pn0a1 | 360 | Phenol hydroxylase {Soil-living yeast (Trichosporo | 94.08 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 93.92 | |
| d1a9xa4 | 121 | Carbamoyl phosphate synthetase (CPS), large subuni | 93.78 | |
| d1nyta1 | 170 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 93.76 | |
| d3grsa1 | 221 | Glutathione reductase {Human (Homo sapiens) [TaxId | 93.73 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 93.53 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 93.47 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 93.42 | |
| d1h6va1 | 235 | Mammalian thioredoxin reductase {Rat (Rattus norve | 93.39 | |
| d1mo9a1 | 261 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 93.34 | |
| d1llua2 | 166 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 93.34 | |
| d1w4xa1 | 298 | Phenylacetone monooxygenase {Thermobifida fusca [T | 93.33 | |
| d3lada1 | 229 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 93.1 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 92.96 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 92.9 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 92.86 | |
| d1t2da1 | 150 | Lactate dehydrogenase {Malaria parasite (Plasmodiu | 92.85 | |
| d3etja2 | 78 | N5-carboxyaminoimidazole ribonucleotide synthetase | 92.73 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 92.52 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 92.34 | |
| d1i36a2 | 152 | Conserved hypothetical protein MTH1747 {Archaeon M | 92.34 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 92.24 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 92.16 | |
| d7mdha1 | 175 | Malate dehydrogenase {Sorghum (Sorghum vulgare), c | 92.08 | |
| d2cmda1 | 145 | Malate dehydrogenase {Escherichia coli [TaxId: 562 | 91.93 | |
| d2gjca1 | 311 | Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( | 91.92 | |
| d1vi2a1 | 182 | Putative shikimate dehydrogenase YdiB {Escherichia | 91.89 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 91.84 | |
| d1ks9a2 | 167 | Ketopantoate reductase PanE {Escherichia coli [Tax | 91.73 | |
| d1mlda1 | 144 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 91.66 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 91.66 | |
| d2bs2a2 | 336 | Fumarate reductase {Wolinella succinogenes [TaxId: | 91.57 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 91.45 | |
| d1pgja2 | 178 | 6-phosphogluconate dehydrogenase {Trypanosoma bruc | 91.28 | |
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 91.24 | |
| d1vi2a1 | 182 | Putative shikimate dehydrogenase YdiB {Escherichia | 91.23 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 91.21 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 91.17 | |
| d1n4wa1 | 367 | Cholesterol oxidase of GMC family {Streptomyces sp | 91.17 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 91.16 | |
| d1rjwa2 | 168 | Alcohol dehydrogenase {Bacillus stearothermophilus | 91.13 | |
| d1kola2 | 195 | Formaldehyde dehydrogenase {Pseudomonas putida [Ta | 91.11 | |
| d1d1ta2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 91.07 | |
| d1xdia1 | 233 | Dihydrolipoamide dehydrogenase {Mycobacterium tube | 91.03 | |
| d1onfa1 | 259 | Glutathione reductase {Plasmodium falciparum [TaxI | 90.96 | |
| d1yqga2 | 152 | Pyrroline-5-carboxylate reductase ProC {Neisseria | 90.94 | |
| d1p77a1 | 171 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 90.84 | |
| d1aoga1 | 238 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 90.74 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 90.69 | |
| d3coxa1 | 370 | Cholesterol oxidase of GMC family {Brevibacterium | 90.64 | |
| d1jw9b_ | 247 | Molybdenum cofactor biosynthesis protein MoeB {Esc | 90.55 | |
| d1nyta1 | 170 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 90.53 | |
| d1kola2 | 195 | Formaldehyde dehydrogenase {Pseudomonas putida [Ta | 90.5 | |
| d1cdoa2 | 175 | Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI | 90.49 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 90.47 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 90.42 | |
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 90.41 | |
| d2gmha1 | 380 | Electron transfer flavoprotein-ubiquinone oxidored | 90.41 | |
| d1qyca_ | 307 | Phenylcoumaran benzylic ether reductase {Loblolly | 90.23 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 90.21 | |
| d1wdka3 | 186 | Fatty oxidation complex alpha subunit, middle doma | 90.15 | |
| d1pzga1 | 154 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 90.1 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 90.03 | |
| d2fr1a1 | 259 | Erythromycin synthase, eryAI, 1st ketoreductase mo | 90.02 | |
| d1p0fa2 | 174 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 89.97 | |
| d2ahra2 | 152 | Pyrroline-5-carboxylate reductase ProC {Streptococ | 89.97 | |
| d2dt5a2 | 126 | Transcriptional repressor Rex, C-terminal domain { | 89.94 | |
| d2f5va1 | 379 | Pyranose 2-oxidase {White-rot fungus (Peniophora s | 89.78 | |
| d1feca1 | 240 | Trypanothione reductase {Crithidia fasciculata [Ta | 89.72 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 89.67 | |
| d1d1ta2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 89.66 | |
| d1kifa1 | 246 | D-aminoacid oxidase, N-terminal domain {Pig (Sus s | 89.65 | |
| d1o6za1 | 142 | Malate dehydrogenase {Archaeon Haloarcula marismor | 89.61 | |
| d1p0fa2 | 174 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 89.54 | |
| d1li4a1 | 163 | S-adenosylhomocystein hydrolase {Human (Homo sapie | 89.47 | |
| d1qyca_ | 307 | Phenylcoumaran benzylic ether reductase {Loblolly | 89.29 | |
| d1l7da1 | 183 | Nicotinamide nucleotide transhydrogenase dI compon | 89.11 | |
| d1llua2 | 166 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 88.91 | |
| d1w4xa2 | 235 | Phenylacetone monooxygenase {Thermobifida fusca [T | 88.74 | |
| d1vl0a_ | 281 | DTDP-4-dehydrorhamnose reductase RfbD {Clostridium | 88.55 | |
| d1h2ba2 | 172 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 88.37 | |
| d2jhfa2 | 176 | Alcohol dehydrogenase {Horse (Equus caballus) [Tax | 88.36 | |
| d1n1ea2 | 189 | Glycerol-3- phosphate dehydrogenase {Trypanosome ( | 88.34 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 88.34 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 88.33 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 88.28 | |
| d1p77a1 | 171 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 88.22 | |
| d1nvta1 | 177 | Shikimate 5-dehydrogenase AroE {Archaeon Methanoco | 88.21 | |
| d1hyha1 | 146 | L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La | 88.07 | |
| d1u8xx1 | 167 | Maltose-6'-phosphate glucosidase GlvA {Bacillus su | 87.97 | |
| d1cdoa2 | 175 | Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI | 87.9 | |
| d1yb5a2 | 174 | Quinone oxidoreductase {Human (Homo sapiens) [TaxI | 87.78 | |
| d2hjsa1 | 144 | Usg-1 protein homolog PA3116 {Pseudomonas aerugino | 87.68 | |
| d1obba1 | 171 | Alpha-glucosidase AglA {Thermotoga maritima [TaxId | 87.62 | |
| d1nvta1 | 177 | Shikimate 5-dehydrogenase AroE {Archaeon Methanoco | 87.51 | |
| d1uxja1 | 142 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 87.48 | |
| d1v8ba1 | 163 | S-adenosylhomocystein hydrolase {Plasmodium falcip | 87.45 | |
| d2fy8a1 | 129 | Potassium channel-related protein MthK {Archaeon M | 87.32 | |
| d1jw9b_ | 247 | Molybdenum cofactor biosynthesis protein MoeB {Esc | 87.1 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 86.86 | |
| d1qp8a1 | 181 | Putative formate dehydrogenase {Archaeon Pyrobacul | 86.85 | |
| d1jaya_ | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae | 86.79 | |
| d1neka2 | 330 | Succinate dehydogenase {Escherichia coli [TaxId: 5 | 86.75 | |
| d1yovb1 | 426 | UBA3 {Human (Homo sapiens) [TaxId: 9606]} | 86.7 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 86.63 | |
| d1p3da1 | 96 | UDP-N-acetylmuramate-alanine ligase MurC {Haemophi | 86.58 | |
| d1y6ja1 | 142 | Lactate dehydrogenase {Clostridium thermocellum [T | 86.39 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 86.38 | |
| d1vl6a1 | 222 | Malate oxidoreductase (malic enzyme) {Thermotoga m | 85.99 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 85.9 | |
| d1vg0a1 | 491 | Rab escort protein 1 {Rat (Rattus norvegicus) [Tax | 85.89 | |
| d1lqta1 | 216 | Ferredoxin:NADP reductase FprA {Mycobacterium tube | 85.84 | |
| d1qp8a1 | 181 | Putative formate dehydrogenase {Archaeon Pyrobacul | 85.65 | |
| d1xgka_ | 350 | Negative transcriptional regulator NmrA {Aspergill | 85.48 | |
| d1cjca1 | 225 | Adrenodoxin reductase of mitochondrial p450 system | 85.24 | |
| d5mdha1 | 154 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 85.19 | |
| d1t2da1 | 150 | Lactate dehydrogenase {Malaria parasite (Plasmodiu | 84.87 | |
| d1omoa_ | 320 | Archaeal alanine dehydrogenase {Archaeon Archaeogl | 84.82 | |
| d1jvba2 | 170 | Alcohol dehydrogenase {Archaeon Sulfolobus solfata | 84.76 | |
| d1llda1 | 143 | Lactate dehydrogenase {Bifidobacterium longum, str | 84.64 | |
| d1up7a1 | 162 | 6-phospho-beta-glucosidase {Thermotoga maritima [T | 84.47 | |
| d1gpea1 | 391 | Glucose oxidase {Penicillium amagasakiense [TaxId: | 84.44 | |
| d1rjwa2 | 168 | Alcohol dehydrogenase {Bacillus stearothermophilus | 84.42 | |
| d1xgka_ | 350 | Negative transcriptional regulator NmrA {Aspergill | 84.27 | |
| d1v3va2 | 182 | Leukotriene b4 12-hydroxydehydrogenase/prostagland | 84.2 | |
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 84.18 | |
| d1id1a_ | 153 | Rck domain from putative potassium channel Kch {Es | 84.14 | |
| d1j4aa1 | 197 | D-lactate dehydrogenase {Lactobacillus helveticus | 84.13 | |
| d2jhfa2 | 176 | Alcohol dehydrogenase {Horse (Equus caballus) [Tax | 84.11 | |
| d1c1da1 | 201 | Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ | 84.08 | |
| d1ygya1 | 184 | Phosphoglycerate dehydrogenase {Mycobacterium tube | 84.07 | |
| d1hwxa1 | 293 | Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: | 83.88 | |
| d1txga2 | 180 | Glycerol-3- phosphate dehydrogenase {Archaeoglobus | 83.81 | |
| d1kdga1 | 360 | Flavoprotein domain of flavocytochrome cellobiose | 83.46 | |
| d2c5aa1 | 363 | GDP-mannose-3', 5'-epimerase {Thale cress (Arabido | 83.43 | |
| d1i0za1 | 160 | Lactate dehydrogenase {Human (Homo sapiens), heart | 83.41 | |
| d1jnra2 | 356 | Adenylylsulfate reductase A subunit {Archaeon Arch | 83.3 | |
| d1c1da1 | 201 | Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ | 83.26 | |
| d1chua2 | 305 | L-aspartate oxidase {Escherichia coli [TaxId: 562] | 83.17 | |
| d1x7da_ | 340 | Ornithine cyclodeaminase {Pseudomonas putida [TaxI | 83.0 | |
| d1vjta1 | 193 | Putative alpha-glucosidase TM0752 {Thermotoga mari | 82.65 | |
| d1jvba2 | 170 | Alcohol dehydrogenase {Archaeon Sulfolobus solfata | 82.61 | |
| d1li4a1 | 163 | S-adenosylhomocystein hydrolase {Human (Homo sapie | 82.61 | |
| d1dxya1 | 199 | D-2-hydroxyisocaproate dehydrogenase {Lactobacillu | 82.49 | |
| d1guza1 | 142 | Malate dehydrogenase {Chlorobium vibrioforme [TaxI | 82.39 | |
| d2fzwa2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 82.28 | |
| d2a35a1 | 212 | Hypothetical protein PA4017 {Pseudomonas aeruginos | 82.16 | |
| d1sc6a1 | 188 | Phosphoglycerate dehydrogenase {Escherichia coli [ | 82.1 | |
| d1rkxa_ | 356 | CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc | 81.92 | |
| d1h2ba2 | 172 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 81.86 | |
| d1b74a1 | 105 | Glutamate racemase {Aquifex pyrophilus [TaxId: 271 | 81.85 | |
| d1cf3a1 | 385 | Glucose oxidase {Aspergillus niger [TaxId: 5061]} | 81.79 | |
| d2ldxa1 | 159 | Lactate dehydrogenase {Mouse (Mus musculus) [TaxId | 81.71 | |
| d1pqwa_ | 183 | Putative enoyl reductase domain of polyketide synt | 81.32 | |
| d1yb5a2 | 174 | Quinone oxidoreductase {Human (Homo sapiens) [TaxI | 81.19 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 80.96 | |
| d1yova1 | 529 | Amyloid beta precursor protein-binding protein 1, | 80.64 | |
| d1rkxa_ | 356 | CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc | 80.53 | |
| d2fzwa2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 80.49 | |
| d1ojua1 | 142 | Malate dehydrogenase {Archaeon Archaeoglobus fulgi | 80.15 | |
| d1edza1 | 171 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 80.06 |
| >d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: FAD/NAD(P)-binding domain superfamily: FAD/NAD(P)-binding domain family: C-terminal domain of adrenodoxin reductase-like domain: Ferredoxin:NADP reductase FprA species: Mycobacterium tuberculosis [TaxId: 1773]
Probab=99.95 E-value=2.6e-27 Score=204.92 Aligned_cols=205 Identities=40% Similarity=0.602 Sum_probs=176.1
Q ss_pred CCCCCCCccCCCccchhhHHHHhcCCCCCCCCCCCCCCCCeEEEEcCCHHHHHHHHHHccCCcccccccccHHHHHHHhc
Q 019876 121 RALGIPGEDLIGVHSAREFVWWYNGHPDGKNLSPDLKSTDTAVILGQGNVALDVARILLRPTEELATTDIASYAWTALEG 200 (334)
Q Consensus 121 ~~~~ipG~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~k~vvVIG~G~~g~e~A~~L~~~~~~~~~~~~~~~~~~~~~~ 200 (334)
+.++|||.+++||+.+.+|+.||+.++++.....++ .+++|+|||+|++|+|+|+.|++...++..||++.++++.+.+
T Consensus 2 R~L~IPGedl~gV~~A~dfl~~~N~~p~~~~~~~~~-~gk~VvVIGgGNvAlD~AR~ll~~~~~l~~tdi~~~~l~~l~r 80 (216)
T d1lqta1 2 RMLNIPGEDLPGSIAAVDFVGWYNAHPHFEQVSPDL-SGARAVVIGNGNVALDVARILLTDPDVLARTDIADHALESLRP 80 (216)
T ss_dssp CCCCCTTTTSTTEEEHHHHHHHHTTCGGGTTCCCCC-CSSEEEEECCSHHHHHHHHHHHSCHHHHTTSCCCHHHHHHHTT
T ss_pred CCCCCCCCCCCCcEeHHHHHHHHhCCccccccCccc-cCceEEEECCCchhHhhhhhhccCHhhhccCCCcHHHHHHHhh
Confidence 578999999999999999999999888776655544 6899999999999999999999999999999999999999999
Q ss_pred CCcceEEEEeecCccccCCCHHHHHHHHcCCceEEEEccCccCCCCCchhhhhccHHHHHHHHHHHHHHhccCCCCCCCc
Q 019876 201 SSIRKVYLVGRRGPVQAACTAKELREILGIKNLYVHIREDDLIKSPTDEEEMKNSRIQRRVYELLSKAAASASSQPMLGQ 280 (334)
Q Consensus 201 ~~~~~Vtiv~r~~~~~~~~~~~~~~~~l~~~gv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 280 (334)
.++++|++++||++..++|+.+|++++++.+++.+.+++..++..... ......+..++..+++.+... .......
T Consensus 81 ~~~~~V~iv~RRg~~~~~ft~~Elre~~~l~~~~~~~~~~~~~~~~~e-~~~~~~~~~~~~~~~~~~~~~---~~~~~~~ 156 (216)
T d1lqta1 81 RGIQEVVIVGRRGPLQAAFTTLELRELADLDGVDVVIDPAELDGITDE-DAAAVGKVCKQNIKVLRGYAD---REPRPGH 156 (216)
T ss_dssp CCCCEEEEECSSCGGGCCCCHHHHHHGGGCTTEEEECCGGGGTTCCHH-HHHHHCHHHHHHHHHHHHHHT---CC-CTTS
T ss_pred cCCceEEEEEECChHhCCCChhhhhhhcccCCCCccCCHHHccchhhh-hhhhhccchhHHHHHHHHhhh---hccccCc
Confidence 999999999999999999999999999999999999998887644432 222345666666666665543 3445667
Q ss_pred eEEEEEeccccceeeccccCCCCeeEEEEEEeeeecCCCCcceeecCCceEeCC
Q 019876 281 RELHFVFFRKPDSFLESNERSGHVSGVHFEKTALKGGGPGKQYAVGTGEFEDLD 334 (334)
Q Consensus 281 ~gv~~~~~~~~~~i~~~~~~~~~v~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~ 334 (334)
+.+.|++...+.++. + +++++++++..+++..+++|+.+++++|++++|+
T Consensus 157 ~~~~~~~~~~~~~~~--~--~~~v~~l~~~~~~~~~d~~g~~~~~~~g~~~~i~ 206 (216)
T d1lqta1 157 RRMVFRFLTSPIEIK--G--KRKVERIVLGRNELVSDGSGRVAAKDTGEREELP 206 (216)
T ss_dssp EEEEEECSEEEEEEE--C--SSSCCEEEEEEEEEEECSSSSEEEEEEEEEEEEE
T ss_pred ceeeeeecccccccc--c--cCceeEEEEEEEEEeeCCCCCeeeecCCcEEEEE
Confidence 889999999999997 6 7899999999999988889999999999988763
|
| >d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} | Back information, alignment and structure |
|---|
| >d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} | Back information, alignment and structure |
|---|
| >d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} | Back information, alignment and structure |
|---|
| >d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} | Back information, alignment and structure |
|---|
| >d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} | Back information, alignment and structure |
|---|
| >d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} | Back information, alignment and structure |
|---|
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} | Back information, alignment and structure |
|---|
| >d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} | Back information, alignment and structure |
|---|
| >d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} | Back information, alignment and structure |
|---|
| >d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
| >d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} | Back information, alignment and structure |
|---|
| >d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} | Back information, alignment and structure |
|---|
| >d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} | Back information, alignment and structure |
|---|
| >d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} | Back information, alignment and structure |
|---|
| >d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} | Back information, alignment and structure |
|---|
| >d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} | Back information, alignment and structure |
|---|
| >d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
| >d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} | Back information, alignment and structure |
|---|
| >d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} | Back information, alignment and structure |
|---|
| >d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} | Back information, alignment and structure |
|---|
| >d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} | Back information, alignment and structure |
|---|
| >d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1b74a1 c.78.2.1 (A:1-105) Glutamate racemase {Aquifex pyrophilus [TaxId: 2714]} | Back information, alignment and structure |
|---|
| >d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} | Back information, alignment and structure |
|---|
| >d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|