Citrus Sinensis ID: 019882
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 334 | 2.2.26 [Sep-21-2011] | |||||||
| Q94BN2 | 359 | Spermine synthase OS=Arab | yes | no | 0.958 | 0.891 | 0.714 | 1e-145 | |
| O82147 | 316 | Spermidine synthase OS=Co | N/A | no | 0.766 | 0.810 | 0.603 | 1e-106 | |
| O48659 | 308 | Spermidine synthase 2 OS= | N/A | no | 0.766 | 0.831 | 0.573 | 1e-102 | |
| Q9ZTR1 | 334 | Spermidine synthase 1 OS= | N/A | no | 0.766 | 0.766 | 0.571 | 1e-102 | |
| Q96556 | 308 | Spermidine synthase 1 OS= | N/A | no | 0.778 | 0.844 | 0.559 | 1e-102 | |
| Q9ZUB3 | 334 | Spermidine synthase 1 OS= | no | no | 0.838 | 0.838 | 0.532 | 1e-101 | |
| Q96557 | 317 | Spermidine synthase 2 OS= | N/A | no | 0.790 | 0.832 | 0.570 | 1e-101 | |
| Q9ZTR0 | 342 | Spermidine synthase 2 OS= | N/A | no | 0.763 | 0.745 | 0.580 | 1e-101 | |
| Q9ZS45 | 342 | Spermidine synthase OS=So | N/A | no | 0.775 | 0.757 | 0.579 | 1e-101 | |
| Q9SMB1 | 323 | Spermidine synthase 1 OS= | no | no | 0.766 | 0.792 | 0.580 | 1e-101 |
| >sp|Q94BN2|SPSY_ARATH Spermine synthase OS=Arabidopsis thaliana GN=SPMS PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 514 bits (1323), Expect = e-145, Method: Compositional matrix adjust.
Identities = 255/357 (71%), Positives = 281/357 (78%), Gaps = 37/357 (10%)
Query: 1 MEGGEGKGLGCQKTMDGKESNKNGSAGAIPSCCLKARASAPELDAKCHSTVVSGWFSESQ 60
MEG G GL CQ TMDGK SN NG +PSCCLKA A PE DAKCHSTVVSGWFSE
Sbjct: 1 MEGDVGIGLVCQNTMDGKASNGNGLEKTVPSCCLKAMACVPEDDAKCHSTVVSGWFSEPH 60
Query: 61 STSDKTG-KTMYFNNPMWPGEAHSLKVKEILFKGKSEYQEVLVFESLAYGKVLVLDGIVQ 119
S K G K +YFNNPMWPGEAHSLKV+++LFK KS++QEVLVFES YGKVLVLDGIVQ
Sbjct: 61 PRSGKKGGKAVYFNNPMWPGEAHSLKVEKVLFKDKSDFQEVLVFESATYGKVLVLDGIVQ 120
Query: 120 LTEKDECAYQEMIAHLPLCSIPSPKT---------------------------------- 145
LTEKDECAYQEMIAHLPLCSI SPK
Sbjct: 121 LTEKDECAYQEMIAHLPLCSISSPKNVLVVGGGDGGVLREISRHSSVEVIDICEIDKMVI 180
Query: 146 -VSKKYFPELAVGFEDPRVRLHIGDAVEFLRQVPRGKYDAIIVDSSDPVGPAQELVEKPF 204
VSKK+FPELAVGF+DPRV+LHIGDA EFLR+ P GKYDAIIVDSSDPVGPA LVEKPF
Sbjct: 181 DVSKKFFPELAVGFDDPRVQLHIGDAAEFLRKSPEGKYDAIIVDSSDPVGPALALVEKPF 240
Query: 205 FDTIAKALRPGGVLCNMAESMWLHTHLIEDMISICRETFKGSVHYAWASVPTYPSGIIGF 264
F+T+A+AL+PGGVLCNMAESMWLHTHLIEDMISICR+TFK SVHYAW+SVPTYPSG+IGF
Sbjct: 241 FETLARALKPGGVLCNMAESMWLHTHLIEDMISICRQTFK-SVHYAWSSVPTYPSGVIGF 299
Query: 265 LICSTEGPHVDFVNPINPIEKLEGADKHKRELRFYNSEIHSAAFALPAFLKREVSVL 321
++CSTEGP VDF NPINPIEKL+GA HKREL+FYNS++H AAFALP FL+REV+ L
Sbjct: 300 VLCSTEGPAVDFKNPINPIEKLDGAMTHKRELKFYNSDMHRAAFALPTFLRREVASL 356
|
Arabidopsis thaliana (taxid: 3702) EC: 2EC: .EC: 5EC: .EC: 1EC: .EC: 2EC: 2 |
| >sp|O82147|SPDE_COFAR Spermidine synthase OS=Coffea arabica PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O48659|SPD2_HYONI Spermidine synthase 2 OS=Hyoscyamus niger PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9ZTR1|SPD1_PEA Spermidine synthase 1 OS=Pisum sativum GN=SPDSYN1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q96556|SPD1_DATST Spermidine synthase 1 OS=Datura stramonium PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9ZUB3|SPD1_ARATH Spermidine synthase 1 OS=Arabidopsis thaliana GN=SPDSYN1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q96557|SPD2_DATST Spermidine synthase 2 OS=Datura stramonium PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9ZTR0|SPD2_PEA Spermidine synthase 2 OS=Pisum sativum GN=SPDSYN2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9ZS45|SPDE_SOLLC Spermidine synthase OS=Solanum lycopersicum GN=SPDSYN PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9SMB1|SPD1_ORYSJ Spermidine synthase 1 OS=Oryza sativa subsp. japonica GN=SPDSYN1 PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 334 | ||||||
| 225462753 | 369 | PREDICTED: spermine synthase [Vitis vini | 1.0 | 0.905 | 0.750 | 1e-159 | |
| 255545020 | 368 | spermidine synthase 1, putative [Ricinus | 0.997 | 0.904 | 0.766 | 1e-159 | |
| 147767804 | 369 | hypothetical protein VITISV_020278 [Viti | 1.0 | 0.905 | 0.750 | 1e-159 | |
| 449456381 | 365 | PREDICTED: spermine synthase-like [Cucum | 0.988 | 0.904 | 0.731 | 1e-155 | |
| 126153733 | 361 | spermine synthase [Lotus japonicus] | 0.967 | 0.894 | 0.754 | 1e-155 | |
| 224120662 | 347 | predicted protein [Populus trichocarpa] | 0.925 | 0.890 | 0.773 | 1e-154 | |
| 357463867 | 358 | Spermidine synthase [Medicago truncatula | 0.943 | 0.879 | 0.748 | 1e-153 | |
| 302143671 | 355 | unnamed protein product [Vitis vinifera] | 0.958 | 0.901 | 0.752 | 1e-153 | |
| 73486701 | 369 | spermine synthase [Malus sylvestris] | 0.991 | 0.897 | 0.724 | 1e-153 | |
| 363808324 | 362 | uncharacterized protein LOC100816988 [Gl | 0.967 | 0.892 | 0.751 | 1e-153 |
| >gi|225462753|ref|XP_002270790.1| PREDICTED: spermine synthase [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 567 bits (1461), Expect = e-159, Method: Compositional matrix adjust.
Identities = 277/369 (75%), Positives = 303/369 (82%), Gaps = 35/369 (9%)
Query: 1 MEGGEGKGLGCQKTMDGKESNKNGSAGAIPSCCLKARASAPELDAKCHSTVVSGWFSESQ 60
MEGG GKGL C K MDGK SN G AIPSCCLKA+ASAPE DAKCHSTVVSGWFSE Q
Sbjct: 1 MEGGAGKGLECPKIMDGKASNGKGLKKAIPSCCLKAKASAPENDAKCHSTVVSGWFSEPQ 60
Query: 61 STSDKTGKTMYFNNPMWPGEAHSLKVKEILFKGKSEYQEVLVFESLAYGKVLVLDGIVQL 120
S SDK G MYFNNPMWPGEAHSLKV+ ILF+GKSE+QE+LVFES AYGKVLVLDGIVQL
Sbjct: 61 SCSDKAGNLMYFNNPMWPGEAHSLKVENILFQGKSEFQEILVFESSAYGKVLVLDGIVQL 120
Query: 121 TEKDECAYQEMIAHLPLCSIPSPKT----------------------------------- 145
+EKDECAYQEMIAHLPLCSI SPK
Sbjct: 121 SEKDECAYQEMIAHLPLCSIESPKRVLVVGGGDGGVLREISRHSSVELIDICEIDKMVID 180
Query: 146 VSKKYFPELAVGFEDPRVRLHIGDAVEFLRQVPRGKYDAIIVDSSDPVGPAQELVEKPFF 205
V KK+FP+L VGFEDPRV+LH+GDAVEFLR VP GKYDAIIVDSSDPVGPAQELVE+PFF
Sbjct: 181 VCKKFFPQLYVGFEDPRVQLHVGDAVEFLRHVPEGKYDAIIVDSSDPVGPAQELVERPFF 240
Query: 206 DTIAKALRPGGVLCNMAESMWLHTHLIEDMISICRETFKGSVHYAWASVPTYPSGIIGFL 265
+T A+ALRPGGVLCNMAESMWLHTHLI+DM+SICRETFKGSVHYAWASVPTYPSG+IGFL
Sbjct: 241 ETTARALRPGGVLCNMAESMWLHTHLIQDMLSICRETFKGSVHYAWASVPTYPSGVIGFL 300
Query: 266 ICSTEGPHVDFVNPINPIEKLEGADKHKRELRFYNSEIHSAAFALPAFLKREVSVLGDSP 325
+CSTEGP VDF++P+NPIEKLEG K RELRFYNSEIHSAAFALP+F++REVS+L +SP
Sbjct: 301 LCSTEGPPVDFLHPVNPIEKLEGNLKCGRELRFYNSEIHSAAFALPSFVRREVSILHNSP 360
Query: 326 TPSQRICVS 334
TP+QRICVS
Sbjct: 361 TPAQRICVS 369
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255545020|ref|XP_002513571.1| spermidine synthase 1, putative [Ricinus communis] gi|223547479|gb|EEF48974.1| spermidine synthase 1, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|147767804|emb|CAN73402.1| hypothetical protein VITISV_020278 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449456381|ref|XP_004145928.1| PREDICTED: spermine synthase-like [Cucumis sativus] gi|449497322|ref|XP_004160371.1| PREDICTED: spermine synthase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|126153733|emb|CAM35498.1| spermine synthase [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|224120662|ref|XP_002318386.1| predicted protein [Populus trichocarpa] gi|222859059|gb|EEE96606.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357463867|ref|XP_003602215.1| Spermidine synthase [Medicago truncatula] gi|355491263|gb|AES72466.1| Spermidine synthase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|302143671|emb|CBI22532.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|73486701|dbj|BAE19758.1| spermine synthase [Malus sylvestris] | Back alignment and taxonomy information |
|---|
| >gi|363808324|ref|NP_001242248.1| uncharacterized protein LOC100816988 [Glycine max] gi|255635898|gb|ACU18296.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 334 | ||||||
| TAIR|locus:2016129 | 340 | SPDS2 "spermidine synthase 2" | 0.694 | 0.682 | 0.504 | 3.9e-60 | |
| UNIPROTKB|E1BM12 | 302 | SRM "Uncharacterized protein" | 0.526 | 0.582 | 0.398 | 2.6e-59 | |
| UNIPROTKB|P19623 | 302 | SRM "Spermidine synthase" [Hom | 0.502 | 0.556 | 0.408 | 4.2e-59 | |
| MGI|MGI:102690 | 302 | Srm "spermidine synthase" [Mus | 0.502 | 0.556 | 0.419 | 4.2e-59 | |
| RGD|620796 | 302 | Srm "spermidine synthase" [Rat | 0.502 | 0.556 | 0.408 | 1.8e-58 | |
| UNIPROTKB|I3LPB8 | 302 | SRM "Uncharacterized protein" | 0.502 | 0.556 | 0.408 | 2.9e-58 | |
| CGD|CAL0006284 | 297 | SPE3 [Candida albicans (taxid: | 0.544 | 0.612 | 0.408 | 6.1e-58 | |
| FB|FBgn0037723 | 299 | SpdS "Spermidine Synthase" [Dr | 0.488 | 0.545 | 0.385 | 2.6e-51 | |
| UNIPROTKB|J9P2P6 | 247 | SRM "Uncharacterized protein" | 0.502 | 0.680 | 0.413 | 4.7e-50 | |
| WB|WBGene00012909 | 366 | spds-1 [Caenorhabditis elegans | 0.431 | 0.393 | 0.360 | 1.6e-22 |
| TAIR|locus:2016129 SPDS2 "spermidine synthase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 616 (221.9 bits), Expect = 3.9e-60, P = 3.9e-60
Identities = 120/238 (50%), Positives = 164/238 (68%)
Query: 86 VKEILFKGKSEYQEVLVFESLAY----GKVLVLDGIVQLTEKDECAYQEMIAHLPLCSIP 141
V ++ + + YQE++ L KVLV+ G + E A + + +C I
Sbjct: 99 VIQLTERDECAYQEMITHLPLCSISNPKKVLVIGGGDGGVLR-EVARHSSVEQIDICEID 157
Query: 142 SPKT-VSKKYFPELAVGFEDPRVRLHIGDAVEFLRQVPRGKYDAIIVDSSDPVGPAQELV 200
V+K+YFP +AVG+EDPRV L IGD V FL+ G YDA+IVDSSDP+GPA+EL
Sbjct: 158 KMVVDVAKQYFPNVAVGYEDPRVNLIIGDGVAFLKNAAEGTYDAVIVDSSDPIGPAKELF 217
Query: 201 EKPFFDTIAKALRPGGVLCNMAESMWLHTHLIEDMISICRETFKGSVHYAWASVPTYPSG 260
EKPFF+++ +ALRPGGV+C AES+WLH +IED++S CR+ FKGSV+YAW SVPTYPSG
Sbjct: 218 EKPFFESVNRALRPGGVVCTQAESLWLHMDIIEDIVSNCRDIFKGSVNYAWTSVPTYPSG 277
Query: 261 IIGFLICSTEGPHVDFVNPINPIEKLEGADKHKRELRFYNSEIHSAAFALPAFLKREV 318
+IGF++CS+EGP VDF P++ I+ E + K L++YN+EIHSAAF LP+F K+ +
Sbjct: 278 VIGFMLCSSEGPQVDFKKPVSLIDTDESSIKSHCPLKYYNAEIHSAAFCLPSFAKKVI 335
|
|
| UNIPROTKB|E1BM12 SRM "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P19623 SRM "Spermidine synthase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:102690 Srm "spermidine synthase" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|620796 Srm "spermidine synthase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LPB8 SRM "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0006284 SPE3 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0037723 SpdS "Spermidine Synthase" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P2P6 SRM "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00012909 spds-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q94BN2 | SPSY_ARATH | 2, ., 5, ., 1, ., 2, 2 | 0.7142 | 0.9580 | 0.8913 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 4th Layer | 2.5.1.16 | 0.946 |
| 3rd Layer | 2.5.1 | 0.976 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 334 | |||
| PLN02366 | 308 | PLN02366, PLN02366, spermidine synthase | 0.0 | |
| PRK00811 | 283 | PRK00811, PRK00811, spermidine synthase; Provision | 2e-81 | |
| pfam01564 | 240 | pfam01564, Spermine_synth, Spermine/spermidine syn | 5e-80 | |
| TIGR00417 | 271 | TIGR00417, speE, spermidine synthase | 2e-74 | |
| COG0421 | 282 | COG0421, SpeE, Spermidine synthase [Amino acid tra | 2e-73 | |
| PLN02823 | 336 | PLN02823, PLN02823, spermine synthase | 6e-33 | |
| PRK03612 | 521 | PRK03612, PRK03612, spermidine synthase; Provision | 9e-12 | |
| COG4262 | 508 | COG4262, COG4262, Predicted spermidine synthase wi | 2e-11 | |
| PRK00536 | 262 | PRK00536, speE, spermidine synthase; Provisional | 1e-08 | |
| PRK01581 | 374 | PRK01581, speE, spermidine synthase; Validated | 1e-07 | |
| cd02440 | 107 | cd02440, AdoMet_MTases, S-adenosylmethionine-depen | 4e-06 | |
| pfam13578 | 105 | pfam13578, Methyltransf_24, Methyltransferase doma | 1e-05 | |
| PRK04457 | 262 | PRK04457, PRK04457, spermidine synthase; Provision | 1e-05 | |
| pfam13659 | 117 | pfam13659, Methyltransf_26, Methyltransferase doma | 7e-05 | |
| pfam05430 | 124 | pfam05430, Methyltransf_30, S-adenosyl-L-methionin | 2e-04 | |
| COG2521 | 287 | COG2521, COG2521, Predicted archaeal methyltransfe | 5e-04 | |
| COG4122 | 219 | COG4122, COG4122, Predicted O-methyltransferase [G | 7e-04 | |
| pfam12847 | 104 | pfam12847, Methyltransf_18, Methyltransferase doma | 0.001 | |
| pfam11899 | 376 | pfam11899, DUF3419, Protein of unknown function (D | 0.001 |
| >gnl|CDD|215208 PLN02366, PLN02366, spermidine synthase | Back alignment and domain information |
|---|
Score = 507 bits (1308), Expect = 0.0
Identities = 202/319 (63%), Positives = 240/319 (75%), Gaps = 49/319 (15%)
Query: 38 ASAPELDAKCHSTVVSGWFSESQSTSDKTGKTMYFNNPMWPGEAHSLKVKEILFKGKSEY 97
A+APE +AKCHSTV+ GWFSE +PMWPGEAHSLKV+++LF+GKS++
Sbjct: 1 AAAPESEAKCHSTVIPGWFSEI--------------SPMWPGEAHSLKVEKVLFQGKSDF 46
Query: 98 QEVLVFESLAYGKVLVLDGIVQLTEKDECAYQEMIAHLPLCSIPSPKTV----------- 146
Q+VLVFES YGKVLVLDG++QLTE+DECAYQEMI HLPLCSIP+PK V
Sbjct: 47 QDVLVFESATYGKVLVLDGVIQLTERDECAYQEMITHLPLCSIPNPKKVLVVGGGDGGVL 106
Query: 147 ------------------------SKKYFPELAVGFEDPRVRLHIGDAVEFLRQVPRGKY 182
SKK+FP+LAVGF+DPRV LHIGD VEFL+ P G Y
Sbjct: 107 REIARHSSVEQIDICEIDKMVIDVSKKFFPDLAVGFDDPRVNLHIGDGVEFLKNAPEGTY 166
Query: 183 DAIIVDSSDPVGPAQELVEKPFFDTIAKALRPGGVLCNMAESMWLHTHLIEDMISICRET 242
DAIIVDSSDPVGPAQEL EKPFF+++A+ALRPGGV+C AESMWLH LIED+I+ICRET
Sbjct: 167 DAIIVDSSDPVGPAQELFEKPFFESVARALRPGGVVCTQAESMWLHMDLIEDLIAICRET 226
Query: 243 FKGSVHYAWASVPTYPSGIIGFLICSTEGPHVDFVNPINPIEKLEGADKHKRELRFYNSE 302
FKGSV+YAW +VPTYPSG+IGF++CS EGP VDF +P+NPI+KLEGA K KR L+FYNSE
Sbjct: 227 FKGSVNYAWTTVPTYPSGVIGFVLCSKEGPAVDFKHPVNPIDKLEGAGKAKRPLKFYNSE 286
Query: 303 IHSAAFALPAFLKREVSVL 321
+H AAF LP+F KRE+ L
Sbjct: 287 VHRAAFCLPSFAKRELESL 305
|
Length = 308 |
| >gnl|CDD|234843 PRK00811, PRK00811, spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216573 pfam01564, Spermine_synth, Spermine/spermidine synthase | Back alignment and domain information |
|---|
| >gnl|CDD|188048 TIGR00417, speE, spermidine synthase | Back alignment and domain information |
|---|
| >gnl|CDD|223498 COG0421, SpeE, Spermidine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|178418 PLN02823, PLN02823, spermine synthase | Back alignment and domain information |
|---|
| >gnl|CDD|235139 PRK03612, PRK03612, spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226713 COG4262, COG4262, Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|134311 PRK00536, speE, spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234961 PRK01581, speE, spermidine synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) | Back alignment and domain information |
|---|
| >gnl|CDD|222236 pfam13578, Methyltransf_24, Methyltransferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|179854 PRK04457, PRK04457, spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222295 pfam13659, Methyltransf_26, Methyltransferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|203249 pfam05430, Methyltransf_30, S-adenosyl-L-methionine-dependent methyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|225319 COG2521, COG2521, Predicted archaeal methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|226607 COG4122, COG4122, Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|221804 pfam12847, Methyltransf_18, Methyltransferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|221301 pfam11899, DUF3419, Protein of unknown function (DUF3419) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 334 | |||
| PLN02366 | 308 | spermidine synthase | 100.0 | |
| KOG1562 | 337 | consensus Spermidine synthase [Amino acid transpor | 100.0 | |
| PRK00536 | 262 | speE spermidine synthase; Provisional | 100.0 | |
| PRK00811 | 283 | spermidine synthase; Provisional | 100.0 | |
| COG0421 | 282 | SpeE Spermidine synthase [Amino acid transport and | 100.0 | |
| PLN02823 | 336 | spermine synthase | 100.0 | |
| TIGR00417 | 270 | speE spermidine synthase. the SpeE subunit of sper | 100.0 | |
| PF01564 | 246 | Spermine_synth: Spermine/spermidine synthase; Inte | 100.0 | |
| PRK03612 | 521 | spermidine synthase; Provisional | 100.0 | |
| PRK01581 | 374 | speE spermidine synthase; Validated | 100.0 | |
| COG4262 | 508 | Predicted spermidine synthase with an N-terminal m | 100.0 | |
| PRK04457 | 262 | spermidine synthase; Provisional | 99.75 | |
| COG2521 | 287 | Predicted archaeal methyltransferase [General func | 99.14 | |
| PF05430 | 124 | Methyltransf_30: S-adenosyl-L-methionine-dependent | 98.3 | |
| PLN02476 | 278 | O-methyltransferase | 98.2 | |
| COG4122 | 219 | Predicted O-methyltransferase [General function pr | 98.13 | |
| PF01596 | 205 | Methyltransf_3: O-methyltransferase; InterPro: IPR | 98.13 | |
| PLN02589 | 247 | caffeoyl-CoA O-methyltransferase | 97.96 | |
| PLN02781 | 234 | Probable caffeoyl-CoA O-methyltransferase | 97.9 | |
| KOG2352 | 482 | consensus Predicted spermine/spermidine synthase [ | 97.49 | |
| PF13659 | 117 | Methyltransf_26: Methyltransferase domain; PDB: 3G | 97.39 | |
| COG1092 | 393 | Predicted SAM-dependent methyltransferases [Genera | 97.36 | |
| COG2519 | 256 | GCD14 tRNA(1-methyladenosine) methyltransferase an | 97.05 | |
| TIGR00091 | 194 | tRNA (guanine-N(7)-)-methyltransferase. In E. coli | 96.97 | |
| PF10672 | 286 | Methyltrans_SAM: S-adenosylmethionine-dependent me | 96.87 | |
| PRK15128 | 396 | 23S rRNA m(5)C1962 methyltransferase; Provisional | 96.8 | |
| PRK01747 | 662 | mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans | 96.58 | |
| KOG1663 | 237 | consensus O-methyltransferase [Secondary metabolit | 96.5 | |
| PF12847 | 112 | Methyltransf_18: Methyltransferase domain; PDB: 3G | 96.45 | |
| PRK00121 | 202 | trmB tRNA (guanine-N(7)-)-methyltransferase; Revie | 96.36 | |
| PRK14121 | 390 | tRNA (guanine-N(7)-)-methyltransferase; Provisiona | 96.35 | |
| PF08704 | 247 | GCD14: tRNA methyltransferase complex GCD14 subuni | 96.3 | |
| PF02390 | 195 | Methyltransf_4: Putative methyltransferase ; Inter | 96.2 | |
| PRK11524 | 284 | putative methyltransferase; Provisional | 96.17 | |
| COG0220 | 227 | Predicted S-adenosylmethionine-dependent methyltra | 95.83 | |
| COG4121 | 252 | Uncharacterized conserved protein [Function unknow | 95.64 | |
| COG2518 | 209 | Pcm Protein-L-isoaspartate carboxylmethyltransfera | 95.58 | |
| PRK13699 | 227 | putative methylase; Provisional | 95.39 | |
| PRK11188 | 209 | rrmJ 23S rRNA methyltransferase J; Provisional | 95.3 | |
| PRK11783 | 702 | rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi | 95.16 | |
| PLN03075 | 296 | nicotianamine synthase; Provisional | 95.1 | |
| TIGR00438 | 188 | rrmJ cell division protein FtsJ. | 94.89 | |
| TIGR02469 | 124 | CbiT precorrin-6Y C5,15-methyltransferase (decarbo | 94.84 | |
| TIGR02752 | 231 | MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me | 94.8 | |
| PF13578 | 106 | Methyltransf_24: Methyltransferase domain; PDB: 3S | 94.66 | |
| TIGR03533 | 284 | L3_gln_methyl protein-(glutamine-N5) methyltransfe | 94.56 | |
| PF05175 | 170 | MTS: Methyltransferase small domain; InterPro: IPR | 94.49 | |
| TIGR00080 | 215 | pimt protein-L-isoaspartate(D-aspartate) O-methylt | 94.48 | |
| TIGR00138 | 181 | gidB 16S rRNA methyltransferase GidB. GidB (glucos | 94.23 | |
| PRK00377 | 198 | cbiT cobalt-precorrin-6Y C(15)-methyltransferase; | 94.01 | |
| PRK04266 | 226 | fibrillarin; Provisional | 93.91 | |
| PRK01544 | 506 | bifunctional N5-glutamine S-adenosyl-L-methionine- | 93.72 | |
| PF03602 | 183 | Cons_hypoth95: Conserved hypothetical protein 95; | 93.62 | |
| PRK14904 | 445 | 16S rRNA methyltransferase B; Provisional | 93.6 | |
| TIGR00446 | 264 | nop2p NOL1/NOP2/sun family putative RNA methylase. | 93.51 | |
| PRK11805 | 307 | N5-glutamine S-adenosyl-L-methionine-dependent met | 93.45 | |
| PF01135 | 209 | PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl | 93.36 | |
| cd02440 | 107 | AdoMet_MTases S-adenosylmethionine-dependent methy | 93.08 | |
| PRK13942 | 212 | protein-L-isoaspartate O-methyltransferase; Provis | 92.96 | |
| PLN02232 | 160 | ubiquinone biosynthesis methyltransferase | 92.93 | |
| PRK08287 | 187 | cobalt-precorrin-6Y C(15)-methyltransferase; Valid | 92.89 | |
| TIGR00308 | 374 | TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi | 92.8 | |
| PRK00107 | 187 | gidB 16S rRNA methyltransferase GidB; Reviewed | 92.71 | |
| PRK14903 | 431 | 16S rRNA methyltransferase B; Provisional | 92.69 | |
| PTZ00146 | 293 | fibrillarin; Provisional | 92.48 | |
| PF02353 | 273 | CMAS: Mycolic acid cyclopropane synthetase; InterP | 92.42 | |
| COG0742 | 187 | N6-adenine-specific methylase [DNA replication, re | 92.35 | |
| COG2242 | 187 | CobL Precorrin-6B methylase 2 [Coenzyme metabolism | 92.08 | |
| PRK14901 | 434 | 16S rRNA methyltransferase B; Provisional | 92.07 | |
| PF08241 | 95 | Methyltransf_11: Methyltransferase domain; InterPr | 91.97 | |
| PRK13944 | 205 | protein-L-isoaspartate O-methyltransferase; Provis | 91.9 | |
| PRK14902 | 444 | 16S rRNA methyltransferase B; Provisional | 91.86 | |
| TIGR03534 | 251 | RF_mod_PrmC protein-(glutamine-N5) methyltransfera | 91.77 | |
| PRK11036 | 255 | putative S-adenosyl-L-methionine-dependent methylt | 91.74 | |
| PRK11933 | 470 | yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; | 91.61 | |
| PRK01683 | 258 | trans-aconitate 2-methyltransferase; Provisional | 91.47 | |
| PRK07402 | 196 | precorrin-6B methylase; Provisional | 91.46 | |
| PRK14967 | 223 | putative methyltransferase; Provisional | 91.02 | |
| PRK04338 | 382 | N(2),N(2)-dimethylguanosine tRNA methyltransferase | 90.65 | |
| PF05401 | 201 | NodS: Nodulation protein S (NodS); InterPro: IPR00 | 90.53 | |
| PRK10901 | 427 | 16S rRNA methyltransferase B; Provisional | 90.27 | |
| PF13847 | 152 | Methyltransf_31: Methyltransferase domain; PDB: 3T | 90.13 | |
| PRK10909 | 199 | rsmD 16S rRNA m(2)G966-methyltransferase; Provisio | 89.91 | |
| TIGR00563 | 426 | rsmB ribosomal RNA small subunit methyltransferase | 89.87 | |
| PRK15001 | 378 | SAM-dependent 23S ribosomal RNA mG1835 methyltrans | 89.87 | |
| COG4123 | 248 | Predicted O-methyltransferase [General function pr | 89.8 | |
| PRK14103 | 255 | trans-aconitate 2-methyltransferase; Provisional | 89.53 | |
| PF13649 | 101 | Methyltransf_25: Methyltransferase domain; PDB: 3B | 89.33 | |
| PRK09328 | 275 | N5-glutamine S-adenosyl-L-methionine-dependent met | 89.16 | |
| PLN02244 | 340 | tocopherol O-methyltransferase | 89.02 | |
| TIGR01177 | 329 | conserved hypothetical protein TIGR01177. This fam | 88.26 | |
| PTZ00098 | 263 | phosphoethanolamine N-methyltransferase; Provision | 88.14 | |
| PF02005 | 377 | TRM: N2,N2-dimethylguanosine tRNA methyltransferas | 87.99 | |
| PRK09489 | 342 | rsmC 16S ribosomal RNA m2G1207 methyltransferase; | 87.94 | |
| PLN02233 | 261 | ubiquinone biosynthesis methyltransferase | 87.6 | |
| PRK00312 | 212 | pcm protein-L-isoaspartate O-methyltransferase; Re | 87.41 | |
| TIGR00536 | 284 | hemK_fam HemK family putative methylases. The gene | 87.17 | |
| PRK11088 | 272 | rrmA 23S rRNA methyltransferase A; Provisional | 86.87 | |
| KOG1709 | 271 | consensus Guanidinoacetate methyltransferase and r | 86.45 | |
| COG0144 | 355 | Sun tRNA and rRNA cytosine-C5-methylases [Translat | 86.4 | |
| PHA03411 | 279 | putative methyltransferase; Provisional | 86.28 | |
| PF06460 | 299 | NSP13: Coronavirus NSP13; InterPro: IPR009461 This | 86.25 | |
| smart00828 | 224 | PKS_MT Methyltransferase in polyketide synthase (P | 86.16 | |
| KOG1661 | 237 | consensus Protein-L-isoaspartate(D-aspartate) O-me | 86.11 | |
| PRK11873 | 272 | arsM arsenite S-adenosylmethyltransferase; Reviewe | 86.11 | |
| TIGR02072 | 240 | BioC biotin biosynthesis protein BioC. This enzyme | 86.08 | |
| PLN02396 | 322 | hexaprenyldihydroxybenzoate methyltransferase | 85.66 | |
| PRK14968 | 188 | putative methyltransferase; Provisional | 85.5 | |
| TIGR03704 | 251 | PrmC_rel_meth putative protein-(glutamine-N5) meth | 85.47 | |
| TIGR01934 | 223 | MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis | 85.45 | |
| TIGR00537 | 179 | hemK_rel_arch HemK-related putative methylase. The | 85.2 | |
| COG2230 | 283 | Cfa Cyclopropane fatty acid synthase and related m | 84.96 | |
| PF02475 | 200 | Met_10: Met-10+ like-protein; InterPro: IPR003402 | 84.93 | |
| KOG1271 | 227 | consensus Methyltransferases [General function pre | 84.45 | |
| TIGR00095 | 189 | RNA methyltransferase, RsmD family. This model rep | 84.35 | |
| PF08242 | 99 | Methyltransf_12: Methyltransferase domain; InterPr | 82.79 | |
| PRK05134 | 233 | bifunctional 3-demethylubiquinone-9 3-methyltransf | 82.49 | |
| TIGR00406 | 288 | prmA ribosomal protein L11 methyltransferase. Ribo | 82.34 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 82.17 | |
| KOG1562 | 337 | consensus Spermidine synthase [Amino acid transpor | 81.86 | |
| KOG4300 | 252 | consensus Predicted methyltransferase [General fun | 81.78 | |
| KOG1253 | 525 | consensus tRNA methyltransferase [Translation, rib | 81.03 | |
| COG2520 | 341 | Predicted methyltransferase [General function pred | 80.66 | |
| PRK00216 | 239 | ubiE ubiquinone/menaquinone biosynthesis methyltra | 80.63 | |
| PRK15451 | 247 | tRNA cmo(5)U34 methyltransferase; Provisional | 80.52 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 80.31 |
| >PLN02366 spermidine synthase | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.6e-63 Score=474.11 Aligned_cols=271 Identities=75% Similarity=1.330 Sum_probs=240.0
Q ss_pred ccCCcccccccccccccceeecccCCCCcccccccCCCCCCCceEEEeeccEEEEeeCCCceEEEEEeCCceeEEEECCe
Q 019882 38 ASAPELDAKCHSTVVSGWFSESQSTSDKTGKTMYFNNPMWPGEAHSLKVKEILFKGKSEYQEVLVFESLAYGKVLVLDGI 117 (334)
Q Consensus 38 ~~~~~~~~~~~~~~~~~wf~e~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~vL~~~~S~yQ~I~V~et~~~G~~L~LDG~ 117 (334)
|++|+++.+||..++++||+|. .++|++.+++++|+++|++++|+||+|+|++++.+|++|+|||.
T Consensus 1 ~~~~~~~~~~~~~~~~~w~~e~--------------~~~~~~~~~~~~v~~~l~~~~s~yQ~i~v~~~~~~g~~L~lDg~ 66 (308)
T PLN02366 1 AAAPESEAKCHSTVIPGWFSEI--------------SPMWPGEAHSLKVEKVLFQGKSDFQDVLVFESATYGKVLVLDGV 66 (308)
T ss_pred CCCCCCCccccchhhhceEeec--------------ccCCCCceEEEEEeeEEEeccCCCeeEEEEEcCCCceEEEECCE
Confidence 5789999999999999999997 34679999999999999999999999999999999999999999
Q ss_pred EEeeccchhHHHHHhhhhccccCCChhh-----------------------------------hHHhhCcccccCCCCCC
Q 019882 118 VQLTEKDECAYQEMIAHLPLCSIPSPKT-----------------------------------VSKKYFPELAVGFEDPR 162 (334)
Q Consensus 118 iQ~te~DEf~YhEmlvh~pl~~hp~Pkr-----------------------------------vak~~fp~l~~~~~dpR 162 (334)
+|++++||+.|||||+|+||+.||+|++ +||+|||.++.+++|||
T Consensus 67 ~q~~~~de~~Y~e~l~h~~l~~~~~pkrVLiIGgG~G~~~rellk~~~v~~V~~VEiD~~Vi~~ar~~f~~~~~~~~dpR 146 (308)
T PLN02366 67 IQLTERDECAYQEMITHLPLCSIPNPKKVLVVGGGDGGVLREIARHSSVEQIDICEIDKMVIDVSKKFFPDLAVGFDDPR 146 (308)
T ss_pred eeecCccHHHHHHHHHHHHHhhCCCCCeEEEEcCCccHHHHHHHhCCCCCeEEEEECCHHHHHHHHHhhhhhccccCCCc
Confidence 9999999999999999999999999999 58899998876789999
Q ss_pred eEEEEchHHHHHhhCCCCceeEEEECCCCCCCCCcCCCCHHHHHHHHHhcCCCcEEEEeccchhhhhhHHHHHHHHHHHh
Q 019882 163 VRLHIGDAVEFLRQVPRGKYDAIIVDSSDPVGPAQELVEKPFFDTIAKALRPGGVLCNMAESMWLHTHLIEDMISICRET 242 (334)
Q Consensus 163 v~viv~Dg~~fL~~~~~~~yDvIIvD~~dp~gpa~~L~t~eFy~~v~~~L~~gGilv~q~~sp~~~~~~~~~i~~tl~~v 242 (334)
++++++||++||++.++++||+||+|+++|.+++.+||+++||+.++++|+|||++++|++|+|.+.+.++.++++++++
T Consensus 147 v~vi~~Da~~~l~~~~~~~yDvIi~D~~dp~~~~~~L~t~ef~~~~~~~L~pgGvlv~q~~s~~~~~~~~~~i~~tl~~~ 226 (308)
T PLN02366 147 VNLHIGDGVEFLKNAPEGTYDAIIVDSSDPVGPAQELFEKPFFESVARALRPGGVVCTQAESMWLHMDLIEDLIAICRET 226 (308)
T ss_pred eEEEEChHHHHHhhccCCCCCEEEEcCCCCCCchhhhhHHHHHHHHHHhcCCCcEEEECcCCcccchHHHHHHHHHHHHH
Confidence 99999999999987645689999999999999999999999999999999999999999999999999999999999999
Q ss_pred cCCceeEEEEEeeecCCCcEEEEEeecCCCCCCCCCCCCchhhccccccCCCCCceeCHHHHHHHhcCcHHHHHHhhcCC
Q 019882 243 FKGSVHYAWASVPTYPSGIIGFLICSTEGPHVDFVNPINPIEKLEGADKHKRELRFYNSEIHSAAFALPAFLKREVSVLG 322 (334)
Q Consensus 243 F~~~v~~~~~~vPsyp~g~w~f~laSk~~~~~~~~~p~~~~~~~~~~~~~~~~lryYn~~ih~aaF~LP~~~~~~l~~~~ 322 (334)
|+.+|.+|.+.||+||+|.|||++||++.+..++..|.+..+.++.......+|||||+++|+|+|+||+|++++|+...
T Consensus 227 F~~~v~~~~~~vPsy~~g~w~f~~as~~~~~~~~~~~~~~~~~~~~~~~~~~~l~yy~~~~h~~~f~lp~~~~~~l~~~~ 306 (308)
T PLN02366 227 FKGSVNYAWTTVPTYPSGVIGFVLCSKEGPAVDFKHPVNPIDKLEGAGKAKRPLKFYNSEVHRAAFCLPSFAKRELESLL 306 (308)
T ss_pred CCCceeEEEecCCCcCCCceEEEEEECCCccccccccccccchhhhhhcccCCCeEECHHHHHHHhcChHHHHHHHHhcc
Confidence 95488999999999999999999999974333444443332211100011246899999999999999999999998653
|
|
| >KOG1562 consensus Spermidine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00536 speE spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK00811 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02823 spermine synthase | Back alignment and domain information |
|---|
| >TIGR00417 speE spermidine synthase | Back alignment and domain information |
|---|
| >PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 | Back alignment and domain information |
|---|
| >PRK03612 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK01581 speE spermidine synthase; Validated | Back alignment and domain information |
|---|
| >COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04457 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >COG2521 Predicted archaeal methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF05430 Methyltransf_30: S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR008471 This entry contains several uncharacterised bacterial proteins with no known function | Back alignment and domain information |
|---|
| >PLN02476 O-methyltransferase | Back alignment and domain information |
|---|
| >COG4122 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases | Back alignment and domain information |
|---|
| >PLN02589 caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >PLN02781 Probable caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >KOG2352 consensus Predicted spermine/spermidine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A | Back alignment and domain information |
|---|
| >COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00091 tRNA (guanine-N(7)-)-methyltransferase | Back alignment and domain information |
|---|
| >PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species | Back alignment and domain information |
|---|
| >PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A | Back alignment and domain information |
|---|
| >PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] | Back alignment and domain information |
|---|
| >PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 | Back alignment and domain information |
|---|
| >PRK11524 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG4121 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13699 putative methylase; Provisional | Back alignment and domain information |
|---|
| >PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional | Back alignment and domain information |
|---|
| >PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN03075 nicotianamine synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR00438 rrmJ cell division protein FtsJ | Back alignment and domain information |
|---|
| >TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit | Back alignment and domain information |
|---|
| >TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase | Back alignment and domain information |
|---|
| >PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D | Back alignment and domain information |
|---|
| >TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific | Back alignment and domain information |
|---|
| >PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases | Back alignment and domain information |
|---|
| >TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase | Back alignment and domain information |
|---|
| >TIGR00138 gidB 16S rRNA methyltransferase GidB | Back alignment and domain information |
|---|
| >PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK04266 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH | Back alignment and domain information |
|---|
| >PRK14904 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase | Back alignment and domain information |
|---|
| >PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 | Back alignment and domain information |
|---|
| >cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) | Back alignment and domain information |
|---|
| >PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02232 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase | Back alignment and domain information |
|---|
| >PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed | Back alignment and domain information |
|---|
| >PRK14903 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PTZ00146 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) | Back alignment and domain information |
|---|
| >COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK14901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14902 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific | Back alignment and domain information |
|---|
| >PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed | Back alignment and domain information |
|---|
| >PRK01683 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07402 precorrin-6B methylase; Provisional | Back alignment and domain information |
|---|
| >PRK14967 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins | Back alignment and domain information |
|---|
| >PRK10901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A | Back alignment and domain information |
|---|
| >PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB | Back alignment and domain information |
|---|
| >PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG4123 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14103 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A | Back alignment and domain information |
|---|
| >PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02244 tocopherol O-methyltransferase | Back alignment and domain information |
|---|
| >TIGR01177 conserved hypothetical protein TIGR01177 | Back alignment and domain information |
|---|
| >PTZ00098 phosphoethanolamine N-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 | Back alignment and domain information |
|---|
| >PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02233 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00536 hemK_fam HemK family putative methylases | Back alignment and domain information |
|---|
| >PRK11088 rrmA 23S rRNA methyltransferase A; Provisional | Back alignment and domain information |
|---|
| >KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PHA03411 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF06460 NSP13: Coronavirus NSP13; InterPro: IPR009461 This domain covers the NSP13 region of the coronavirus polyprotein | Back alignment and domain information |
|---|
| >smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes | Back alignment and domain information |
|---|
| >KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02072 BioC biotin biosynthesis protein BioC | Back alignment and domain information |
|---|
| >PLN02396 hexaprenyldihydroxybenzoate methyltransferase | Back alignment and domain information |
|---|
| >PRK14968 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific | Back alignment and domain information |
|---|
| >TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases | Back alignment and domain information |
|---|
| >TIGR00537 hemK_rel_arch HemK-related putative methylase | Back alignment and domain information |
|---|
| >COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family | Back alignment and domain information |
|---|
| >KOG1271 consensus Methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00095 RNA methyltransferase, RsmD family | Back alignment and domain information |
|---|
| >PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional | Back alignment and domain information |
|---|
| >TIGR00406 prmA ribosomal protein L11 methyltransferase | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >KOG1562 consensus Spermidine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4300 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1253 consensus tRNA methyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG2520 Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 334 | ||||
| 1xj5_A | 334 | X-Ray Structure Of Spermidine Synthase From Arabido | 1e-100 | ||
| 2o05_A | 304 | Human Spermidine Synthase Length = 304 | 1e-60 | ||
| 3rw9_A | 304 | Crystal Structure Of Human Spermidine Synthase In C | 1e-60 | ||
| 2pss_A | 321 | The Structure Of Plasmodium Falciparum Spermidine S | 6e-59 | ||
| 2pwp_A | 282 | Crystal Structure Of Spermidine Synthase From Plasm | 7e-59 | ||
| 2hte_A | 283 | The Crystal Structure Of Spermidine Synthase From P | 7e-59 | ||
| 2b2c_A | 314 | Cloning, Expression, Characterisation And Three- Di | 5e-56 | ||
| 3bwb_A | 304 | Crystal Structure Of The Apo Form Of Spermidine Syn | 1e-51 | ||
| 1iy9_A | 275 | Crystal Structure Of Spermidine Synthase Length = 2 | 4e-32 | ||
| 3o4f_A | 294 | Crystal Structure Of Spermidine Synthase From E. Co | 5e-29 | ||
| 1jq3_A | 296 | Crystal Structure Of Spermidine Synthase In Complex | 9e-29 | ||
| 3anx_A | 314 | Crystal Structure Of TriamineAGMATINE AMINOPROPYLTR | 2e-21 | ||
| 1uir_A | 314 | Crystal Structure Of Polyamine Aminopropyltransfeas | 5e-21 | ||
| 1mjf_A | 281 | Putative Spermidine Synthetase From Pyrococcus Furi | 3e-18 | ||
| 2e5w_A | 280 | Crystal Structure Of Spermidine Synthase From Pyroc | 4e-18 |
| >pdb|1XJ5|A Chain A, X-Ray Structure Of Spermidine Synthase From Arabidopsis Thaliana Gene At1g23820 Length = 334 | Back alignment and structure |
|
| >pdb|2O05|A Chain A, Human Spermidine Synthase Length = 304 | Back alignment and structure |
| >pdb|3RW9|A Chain A, Crystal Structure Of Human Spermidine Synthase In Complex With Decarboxylated S-Adenosylhomocysteine Length = 304 | Back alignment and structure |
| >pdb|2PSS|A Chain A, The Structure Of Plasmodium Falciparum Spermidine Synthase In Its Apo- Form Length = 321 | Back alignment and structure |
| >pdb|2PWP|A Chain A, Crystal Structure Of Spermidine Synthase From Plasmodium Falciparum In Complex With Spermidine Length = 282 | Back alignment and structure |
| >pdb|2HTE|A Chain A, The Crystal Structure Of Spermidine Synthase From P. Falciparum In Complex With 5'-Methylthioadenosine Length = 283 | Back alignment and structure |
| >pdb|2B2C|A Chain A, Cloning, Expression, Characterisation And Three- Dimensional Structure Determination Of The Caenorhabditis Elegans Spermidine Synthase Length = 314 | Back alignment and structure |
| >pdb|3BWB|A Chain A, Crystal Structure Of The Apo Form Of Spermidine Synthase From Trypanosoma Cruzi At 2.5 A Resolution Length = 304 | Back alignment and structure |
| >pdb|1IY9|A Chain A, Crystal Structure Of Spermidine Synthase Length = 275 | Back alignment and structure |
| >pdb|3O4F|A Chain A, Crystal Structure Of Spermidine Synthase From E. Coli Length = 294 | Back alignment and structure |
| >pdb|1JQ3|A Chain A, Crystal Structure Of Spermidine Synthase In Complex With Transition State Analogue Adodato Length = 296 | Back alignment and structure |
| >pdb|3ANX|A Chain A, Crystal Structure Of TriamineAGMATINE AMINOPROPYLTRANSFERASE (SPEE) From Thermus Thermophilus, Complexed With Mta Length = 314 | Back alignment and structure |
| >pdb|1UIR|A Chain A, Crystal Structure Of Polyamine Aminopropyltransfease From Thermus Thermophilus Length = 314 | Back alignment and structure |
| >pdb|1MJF|A Chain A, Putative Spermidine Synthetase From Pyrococcus Furiosus Pfu- 132382 Length = 281 | Back alignment and structure |
| >pdb|2E5W|A Chain A, Crystal Structure Of Spermidine Synthase From Pyrococcus Horikoshii Ot3 Length = 280 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Length = 334 | Back alignment and structure |
|---|
Score = 382 bits (983), Expect = e-133
Identities = 176/342 (51%), Positives = 227/342 (66%), Gaps = 51/342 (14%)
Query: 12 QKTMDGKESNKNGSAGAIPSCCLKARASAPELDAKCHSTVVSGWFSESQSTSDKTGKTMY 71
++T + ++ + + C STV+ GWFSE
Sbjct: 4 KETSATDLKRPREEDDNGGAATMETENGDQKKEPACFSTVIPGWFSEMS----------- 52
Query: 72 FNNPMWPGEAHSLKVKEILFKGKSEYQEVLVFESLAYGKVLVLDGIVQLTEKDECAYQEM 131
PMWPGEAHSLKV+++LF+GKS+YQ+V+VF+S YGKVLVLDG++QLTE+DECAYQEM
Sbjct: 53 ---PMWPGEAHSLKVEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVIQLTERDECAYQEM 109
Query: 132 IAHLPLCSIPSPKTV-----------------------------------SKKYFPELAV 156
I HLPLCSIP+PK V SK++FP++A+
Sbjct: 110 ITHLPLCSIPNPKKVLVIGGGDGGVLREVARHASIEQIDMCEIDKMVVDVSKQFFPDVAI 169
Query: 157 GFEDPRVRLHIGDAVEFLRQVPRGKYDAIIVDSSDPVGPAQELVEKPFFDTIAKALRPGG 216
G+EDPRV L IGD V FL+ G YDA+IVDSSDP+GPA+EL EKPFF ++A+ALRPGG
Sbjct: 170 GYEDPRVNLVIGDGVAFLKNAAEGSYDAVIVDSSDPIGPAKELFEKPFFQSVARALRPGG 229
Query: 217 VLCNMAESMWLHTHLIEDMISICRETFKGSVHYAWASVPTYPSGIIGFLICSTEGPHVDF 276
V+C AES+WLH +IED++S CRE FKGSV+YAW SVPTYPSG+IGF++CSTEGP VDF
Sbjct: 230 VVCTQAESLWLHMDIIEDIVSNCREIFKGSVNYAWTSVPTYPSGVIGFMLCSTEGPDVDF 289
Query: 277 VNPINPIEKLEGADKHKRELRFYNSEIHSAAFALPAFLKREV 318
+P+NPI+ E + K L+FYN+EIHSAAF LP+F K+ +
Sbjct: 290 KHPLNPID--ESSSKSNGPLKFYNAEIHSAAFCLPSFAKKVI 329
|
| >2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Length = 321 | Back alignment and structure |
|---|
| >2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Length = 314 | Back alignment and structure |
|---|
| >2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Length = 304 | Back alignment and structure |
|---|
| >3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Length = 304 | Back alignment and structure |
|---|
| >2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Length = 283 | Back alignment and structure |
|---|
| >1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Length = 275 | Back alignment and structure |
|---|
| >1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Length = 296 | Back alignment and structure |
|---|
| >1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Length = 281 | Back alignment and structure |
|---|
| >1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Length = 314 | Back alignment and structure |
|---|
| >2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Length = 262 | Back alignment and structure |
|---|
| >3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Length = 317 | Back alignment and structure |
|---|
| >3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Length = 221 | Back alignment and structure |
|---|
| >3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Length = 232 | Back alignment and structure |
|---|
| >1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} SCOP: c.66.1.16 PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Length = 236 | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Length = 256 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 334 | |||
| 3o4f_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 100.0 | |
| 3adn_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 100.0 | |
| 2b2c_A | 314 | Spermidine synthase; beta-alpha, transferase; 2.50 | 100.0 | |
| 1iy9_A | 275 | Spermidine synthase; rossmann fold, structural gen | 100.0 | |
| 1xj5_A | 334 | Spermidine synthase 1; structural genomics, protei | 100.0 | |
| 2o07_A | 304 | Spermidine synthase; structural genomics, structur | 100.0 | |
| 2i7c_A | 283 | Spermidine synthase; transferase, structural genom | 100.0 | |
| 1inl_A | 296 | Spermidine synthase; beta-barrel, rossman fold, st | 100.0 | |
| 2pt6_A | 321 | Spermidine synthase; transferase, structural genom | 100.0 | |
| 1uir_A | 314 | Polyamine aminopropyltransferase; spermidien synth | 100.0 | |
| 3bwc_A | 304 | Spermidine synthase; SAM, SGPP, structura genomics | 100.0 | |
| 1mjf_A | 281 | Spermidine synthase; spermidine synthetase, struct | 100.0 | |
| 2cmg_A | 262 | Spermidine synthase; transferase, putrescine amino | 100.0 | |
| 3c6k_A | 381 | Spermine synthase; spermidine aminopropyltransfera | 100.0 | |
| 2qfm_A | 364 | Spermine synthase; spermidine aminopropyltransfera | 100.0 | |
| 3gjy_A | 317 | Spermidine synthase; APC62791, structural genomics | 99.95 | |
| 2qy6_A | 257 | UPF0209 protein YFCK; structural genomics, unknown | 98.08 | |
| 3c3y_A | 237 | Pfomt, O-methyltransferase; plant secondary metabo | 98.06 | |
| 3dr5_A | 221 | Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 | 97.96 | |
| 1sui_A | 247 | Caffeoyl-COA O-methyltransferase; rossmann fold, p | 97.94 | |
| 3vyw_A | 308 | MNMC2; tRNA wobble uridine, modification enzyme, g | 97.93 | |
| 3tfw_A | 248 | Putative O-methyltransferase; PSI-biology, nysgrc, | 97.8 | |
| 3duw_A | 223 | OMT, O-methyltransferase, putative; alternating of | 97.72 | |
| 3r3h_A | 242 | O-methyltransferase, SAM-dependent; structural gen | 97.54 | |
| 3c3p_A | 210 | Methyltransferase; NP_951602.1, structural genomic | 97.53 | |
| 3ntv_A | 232 | MW1564 protein; rossmann fold, putative methyltran | 97.51 | |
| 3cbg_A | 232 | O-methyltransferase; cyanobacterium; HET: SAH FER | 97.33 | |
| 2avd_A | 229 | Catechol-O-methyltransferase; structural genomics, | 97.28 | |
| 3dxy_A | 218 | TRNA (guanine-N(7)-)-methyltransferase; rossmann f | 97.15 | |
| 2hnk_A | 239 | SAM-dependent O-methyltransferase; modified rossma | 97.12 | |
| 3tr6_A | 225 | O-methyltransferase; cellular processes; HET: SAH; | 97.11 | |
| 3orh_A | 236 | Guanidinoacetate N-methyltransferase; structura ge | 97.11 | |
| 1yzh_A | 214 | TRNA (guanine-N(7)-)-methyltransferase; alpha-beta | 96.97 | |
| 2igt_A | 332 | SAM dependent methyltransferase; alpha-beta sandwi | 96.93 | |
| 2frn_A | 278 | Hypothetical protein PH0793; structural genomics, | 96.92 | |
| 3cvo_A | 202 | Methyltransferase-like protein of unknown functio; | 96.79 | |
| 2fca_A | 213 | TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac | 96.76 | |
| 1zx0_A | 236 | Guanidinoacetate N-methyltransferase; structural g | 96.7 | |
| 3p9n_A | 189 | Possible methyltransferase (methylase); RV2966C, a | 96.61 | |
| 2wk1_A | 282 | NOVP; transferase, O-methyltransferase, novobiocin | 96.6 | |
| 2b78_A | 385 | Hypothetical protein SMU.776; structure genomics, | 96.46 | |
| 3u81_A | 221 | Catechol O-methyltransferase; neurotransmitter deg | 96.44 | |
| 3ckk_A | 235 | TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- | 96.37 | |
| 2bm8_A | 236 | Cephalosporin hydroxylase CMCI; cephamycin biosynt | 96.28 | |
| 3pvc_A | 689 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 96.27 | |
| 3ps9_A | 676 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 96.26 | |
| 1xdz_A | 240 | Methyltransferase GIDB; MCSG, protein structure in | 96.24 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 96.12 | |
| 3lpm_A | 259 | Putative methyltransferase; structural genomics, p | 96.12 | |
| 3mb5_A | 255 | SAM-dependent methyltransferase; RNA methyltransfe | 96.05 | |
| 2b25_A | 336 | Hypothetical protein; structural genomics, methyl | 96.0 | |
| 2vdv_E | 246 | TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl | 95.97 | |
| 1boo_A | 323 | Protein (N-4 cytosine-specific methyltransferase P | 95.93 | |
| 3c0k_A | 396 | UPF0064 protein YCCW; PUA domain, adoMet dependent | 95.9 | |
| 4dmg_A | 393 | Putative uncharacterized protein TTHA1493; rRNA, m | 95.88 | |
| 2yvl_A | 248 | TRMI protein, hypothetical protein; tRNA, methyltr | 95.84 | |
| 4dzr_A | 215 | Protein-(glutamine-N5) methyltransferase, release | 95.82 | |
| 3e05_A | 204 | Precorrin-6Y C5,15-methyltransferase (decarboxyla; | 95.82 | |
| 1wxx_A | 382 | TT1595, hypothetical protein TTHA1280; thermus the | 95.75 | |
| 2pwy_A | 258 | TRNA (adenine-N(1)-)-methyltransferase; mtase, ado | 95.71 | |
| 2gpy_A | 233 | O-methyltransferase; structural genomics, PSI, pro | 95.68 | |
| 2ift_A | 201 | Putative methylase HI0767; NESG, Y767_haein, struc | 95.65 | |
| 1g8a_A | 227 | Fibrillarin-like PRE-rRNA processing protein; rRNA | 95.61 | |
| 1eg2_A | 319 | Modification methylase RSRI; rossmann fold, exocyc | 95.59 | |
| 1l3i_A | 192 | Precorrin-6Y methyltransferase/putative decarboxyl | 95.57 | |
| 3hm2_A | 178 | Precorrin-6Y C5,15-methyltransferase; alpha-beta-s | 95.56 | |
| 3a27_A | 272 | TYW2, uncharacterized protein MJ1557; wybutosine m | 95.54 | |
| 1g60_A | 260 | Adenine-specific methyltransferase MBOIIA; structu | 95.51 | |
| 2zig_A | 297 | TTHA0409, putative modification methylase; methylt | 95.48 | |
| 3njr_A | 204 | Precorrin-6Y methylase; methyltransferase, decarbo | 95.46 | |
| 2oo3_A | 283 | Protein involved in catabolism of external DNA; st | 95.45 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 95.45 | |
| 3eey_A | 197 | Putative rRNA methylase; rRNA methylation, S-adeno | 95.45 | |
| 2yx1_A | 336 | Hypothetical protein MJ0883; methyl transferase, t | 95.4 | |
| 3k6r_A | 278 | Putative transferase PH0793; structural genomics, | 95.37 | |
| 3dou_A | 191 | Ribosomal RNA large subunit methyltransferase J; c | 95.36 | |
| 1ej0_A | 180 | FTSJ; methyltransferase, adoMet, adenosyl methioni | 95.36 | |
| 3fpf_A | 298 | Mtnas, putative uncharacterized protein; thermonic | 95.28 | |
| 2fhp_A | 187 | Methylase, putative; alpha-beta-alpha sandwich, st | 95.25 | |
| 2as0_A | 396 | Hypothetical protein PH1915; RNA methyltransferase | 95.24 | |
| 2esr_A | 177 | Methyltransferase; structural genomics, hypothetic | 95.23 | |
| 3evz_A | 230 | Methyltransferase; NYSGXRC, NEW YORK SGX research | 95.22 | |
| 2ozv_A | 260 | Hypothetical protein ATU0636; structural genomics, | 95.21 | |
| 2fpo_A | 202 | Methylase YHHF; structural genomics, putative meth | 95.14 | |
| 4hg2_A | 257 | Methyltransferase type 11; structural genomics, PS | 95.13 | |
| 3axs_A | 392 | Probable N(2),N(2)-dimethylguanosine tRNA methylt | 95.07 | |
| 1o54_A | 277 | SAM-dependent O-methyltransferase; TM0748, structu | 95.02 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 94.94 | |
| 3g89_A | 249 | Ribosomal RNA small subunit methyltransferase G; 1 | 94.83 | |
| 2qm3_A | 373 | Predicted methyltransferase; putative methyltransf | 94.66 | |
| 1i9g_A | 280 | Hypothetical protein RV2118C; mtase, adoMet, cryst | 94.63 | |
| 3mti_A | 185 | RRNA methylase; SAM-dependent, PSI, MCSG, structur | 94.54 | |
| 1yb2_A | 275 | Hypothetical protein TA0852; structural genomics, | 94.5 | |
| 1ws6_A | 171 | Methyltransferase; structural genomics, riken stru | 94.49 | |
| 3tos_A | 257 | CALS11; methyltransferase, calicheamicin, structur | 94.4 | |
| 3ajd_A | 274 | Putative methyltransferase MJ0026; tRNA, M5C, ross | 94.34 | |
| 3hem_A | 302 | Cyclopropane-fatty-acyl-phospholipid synthase 2; p | 94.27 | |
| 2dul_A | 378 | N(2),N(2)-dimethylguanosine tRNA methyltransferas; | 94.22 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 94.16 | |
| 2p41_A | 305 | Type II methyltransferase; vizier, viral enzymes i | 94.11 | |
| 3jwg_A | 219 | HEN1, methyltransferase type 12; 1.90A {Clostridiu | 94.01 | |
| 1nt2_A | 210 | Fibrillarin-like PRE-rRNA processing protein; adeM | 93.94 | |
| 1jsx_A | 207 | Glucose-inhibited division protein B; methyltransf | 93.77 | |
| 2plw_A | 201 | Ribosomal RNA methyltransferase, putative; malaria | 93.76 | |
| 2ipx_A | 233 | RRNA 2'-O-methyltransferase fibrillarin; FBL, stru | 93.76 | |
| 3m4x_A | 456 | NOL1/NOP2/SUN family protein; mtase domain, PUA do | 93.64 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 93.61 | |
| 2nyu_A | 196 | Putative ribosomal RNA methyltransferase 2; SAM, s | 93.59 | |
| 1ixk_A | 315 | Methyltransferase; open beta sheet; 1.90A {Pyrococ | 93.56 | |
| 3e23_A | 211 | Uncharacterized protein RPA2492; alpha-beta protei | 93.46 | |
| 3jwh_A | 217 | HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena | 93.44 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 93.41 | |
| 4htf_A | 285 | S-adenosylmethionine-dependent methyltransferase; | 93.34 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 93.33 | |
| 3lbf_A | 210 | Protein-L-isoaspartate O-methyltransferase; modifi | 93.3 | |
| 3sso_A | 419 | Methyltransferase; macrolide, natural product, ros | 93.23 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 93.23 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 93.13 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 92.92 | |
| 3m6w_A | 464 | RRNA methylase; rRNA methyltransferase, 5-methylcy | 92.91 | |
| 4fzv_A | 359 | Putative methyltransferase NSUN4; mterf fold, meth | 92.9 | |
| 4dcm_A | 375 | Ribosomal RNA large subunit methyltransferase G; 2 | 92.84 | |
| 3dmg_A | 381 | Probable ribosomal RNA small subunit methyltransf; | 92.62 | |
| 3ocj_A | 305 | Putative exported protein; structural genomics, PS | 92.54 | |
| 2xyq_A | 290 | Putative 2'-O-methyl transferase; transferase-vira | 92.47 | |
| 2ld4_A | 176 | Anamorsin; methyltransferase-like fold, alpha/beta | 92.45 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 92.38 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 92.37 | |
| 1r18_A | 227 | Protein-L-isoaspartate(D-aspartate)-O-methyltrans; | 92.31 | |
| 2yxl_A | 450 | PH0851 protein, 450AA long hypothetical FMU protei | 92.24 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 92.11 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 91.89 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 91.87 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 91.79 | |
| 2ih2_A | 421 | Modification methylase TAQI; DNA, DNA methyltransf | 91.73 | |
| 2frx_A | 479 | Hypothetical protein YEBU; rossmann-type S-adenosy | 91.71 | |
| 1dl5_A | 317 | Protein-L-isoaspartate O-methyltransferase; isoasp | 91.69 | |
| 2pbf_A | 227 | Protein-L-isoaspartate O-methyltransferase beta-A | 91.66 | |
| 1fbn_A | 230 | MJ fibrillarin homologue; MJ proteins, ribosomal R | 91.64 | |
| 2oxt_A | 265 | Nucleoside-2'-O-methyltransferase; flavivirus, vir | 91.45 | |
| 1sqg_A | 429 | SUN protein, FMU protein; rossmann-fold, mixed bet | 91.41 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 91.26 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 91.24 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 91.19 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 91.08 | |
| 3id6_C | 232 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 90.9 | |
| 3q7e_A | 349 | Protein arginine N-methyltransferase 1; HET: SAH; | 90.73 | |
| 2f8l_A | 344 | Hypothetical protein LMO1582; structural genomics, | 90.47 | |
| 4fsd_A | 383 | Arsenic methyltransferase; rossmann fold; 1.75A {C | 90.46 | |
| 2fyt_A | 340 | Protein arginine N-methyltransferase 3; structural | 90.46 | |
| 2wa2_A | 276 | Non-structural protein 5; transferase, S-adenosyl- | 90.41 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 90.38 | |
| 3tma_A | 354 | Methyltransferase; thump domain; 2.05A {Thermus th | 90.29 | |
| 2b3t_A | 276 | Protein methyltransferase HEMK; translation termin | 90.23 | |
| 1nkv_A | 256 | Hypothetical protein YJHP; structural genomics, PS | 90.22 | |
| 3mgg_A | 276 | Methyltransferase; NYSGXRC, PSI-II, protein struct | 90.2 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 90.19 | |
| 2zfu_A | 215 | Nucleomethylin, cerebral protein 1; nucleolar prot | 90.12 | |
| 2nxc_A | 254 | L11 mtase, ribosomal protein L11 methyltransferase | 90.1 | |
| 3g2m_A | 299 | PCZA361.24; SAM-dependent methyltransferase, glyco | 90.07 | |
| 1o9g_A | 250 | RRNA methyltransferase; antibiotic resistance, Se- | 90.03 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 90.02 | |
| 3m33_A | 226 | Uncharacterized protein; structural genomics, PSI- | 90.01 | |
| 2gb4_A | 252 | Thiopurine S-methyltransferase; 18204406, thiopuri | 89.99 | |
| 3r0q_C | 376 | Probable protein arginine N-methyltransferase 4.2; | 89.92 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 89.85 | |
| 2yxe_A | 215 | Protein-L-isoaspartate O-methyltransferase; rossma | 89.83 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 89.82 | |
| 2gs9_A | 211 | Hypothetical protein TT1324; methyl transferase, s | 89.72 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 89.71 | |
| 1kpg_A | 287 | CFA synthase;, cyclopropane-fatty-acyl-phospholipi | 89.7 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 89.6 | |
| 1i1n_A | 226 | Protein-L-isoaspartate O-methyltransferase; S-aden | 89.57 | |
| 2o57_A | 297 | Putative sarcosine dimethylglycine methyltransfera | 89.48 | |
| 1vl5_A | 260 | Unknown conserved protein BH2331; putative methylt | 89.34 | |
| 2pjd_A | 343 | Ribosomal RNA small subunit methyltransferase C; g | 89.3 | |
| 2p35_A | 259 | Trans-aconitate 2-methyltransferase; SAM dependent | 89.27 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 89.2 | |
| 4gek_A | 261 | TRNA (CMO5U34)-methyltransferase; structural genom | 88.83 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 88.73 | |
| 2fk8_A | 318 | Methoxy mycolic acid synthase 4; S-adenosylmethion | 88.48 | |
| 3vc1_A | 312 | Geranyl diphosphate 2-C-methyltransferase; rossman | 88.46 | |
| 2kw5_A | 202 | SLR1183 protein; structural genomics, northeast st | 88.46 | |
| 3gu3_A | 284 | Methyltransferase; alpha-beta protein, structural | 88.41 | |
| 3lcc_A | 235 | Putative methyl chloride transferase; halide methy | 88.38 | |
| 1ri5_A | 298 | MRNA capping enzyme; methyltransferase, M7G, messe | 88.15 | |
| 3d2l_A | 243 | SAM-dependent methyltransferase; ZP_00538691.1, st | 88.11 | |
| 3gdh_A | 241 | Trimethylguanosine synthase homolog; M7G, CAP, dim | 88.08 | |
| 3ccf_A | 279 | Cyclopropane-fatty-acyl-phospholipid synthase; YP_ | 88.07 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 87.92 | |
| 1g6q_1 | 328 | HnRNP arginine N-methyltransferase; SAM-binding do | 87.85 | |
| 4df3_A | 233 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 87.79 | |
| 1vbf_A | 231 | 231AA long hypothetical protein-L-isoaspartate O- | 87.71 | |
| 3m70_A | 286 | Tellurite resistance protein TEHB homolog; structu | 87.7 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 87.68 | |
| 2y1w_A | 348 | Histone-arginine methyltransferase CARM1; histone | 87.56 | |
| 3g07_A | 292 | 7SK snRNA methylphosphate capping enzyme; structur | 87.54 | |
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 87.35 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 87.18 | |
| 3bt7_A | 369 | TRNA (uracil-5-)-methyltransferase; methyluridine, | 86.79 | |
| 1jg1_A | 235 | PIMT;, protein-L-isoaspartate O-methyltransferase; | 86.53 | |
| 3cc8_A | 230 | Putative methyltransferase; structural genomics, j | 86.43 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 86.13 | |
| 3q87_B | 170 | N6 adenine specific DNA methylase; SAM-methyltrans | 85.75 | |
| 1wy7_A | 207 | Hypothetical protein PH1948; seven-stranded beta s | 85.41 | |
| 1nv8_A | 284 | HEMK protein; class I adoMet-dependent methyltrans | 85.37 | |
| 2p8j_A | 209 | S-adenosylmethionine-dependent methyltransferase; | 85.36 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 85.31 | |
| 1y8c_A | 246 | S-adenosylmethionine-dependent methyltransferase; | 84.66 | |
| 3ggd_A | 245 | SAM-dependent methyltransferase; YP_325210.1, stru | 84.61 | |
| 2vdw_A | 302 | Vaccinia virus capping enzyme D1 subunit; nucleoti | 84.34 | |
| 2aot_A | 292 | HMT, histamine N-methyltransferase; classic methyl | 84.04 | |
| 3bgv_A | 313 | MRNA CAP guanine-N7 methyltransferase; alternative | 83.62 | |
| 1p91_A | 269 | Ribosomal RNA large subunit methyltransferase A; R | 83.55 | |
| 1vlm_A | 219 | SAM-dependent methyltransferase; possible histamin | 83.31 | |
| 3lst_A | 348 | CALO1 methyltransferase; calicheamicin, enediyne, | 81.75 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 81.74 | |
| 3evf_A | 277 | RNA-directed RNA polymerase NS5; NS5 methyltransfe | 81.65 | |
| 3i53_A | 332 | O-methyltransferase; CO-complex, rossmann-like fol | 81.48 | |
| 4hc4_A | 376 | Protein arginine N-methyltransferase 6; HRMT1L6, S | 81.04 | |
| 2ip2_A | 334 | Probable phenazine-specific methyltransferase; pyo | 80.89 | |
| 1pjz_A | 203 | Thiopurine S-methyltransferase; polymorphism, S-ad | 80.8 |
| >3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.1e-65 Score=489.09 Aligned_cols=251 Identities=30% Similarity=0.576 Sum_probs=219.0
Q ss_pred cccccccceeecccCCCCcccccccCCCCCCCceEEEeeccEEEEeeCCCceEEEEEeCCceeEEEECCeEEeeccchhH
Q 019882 48 HSTVVSGWFSESQSTSDKTGKTMYFNNPMWPGEAHSLKVKEILFKGKSEYQEVLVFESLAYGKVLVLDGIVQLTEKDECA 127 (334)
Q Consensus 48 ~~~~~~~wf~e~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~vL~~~~S~yQ~I~V~et~~~G~~L~LDG~iQ~te~DEf~ 127 (334)
|-+.++.||+|. .++.+++++|+++|++++|+||+|+|++++.||++|+|||.+|+|++|||+
T Consensus 6 ~m~~~~~w~e~~-----------------~~~~~~~~~v~~vl~~~~S~yQ~i~v~~s~~~G~~L~LDg~~q~te~De~~ 68 (294)
T 3o4f_A 6 HMAEKKQWHETL-----------------HDQFGQYFAVDNVLYHEKTDHQDLIIFENAAFGRVMALDGVVQTTERDEFI 68 (294)
T ss_dssp ----CEEEECCS-----------------SSSEEEEEEESEEEEEEC---CCEEEEEETTTEEEEEETTEEEEETTTHHH
T ss_pred ccccccceeeec-----------------cCCcceEEEEeeEEEeccCCCceEEEEEcCCcceEEEECCchhhccccHHH
Confidence 445566798775 256799999999999999999999999999999999999999999999999
Q ss_pred HHHHhhhhccccCCChhh-----------------------------------hHHhhCccccc-CCCCCCeEEEEchHH
Q 019882 128 YQEMIAHLPLCSIPSPKT-----------------------------------VSKKYFPELAV-GFEDPRVRLHIGDAV 171 (334)
Q Consensus 128 YhEmlvh~pl~~hp~Pkr-----------------------------------vak~~fp~l~~-~~~dpRv~viv~Dg~ 171 (334)
|||||+|+||++||+|++ +||+|||.++. +++|||++|+++||+
T Consensus 69 YhE~l~h~~l~~~p~pk~VLIiGgGdG~~~revlk~~~v~~v~~VEID~~Vv~~a~~~lp~~~~~~~~dpRv~v~~~Dg~ 148 (294)
T 3o4f_A 69 YHEMMTHVPLLAHGHAKHVLIIGGGDGAMLREVTRHKNVESITMVEIDAGVVSFCRQYLPNHNAGSYDDPRFKLVIDDGV 148 (294)
T ss_dssp HHHHHHHHHHHHSSCCCEEEEESCTTSHHHHHHHTCTTCCEEEEEESCHHHHHHHHHHCHHHHTTGGGCTTEEEEESCTT
T ss_pred HHHHHHHHHHhhCCCCCeEEEECCCchHHHHHHHHcCCcceEEEEcCCHHHHHHHHhcCccccccccCCCcEEEEechHH
Confidence 999999999999999999 68999999875 489999999999999
Q ss_pred HHHhhCCCCceeEEEECCCCCCCCCcCCCCHHHHHHHHHhcCCCcEEEEeccchhhhhhHHHHHHHHHHHhcCCceeEEE
Q 019882 172 EFLRQVPRGKYDAIIVDSSDPVGPAQELVEKPFFDTIAKALRPGGVLCNMAESMWLHTHLIEDMISICRETFKGSVHYAW 251 (334)
Q Consensus 172 ~fL~~~~~~~yDvIIvD~~dp~gpa~~L~t~eFy~~v~~~L~~gGilv~q~~sp~~~~~~~~~i~~tl~~vF~~~v~~~~ 251 (334)
+||++. .++|||||+|++||.+++..|||+|||+.|+++|+|||++|+|++||+.+.+.++.++++++++|+ .|.+|.
T Consensus 149 ~~l~~~-~~~yDvIi~D~~dp~~~~~~L~t~eFy~~~~~~L~p~Gv~v~q~~sp~~~~~~~~~~~~~l~~~F~-~v~~~~ 226 (294)
T 3o4f_A 149 NFVNQT-SQTFDVIISDCTDPIGPGESLFTSAFYEGCKRCLNPGGIFVAQNGVCFLQQEEAIDSHRKLSHYFS-DVGFYQ 226 (294)
T ss_dssp TTTSCS-SCCEEEEEESCCCCCCTTCCSSCCHHHHHHHHTEEEEEEEEEEEEESSSCCHHHHHHHHHHHHHCS-EEEEEE
T ss_pred HHHhhc-cccCCEEEEeCCCcCCCchhhcCHHHHHHHHHHhCCCCEEEEecCCcccChHHHHHHHHHHHhhCC-ceeeee
Confidence 999887 478999999999999999999999999999999999999999999999999999999999999999 899999
Q ss_pred EEeeecCCCcEEEEEeecCCCCCCCCCCCCchhhccccccCCCCCceeCHHHHHHHhcCcHHHHHHhhcC
Q 019882 252 ASVPTYPSGIIGFLICSTEGPHVDFVNPINPIEKLEGADKHKRELRFYNSEIHSAAFALPAFLKREVSVL 321 (334)
Q Consensus 252 ~~vPsyp~g~w~f~laSk~~~~~~~~~p~~~~~~~~~~~~~~~~lryYn~~ih~aaF~LP~~~~~~l~~~ 321 (334)
+.|||||+|.|+|++|||+.++..+. .... ..+......+|||||+++|+|||+||+|+|++|+.+
T Consensus 227 ~~vPty~~g~w~f~~as~~~~~~~~~---~~~~-~~~~~~~~~~~~yyn~~~h~aaF~lP~~~~~~l~~e 292 (294)
T 3o4f_A 227 AAIPTYYGGIMTFAWATDNDALRHLS---TEII-QARFLASGLKCRYYNPAIHTAAFALPQYLQDALASQ 292 (294)
T ss_dssp ECCTTSSSSCEEEEEEESCTTGGGCC---HHHH-HHHHHSSCCCCSSCCHHHHHHHTCCCHHHHHHTTSS
T ss_pred eeeccCCCcceeheeEECCCccccCC---hHHH-hHHHHhhCCCceEECHHHHHHHccCcHHHHHHHhcC
Confidence 99999999999999999986544322 1111 112233456899999999999999999999999753
|
| >2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A | Back alignment and structure |
|---|
| >2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* | Back alignment and structure |
|---|
| >2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* | Back alignment and structure |
|---|
| >1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* | Back alignment and structure |
|---|
| >2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* | Back alignment and structure |
|---|
| >1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* | Back alignment and structure |
|---|
| >3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* | Back alignment and structure |
|---|
| >1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* | Back alignment and structure |
|---|
| >2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A | Back alignment and structure |
|---|
| >3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* | Back alignment and structure |
|---|
| >3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} | Back alignment and structure |
|---|
| >3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* | Back alignment and structure |
|---|
| >3vyw_A MNMC2; tRNA wobble uridine, modification enzyme, genetic CODE, 5- methylaminomethyl-2-thiouridine, methyltransferase; HET: SAM; 2.49A {Aquifex aeolicus} PDB: 2e58_A* | Back alignment and structure |
|---|
| >3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* | Back alignment and structure |
|---|
| >3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
| >3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} | Back alignment and structure |
|---|
| >2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 | Back alignment and structure |
|---|
| >3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* | Back alignment and structure |
|---|
| >2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} | Back alignment and structure |
|---|
| >3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 | Back alignment and structure |
|---|
| >2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} | Back alignment and structure |
|---|
| >2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* | Back alignment and structure |
|---|
| >3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... | Back alignment and structure |
|---|
| >3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* | Back alignment and structure |
|---|
| >3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* | Back alignment and structure |
|---|
| >3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* | Back alignment and structure |
|---|
| >1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 | Back alignment and structure |
|---|
| >3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* | Back alignment and structure |
|---|
| >2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E | Back alignment and structure |
|---|
| >1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 | Back alignment and structure |
|---|
| >3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* | Back alignment and structure |
|---|
| >2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A | Back alignment and structure |
|---|
| >1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A | Back alignment and structure |
|---|
| >1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* | Back alignment and structure |
|---|
| >3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 | Back alignment and structure |
|---|
| >2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A | Back alignment and structure |
|---|
| >3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* | Back alignment and structure |
|---|
| >3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* | Back alignment and structure |
|---|
| >3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* | Back alignment and structure |
|---|
| >2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 | Back alignment and structure |
|---|
| >2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} | Back alignment and structure |
|---|
| >3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* | Back alignment and structure |
|---|
| >1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* | Back alignment and structure |
|---|
| >2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} | Back alignment and structure |
|---|
| >1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* | Back alignment and structure |
|---|
| >1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3tos_A CALS11; methyltransferase, calicheamicin, structural genomic protein structure initiative, PSI, natPro; HET: MSE SAH GLU; 1.55A {Micromonospora echinospora} PDB: 4gf5_A* | Back alignment and structure |
|---|
| >3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A | Back alignment and structure |
|---|
| >3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* | Back alignment and structure |
|---|
| >2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* | Back alignment and structure |
|---|
| >3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A | Back alignment and structure |
|---|
| >1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 | Back alignment and structure |
|---|
| >1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* | Back alignment and structure |
|---|
| >4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* | Back alignment and structure |
|---|
| >4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* | Back alignment and structure |
|---|
| >4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* | Back alignment and structure |
|---|
| >3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* | Back alignment and structure |
|---|
| >2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* | Back alignment and structure |
|---|
| >2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 | Back alignment and structure |
|---|
| >2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A | Back alignment and structure |
|---|
| >2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} | Back alignment and structure |
|---|
| >1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* | Back alignment and structure |
|---|
| >3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* | Back alignment and structure |
|---|
| >2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A | Back alignment and structure |
|---|
| >2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* | Back alignment and structure |
|---|
| >2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 | Back alignment and structure |
|---|
| >3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} | Back alignment and structure |
|---|
| >2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* | Back alignment and structure |
|---|
| >3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* | Back alignment and structure |
|---|
| >1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* | Back alignment and structure |
|---|
| >3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* | Back alignment and structure |
|---|
| >3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* | Back alignment and structure |
|---|
| >2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* | Back alignment and structure |
|---|
| >2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 | Back alignment and structure |
|---|
| >1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A | Back alignment and structure |
|---|
| >2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* | Back alignment and structure |
|---|
| >3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* | Back alignment and structure |
|---|
| >2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A | Back alignment and structure |
|---|
| >3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A | Back alignment and structure |
|---|
| >3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* | Back alignment and structure |
|---|
| >3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} | Back alignment and structure |
|---|
| >3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* | Back alignment and structure |
|---|
| >3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* | Back alignment and structure |
|---|
| >1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 | Back alignment and structure |
|---|
| >4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A | Back alignment and structure |
|---|
| >3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* | Back alignment and structure |
|---|
| >3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} | Back alignment and structure |
|---|
| >1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* | Back alignment and structure |
|---|
| >3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* | Back alignment and structure |
|---|
| >2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} | Back alignment and structure |
|---|
| >2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* | Back alignment and structure |
|---|
| >3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* | Back alignment and structure |
|---|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 | Back alignment and structure |
|---|
| >1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* | Back alignment and structure |
|---|
| >3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* | Back alignment and structure |
|---|
| >4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} | Back alignment and structure |
|---|
| >2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 334 | ||||
| d1xj5a_ | 290 | c.66.1.17 (A:) Spermidine synthase {Thale cress (A | 1e-89 | |
| d2b2ca1 | 312 | c.66.1.17 (A:3-314) Spermidine synthase {Caenorhab | 2e-84 | |
| d2o07a1 | 285 | c.66.1.17 (A:16-300) Spermidine synthase {Human (H | 7e-76 | |
| d1inla_ | 295 | c.66.1.17 (A:) Spermidine synthase {Thermotoga mar | 2e-72 | |
| d1uira_ | 312 | c.66.1.17 (A:) Spermidine synthase {Thermus thermo | 7e-68 | |
| d1iy9a_ | 274 | c.66.1.17 (A:) Spermidine synthase {Bacillus subti | 1e-66 | |
| d1mjfa_ | 276 | c.66.1.17 (A:) Putative spermidine synthetase PF01 | 1e-62 | |
| d1booa_ | 320 | c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA me | 0.001 | |
| d2b25a1 | 324 | c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 | 0.004 |
| >d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 290 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: Spermidine synthase domain: Spermidine synthase species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 268 bits (685), Expect = 1e-89
Identities = 174/305 (57%), Positives = 219/305 (71%), Gaps = 51/305 (16%)
Query: 49 STVVSGWFSESQSTSDKTGKTMYFNNPMWPGEAHSLKVKEILFKGKSEYQEVLVFESLAY 108
STV+ GWFSE +PMWPGEAHSLKV+++LF+GKS+YQ+V+VF+S Y
Sbjct: 1 STVIPGWFSE--------------MSPMWPGEAHSLKVEKVLFQGKSDYQDVIVFQSATY 46
Query: 109 GKVLVLDGIVQLTEKDECAYQEMIAHLPLCSIPSPKTV---------------------- 146
GKVLVLDG++QLTE+DECAYQEMI HLPLCSIP+PK V
Sbjct: 47 GKVLVLDGVIQLTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHASIEQ 106
Query: 147 -------------SKKYFPELAVGFEDPRVRLHIGDAVEFLRQVPRGKYDAIIVDSSDPV 193
SK++FP++A+G+EDPRV L IGD V FL+ G YDA+IVDSSDP+
Sbjct: 107 IDMCEIDKMVVDVSKQFFPDVAIGYEDPRVNLVIGDGVAFLKNAAEGSYDAVIVDSSDPI 166
Query: 194 GPAQELVEKPFFDTIAKALRPGGVLCNMAESMWLHTHLIEDMISICRETFKGSVHYAWAS 253
GPA+EL EKPFF ++A+ALRPGGV+C AES+WLH +IED++S CRE FKGSV+YAW S
Sbjct: 167 GPAKELFEKPFFQSVARALRPGGVVCTQAESLWLHMDIIEDIVSNCREIFKGSVNYAWTS 226
Query: 254 VPTYPSGIIGFLICSTEGPHVDFVNPINPIEKLEGADKHKRELRFYNSEIHSAAFALPAF 313
VPTYPSG+IGF++CSTEGP VDF +P+NPI+ E + K L+FYN+EIHSAAF LP+F
Sbjct: 227 VPTYPSGVIGFMLCSTEGPDVDFKHPLNPID--ESSSKSNGPLKFYNAEIHSAAFCLPSF 284
Query: 314 LKREV 318
K+ +
Sbjct: 285 AKKVI 289
|
| >d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Length = 312 | Back information, alignment and structure |
|---|
| >d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Length = 295 | Back information, alignment and structure |
|---|
| >d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Length = 312 | Back information, alignment and structure |
|---|
| >d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Length = 274 | Back information, alignment and structure |
|---|
| >d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 276 | Back information, alignment and structure |
|---|
| >d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Length = 320 | Back information, alignment and structure |
|---|
| >d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 334 | |||
| d1xj5a_ | 290 | Spermidine synthase {Thale cress (Arabidopsis thal | 100.0 | |
| d2b2ca1 | 312 | Spermidine synthase {Caenorhabditis elegans [TaxId | 100.0 | |
| d2o07a1 | 285 | Spermidine synthase {Human (Homo sapiens) [TaxId: | 100.0 | |
| d1inla_ | 295 | Spermidine synthase {Thermotoga maritima [TaxId: 2 | 100.0 | |
| d1iy9a_ | 274 | Spermidine synthase {Bacillus subtilis [TaxId: 142 | 100.0 | |
| d1uira_ | 312 | Spermidine synthase {Thermus thermophilus [TaxId: | 100.0 | |
| d1mjfa_ | 276 | Putative spermidine synthetase PF0127 (SpeE) {Arch | 100.0 | |
| d1susa1 | 227 | Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag | 98.06 | |
| d2avda1 | 219 | COMT domain-containing protein 1, COMTD1 {Human (H | 97.93 | |
| d2b78a2 | 317 | Hypothetical protein SMu776, middle and C-terminal | 97.41 | |
| d2fcaa1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil | 97.41 | |
| d1zx0a1 | 229 | Guanidinoacetate methyltransferase {Human (Homo sa | 97.31 | |
| d2igta1 | 309 | Putative methyltransferase Atu0340 {Agrobacterium | 96.94 | |
| d1yzha1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep | 96.94 | |
| d1i9ga_ | 264 | Probable methyltransferase Rv2118c {Mycobacterium | 96.86 | |
| d2as0a2 | 324 | Hypothetical protein PH1915, middle and C-terminal | 96.85 | |
| d1yb2a1 | 250 | Hypothetical protein Ta0852 {Thermoplasma acidophi | 96.84 | |
| d1wxxa2 | 318 | Hypothetical protein TTHA1280, middle and C-termin | 96.81 | |
| d2b25a1 | 324 | Hypothetical protein FLJ20628 {Human (Homo sapiens | 96.38 | |
| d1dusa_ | 194 | Hypothetical protein MJ0882 {Archaeon Methanococcu | 96.0 | |
| d1o54a_ | 266 | Hypothetical protein TM0748 {Thermotoga maritima [ | 95.41 | |
| d1l3ia_ | 186 | Precorrin-6Y methyltransferase (CbiT) {Archaeon Me | 95.34 | |
| d2cl5a1 | 214 | Catechol O-methyltransferase, COMT {Rat (Rattus no | 95.26 | |
| d1g60a_ | 256 | Methyltransferase mboII {Moraxella bovis [TaxId: 4 | 95.14 | |
| d2esra1 | 152 | Putative methyltransferase SPy1538 {Streptococcus | 94.97 | |
| d1booa_ | 320 | m.PvuII N4 cytosine-specific DNA methyltransferase | 94.92 | |
| d2fhpa1 | 182 | Putative methylase EF2452 {Enterococcus faecalis [ | 94.45 | |
| d2fpoa1 | 183 | Methylase YhhF {Escherichia coli [TaxId: 562]} | 94.43 | |
| d1eg2a_ | 279 | m.RsrI N6 adenosine-specific DNA methyltransferase | 94.29 | |
| d2dula1 | 375 | N(2),N(2)-dimethylguanosine tRNA methyltransferase | 94.12 | |
| d1y8ca_ | 246 | Putative methyltransferase CAC2371 {Clostridium ac | 93.92 | |
| d2frna1 | 260 | Hypothetical protein PH0793 {Pyrococcus horikoshii | 93.8 | |
| d1vbfa_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Sulfolo | 93.05 | |
| d1kpia_ | 291 | CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | 93.01 | |
| d1i1na_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Human ( | 92.96 | |
| d1dl5a1 | 213 | Protein-L-isoaspartyl O-methyltransferase {Thermot | 92.95 | |
| d1wzna1 | 251 | Hypothetical methyltransferase PH1305 {Archaeon Py | 92.31 | |
| d1r18a_ | 223 | Protein-L-isoaspartyl O-methyltransferase {Fruit f | 91.73 | |
| d1nkva_ | 245 | Hypothetical Protein YjhP {Escherichia coli [TaxId | 91.61 | |
| d1vl5a_ | 231 | Hypothetical protein BH2331 {Bacillus halodurans [ | 91.46 | |
| d2o57a1 | 282 | Putative sarcosine dimethylglycine methyltransfera | 91.3 | |
| d1kpga_ | 285 | CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | 91.29 | |
| d2fk8a1 | 280 | Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri | 91.12 | |
| d1xtpa_ | 254 | Hypothetical protein Lmaj004091aaa (LmjF30.0810) { | 90.99 | |
| d1ve3a1 | 226 | Hypothetical protein PH0226 {Archaeon Pyrococcus h | 90.57 | |
| d2ifta1 | 183 | Putative methylase HI0767 {Haemophilus influenzae | 90.49 | |
| d1p91a_ | 268 | rRNA methyltransferase RlmA {Escherichia coli [Tax | 90.41 | |
| d1jg1a_ | 215 | Protein-L-isoaspartyl O-methyltransferase {Archaeo | 89.58 | |
| d2ex4a1 | 222 | Adrenal gland protein AD-003 (C9orf32) {Human (Hom | 88.87 | |
| d1xxla_ | 234 | Hypothetical protein YcgJ {Bacillus subtilis [TaxI | 88.23 | |
| d2nxca1 | 254 | PrmA-like protein TTHA0656 (TT0836) {Thermus therm | 87.8 | |
| d1ri5a_ | 252 | mRNA cap (Guanine N-7) methyltransferase {Fungus ( | 86.41 | |
| d1vlma_ | 208 | Possible histamine N-methyltransferase TM1293 {The | 86.38 | |
| d1ws6a1 | 171 | Methyltransferase TTHA0928 {Thermus thermophilus [ | 86.27 | |
| d2bm8a1 | 232 | Cephalosporin hydroxylase CmcI {Streptomyces clavu | 85.81 | |
| d1oria_ | 316 | Protein arginine N-methyltransferase 1, PRMT1 {Rat | 84.98 | |
| d1g6q1_ | 328 | Arginine methyltransferase, HMT1 {Baker's yeast (S | 83.81 | |
| d1g8sa_ | 230 | Fibrillarin homologue {Archaeon Methanococcus jann | 83.45 | |
| d2p7ia1 | 225 | Hypothetical protein ECA1738 {Erwinia carotovora [ | 82.93 | |
| d1g8aa_ | 227 | Fibrillarin homologue {Archaeon Pyrococcus horikos | 82.9 | |
| d1tw3a2 | 253 | Carminomycin 4-O-methyltransferase {Streptomyces p | 82.86 | |
| d1nt2a_ | 209 | Fibrillarin homologue {Archaeon Archaeoglobus fulg | 82.58 | |
| d2fyta1 | 311 | Protein arginine N-methyltransferase 3, PRMT3 {Hum | 82.35 | |
| d1jqea_ | 280 | Histamine methyltransferase {Human (Homo sapiens) | 82.08 | |
| d2oyra1 | 250 | Hypothetical protein YhiQ {Shigella flexneri [TaxI | 81.87 | |
| d2bzga1 | 229 | Thiopurine S-methyltransferase {Human (Homo sapien | 81.5 | |
| d2avna1 | 246 | Hypothetical methyltransferase TM1389 {Thermotoga | 81.46 |
| >d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: Spermidine synthase domain: Spermidine synthase species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=100.00 E-value=1.2e-65 Score=486.61 Aligned_cols=255 Identities=68% Similarity=1.275 Sum_probs=234.9
Q ss_pred ccccccceeecccCCCCcccccccCCCCCCCceEEEeeccEEEEeeCCCceEEEEEeCCceeEEEECCeEEeeccchhHH
Q 019882 49 STVVSGWFSESQSTSDKTGKTMYFNNPMWPGEAHSLKVKEILFKGKSEYQEVLVFESLAYGKVLVLDGIVQLTEKDECAY 128 (334)
Q Consensus 49 ~~~~~~wf~e~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~vL~~~~S~yQ~I~V~et~~~G~~L~LDG~iQ~te~DEf~Y 128 (334)
+|.+++||+|. +++|||.+++++|+++|++++|+||+|+|++++.+||+|+|||.+|++++||+.|
T Consensus 1 ~~~~~~w~~e~--------------~~~~~~~~~~~~v~~~l~~~~S~yQ~i~v~~~~~~gr~L~LDg~~q~~e~de~~Y 66 (290)
T d1xj5a_ 1 STVIPGWFSEM--------------SPMWPGEAHSLKVEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVIQLTERDECAY 66 (290)
T ss_dssp CCCCSSEEEEC--------------CTTSTTEEEEEEEEEEEEEEECSSCEEEEEEESSSCEEEEETTEEEEETTTHHHH
T ss_pred CCCCCcceecc--------------ccCCCCceEEEEEeeEEEeCCCCCeEEEEEEeCCCCeEEEECCeEeeeccchhHH
Confidence 46788999998 5789999999999999999999999999999999999999999999999999999
Q ss_pred HHHhhhhccccCCChhh-----------------------------------hHHhhCcccccCCCCCCeEEEEchHHHH
Q 019882 129 QEMIAHLPLCSIPSPKT-----------------------------------VSKKYFPELAVGFEDPRVRLHIGDAVEF 173 (334)
Q Consensus 129 hEmlvh~pl~~hp~Pkr-----------------------------------vak~~fp~l~~~~~dpRv~viv~Dg~~f 173 (334)
||||+|+||++||+|++ +|++|||....+++|||++++++||++|
T Consensus 67 he~l~h~~~~~~~~pk~VLiiGgG~G~~~r~~l~~~~~~~i~~VEiD~~Vi~~~~~~f~~~~~~~~~~r~~i~~~Da~~~ 146 (290)
T d1xj5a_ 67 QEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHASIEQIDMCEIDKMVVDVSKQFFPDVAIGYEDPRVNLVIGDGVAF 146 (290)
T ss_dssp HHHHHHHHHTTSSCCCEEEEETCSSSHHHHHHTTCTTCCEEEEEESCHHHHHHHHHHCHHHHGGGGSTTEEEEESCHHHH
T ss_pred HHHHhhHHHhhCCCCcceEEecCCchHHHHHHHhcccceeeEEecCCHHHHHHHHHhchhhhccccCCCcEEEEccHHHH
Confidence 99999999999999999 6899999887778999999999999999
Q ss_pred HhhCCCCceeEEEECCCCCCCCCcCCCCHHHHHHHHHhcCCCcEEEEeccchhhhhhHHHHHHHHHHHhcCCceeEEEEE
Q 019882 174 LRQVPRGKYDAIIVDSSDPVGPAQELVEKPFFDTIAKALRPGGVLCNMAESMWLHTHLIEDMISICRETFKGSVHYAWAS 253 (334)
Q Consensus 174 L~~~~~~~yDvIIvD~~dp~gpa~~L~t~eFy~~v~~~L~~gGilv~q~~sp~~~~~~~~~i~~tl~~vF~~~v~~~~~~ 253 (334)
|++.++++||+||+|++||.+++.+|||+|||+.|+++|+|||++|+|++|++.+.+.++.++++++++|++++.|+.+.
T Consensus 147 l~~~~~~~yDvIi~D~~dp~~~~~~L~t~eF~~~~~~~L~~~Gi~v~q~~s~~~~~~~~~~i~~~l~~vF~~~~~y~~~~ 226 (290)
T d1xj5a_ 147 LKNAAEGSYDAVIVDSSDPIGPAKELFEKPFFQSVARALRPGGVVCTQAESLWLHMDIIEDIVSNCREIFKGSVNYAWTS 226 (290)
T ss_dssp HHTSCTTCEEEEEECCCCTTSGGGGGGSHHHHHHHHHHEEEEEEEEEECCCTTTCHHHHHHHHHHHHHHCSSCEEEEEEE
T ss_pred HhhccccCccEEEEcCCCCCCcchhhCCHHHHHHHHHhcCCCcEEEEecCCcHHHHHHHHHHHhhhhhhcccceeEeeEe
Confidence 98875568999999999999999999999999999999999999999999999999999999999999999777777789
Q ss_pred eeecCCCcEEEEEeecCCCCCCCCCCCCchhhccccccCCCCCceeCHHHHHHHhcCcHHHHHHhh
Q 019882 254 VPTYPSGIIGFLICSTEGPHVDFVNPINPIEKLEGADKHKRELRFYNSEIHSAAFALPAFLKREVS 319 (334)
Q Consensus 254 vPsyp~g~w~f~laSk~~~~~~~~~p~~~~~~~~~~~~~~~~lryYn~~ih~aaF~LP~~~~~~l~ 319 (334)
||+|++|.|+|++||++.++.++.+|..+++.. ......+|||||+++|+|+|+||+|+|++|+
T Consensus 227 vPty~~g~w~f~~as~~~~~~~~~~~~~~~~~~--~~~~~~~l~yYn~~ih~~~F~lP~~~~~~l~ 290 (290)
T d1xj5a_ 227 VPTYPSGVIGFMLCSTEGPDVDFKHPLNPIDES--SSKSNGPLKFYNAEIHSAAFCLPSFAKKVIE 290 (290)
T ss_dssp CTTSGGGEEEEEEEECSSSCCCSSSCSSCCCSG--GGTTTCCCSSCCHHHHHHTTCCCHHHHHHHC
T ss_pred eeeecCCceEEEEEeCCCCccccccccchhHHH--HHhhcCCCcccCHHHHHHHccCcHHHHHhhC
Confidence 999999999999999998888887777655432 2334568999999999999999999999985
|
| >d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} | Back information, alignment and structure |
|---|
| >d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} | Back information, alignment and structure |
|---|
| >d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} | Back information, alignment and structure |
|---|
| >d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} | Back information, alignment and structure |
|---|
| >d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} | Back information, alignment and structure |
|---|
| >d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} | Back information, alignment and structure |
|---|
| >d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} | Back information, alignment and structure |
|---|
| >d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|