Citrus Sinensis ID: 019948

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330---
MTRRCSHCSHNGHNSRTCPNRGVKIFGVRLTDGSIRKSASMGNLSHYAGSTSGHNNNNASNTPDSPGETPDHHADGYASEDFVPGSSSSRERKKGVPWTEEEHRMFLLGLQKLGKGDWRGIARNYVVSRTPTQVASHAQKYFIRQSNVSRRKRRSSLFDIVADEPLDTPAASQDLFSANHTQGETQSNNPLPAPPALDEECESMDSTNSNDGEPAPPKPENSQSCIPMVYPAAYVSPFFPFTYPYWSAYNTEPTQKETHEVLKPTAVHSKSPINVDELVGMSKLSLGESIGQNGPSSLSLKLDEGSSRQSAFHANPASGSSGMNSSGSPIHAL
ccccccccccccccccccccccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccccccccccccccccEEEEEEEEEccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccHHHHcccccccHHHHHHHHHHHHHHccccccccccccEEcccHHHHHHHHHHHHHHHcccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccEEEc
mtrrcshcshnghnsrtcpnrgvkifgvrltdgsirksasmgnlshyagstsghnnnnasntpdspgetpdhhadgyasedfvpgssssrerkkgvpwteEEHRMFLLGLqklgkgdwrgiarnyvvsrtptqvaSHAQKYFIRqsnvsrrkrrsslfdivadepldtpaasqdlfsanhtqgetqsnnplpappaldeecesmdstnsndgepappkpensqscipmvypaayvspffpftypywsaynteptqkethevlkptavhskspinvdELVGMSKLSlgesigqngpsslslkldegssrqsafhanpasgssgmnssgspihal
mtrrcshcshnghnsrtcpnrgvKIFGVRLTDGSIRKSASMGNLSHYAGSTSGHNNNNASNTPDSPGETPDHHADGYASedfvpgssssrerkkgvpwteEEHRMFLLGlqklgkgdWRGIARNYVVSRtptqvashaqkyfirqsnvsrrkrrSSLFDIVADEPLDTPAASQDLFSANHTQGETQSNNPLPAPPALDEECESMDSTNSNDGEPAPPKPENSQSCIPMVYPAAYVSPFFPFTYPYWSAYNTEPTQKETHEVLKPtavhskspinvDELVGMSKLSLGESIGQNGPSSLSLKLDEGSSRQSAFhanpasgssgmnssgspihal
MTRRCSHCSHNGHNSRTCPNRGVKIFGVRLTDGSIRKSASMGNLSHYAGSTSGHNNNNASNTPDSPGETPDHHADGYASEDFVPGSSSSRERKKGVPWTEEEHRMFLLGLQKLGKGDWRGIARNYVVSRTPTQVASHAQKYFIRQSNVSRRKRRSSLFDIVADEPLDTPAASQDLFSANHTQGETQSNNPLPAPPALDEECESMDSTNSNDGEPAPPKPENSQSCIPMVYPAAYVSPFFPFTYPYWSAYNTEPTQKETHEVLKPTAVHSKSPINVDELVGMSKLSLGESIGQNGPSSLSLKLDEGSSRQSAFHANPAsgssgmnssgsPIHAL
********************RGVKIFGVRLT*********************************************************************EEHRMFLLGLQKLGKGDWRGIARNYVVSRTPTQVASHAQKYFIR********************************************************************************CIPMVYPAAYVSPFFPFTYPYWSAYNT**********************************************************************************
******H**H*GHNSRTCPNRGVKIFGV************************************************************************EEHRMFLLGLQKLGKGDWRGIARNYVVSRTPTQVASHAQKY****************************************************************************************YPAAYVSPFFPFT******************************INVD*LVG*****************************************************
**************SRTCPNRGVKIFGVRLTDGSIRKSASMGNLSHYAGSTSGHNNNN*************HHADGYASED*****************TEEEHRMFLLGLQKLGKGDWRGIARNYVVSRTPTQVASHAQKYFIRQSNVSRRKRRSSLFDIVADEPLDTPAASQDLFSAN***********LPAPPALDE**********************SQSCIPMVYPAAYVSPFFPFTYPYWSAYNTEPTQKETHEVLKPTAVHSKSPINVDELVGMSKLSLGESIGQNGPSSLS**********************************
*****************CPNRGVKIFGVRLTDGSIRKS********************************************************GVPWTEEEHRMFLLGLQKLGKGDWRGIARNYVVSRTPTQVASHAQKYFIRQSN*************************************************************************NSQSCIPMVYPAAYVSPFFPFTYPYWSAYNTE*TQKETHEVLKPTAVHSKSPINVDELVGM****************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTRRCSHCSHNGHNSRTCPNRGVKIFGVRLTDGSIRKSASMGNLSHYAGSTSGHNNNNASNTPDSPGETPDHHADGYASEDFVPGSSSSRERKKGVPWTEEEHRMFLLGLQKLGKGDWRGIARNYVVSRTPTQVASHAQKYFIRQSNVSRRKRRSSLFDIVADEPLDTPAASQDLFSANHTQGETQSNNPLPAPPALDEECESMDSTNSNDGEPAPPKPENSQSCIPMVYPAAYVSPFFPFTYPYWSAYNTEPTQKETHEVLKPTAVHSKSPINVDELVGMSKLSLGESIGQNGPSSLSLKLDEGSSRQSAFHANPASGSSGMNSSGSPIHAL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query333 2.2.26 [Sep-21-2011]
Q2V9B0297 Transcription factor MYB1 N/A no 0.510 0.572 0.489 1e-29
Q8S9H7307 Transcription factor DIVA N/A no 0.231 0.250 0.688 3e-27
Q869R9 734 Myb-like protein J OS=Dic yes no 0.195 0.088 0.507 1e-12
Q54HX6 977 Myb-like protein I OS=Dic no no 0.198 0.067 0.447 1e-07
Q54Z40 1217 Myb-like protein H OS=Dic no no 0.150 0.041 0.415 9e-06
Q54IF9 423 Myb-like protein G OS=Dic no no 0.135 0.106 0.489 2e-05
Q6R0H0287 Transcription factor ASG4 no no 0.135 0.156 0.489 6e-05
P92973 608 Protein CCA1 OS=Arabidops no no 0.138 0.075 0.433 0.0003
Q6R0H1 645 Protein LHY OS=Arabidopsi no no 0.153 0.079 0.379 0.0007
>sp|Q2V9B0|MY1R1_SOLTU Transcription factor MYB1R1 OS=Solanum tuberosum PE=2 SV=1 Back     alignment and function desciption
 Score =  130 bits (327), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 89/182 (48%), Positives = 115/182 (63%), Gaps = 12/182 (6%)

Query: 23  VKIFGVRLTDGSIRKSASMGNLSHYAGSTSGHNNNNASNTPDSPGETPDHHAD-GYASED 81
           + +FGVR+    +RKS S+ +LS Y      H N N +N      E+     D GYAS D
Sbjct: 24  IMLFGVRVKVDPMRKSVSLNDLSQYE-----HPNANNNNNGGDNNESSKVAQDEGYASAD 78

Query: 82  --FVPGSSSSRERKKGVPWTEEEHRMFLLGLQKLGKGDWRGIARNYVVSRTPTQVASHAQ 139
                 S+S RERK+GVPWTEEEH++FLLGLQK+GKGDWRGI+RN+V +RTPTQVASHAQ
Sbjct: 79  DAVQHQSNSGRERKRGVPWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQ 138

Query: 140 KYFIRQSNVSRRKRRSSLFDIVADE----PLDTPAASQDLFSANHTQGETQSNNPLPAPP 195
           KYF+R+SN++RR+RRSSLFDI  D     P++     Q++         T   N  P  P
Sbjct: 139 KYFLRRSNLNRRRRRSSLFDITTDSVSVMPIEEVENKQEIPVVAPATLPTTKTNAFPVAP 198

Query: 196 AL 197
            +
Sbjct: 199 TV 200
Binds selectively to the DNA sequence 5'-[GA]GATAA-3' and may act as a transcription factor involved in the regulation of drought-responsive genes. Enhances stomatal closure in response to abscisic acid (ABA). Confers drought and salt tolerance.
Solanum tuberosum (taxid: 4113)
>sp|Q8S9H7|DIV_ANTMA Transcription factor DIVARICATA OS=Antirrhinum majus GN=DIVARICATA PE=2 SV=1 Back     alignment and function description
>sp|Q869R9|MYBJ_DICDI Myb-like protein J OS=Dictyostelium discoideum GN=mybJ PE=3 SV=1 Back     alignment and function description
>sp|Q54HX6|MYBI_DICDI Myb-like protein I OS=Dictyostelium discoideum GN=mybI PE=3 SV=1 Back     alignment and function description
>sp|Q54Z40|MYBH_DICDI Myb-like protein H OS=Dictyostelium discoideum GN=mybH PE=3 SV=1 Back     alignment and function description
>sp|Q54IF9|MYBG_DICDI Myb-like protein G OS=Dictyostelium discoideum GN=mybG PE=3 SV=1 Back     alignment and function description
>sp|Q6R0H0|ASG4_ARATH Transcription factor ASG4 OS=Arabidopsis thaliana GN=ASG4 PE=2 SV=1 Back     alignment and function description
>sp|P92973|CCA1_ARATH Protein CCA1 OS=Arabidopsis thaliana GN=CCA1 PE=1 SV=1 Back     alignment and function description
>sp|Q6R0H1|LHY_ARATH Protein LHY OS=Arabidopsis thaliana GN=LHY PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query333
449526597335 PREDICTED: transcription factor MYB1R1-l 0.993 0.988 0.798 1e-150
224138664337 predicted protein [Populus trichocarpa] 0.996 0.985 0.795 1e-147
449459046336 PREDICTED: transcription factor MYB1R1-l 0.972 0.964 0.793 1e-146
225468749335 PREDICTED: transcription factor MYB1R1 [ 0.996 0.991 0.827 1e-144
296085699324 unnamed protein product [Vitis vinifera] 0.966 0.993 0.811 1e-141
355320018336 myb transcription factor [Humulus lupulu 0.993 0.985 0.795 1e-139
224074185336 predicted protein [Populus trichocarpa] 0.993 0.985 0.804 1e-138
351723019333 MYB transcription factor MYB93 [Glycine 0.981 0.981 0.796 1e-135
7705206342 MybSt1 [Solanum tuberosum] 0.996 0.970 0.749 1e-133
302398961328 MYBR domain class transcription factor [ 0.978 0.993 0.779 1e-132
>gi|449526597|ref|XP_004170300.1| PREDICTED: transcription factor MYB1R1-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  538 bits (1386), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 269/337 (79%), Positives = 293/337 (86%), Gaps = 6/337 (1%)

Query: 1   MTRRCSHCSHNGHNSRTCPNRGVKIFGVRLTDGSIRKSASMGNLSHYAGSTSGHNNNNAS 60
           MTRRCSHCSHNGHNSRTCPNR VK+FGVRLTDGSIRKSASMGNL+HYAGS SG    + S
Sbjct: 1   MTRRCSHCSHNGHNSRTCPNRVVKLFGVRLTDGSIRKSASMGNLNHYAGSGSG-ALQSGS 59

Query: 61  NTPDSPGETPDH--HADGYASEDFVPGSSSS-RERKKGVPWTEEEHRMFLLGLQKLGKGD 117
           N P SPGETP+H   ADGYASEDFVPGSSSS RERKKGVPWTEEEHRMFLLGLQKLGKGD
Sbjct: 60  NNPASPGETPEHGVAADGYASEDFVPGSSSSCRERKKGVPWTEEEHRMFLLGLQKLGKGD 119

Query: 118 WRGIARNYVVSRTPTQVASHAQKYFIRQSNVSRRKRRSSLFDIVADEPLDTPAASQDLFS 177
           WRGIARNYVVSRTPTQVASHAQKYFIRQ+NVSRRKRRSSLFDIVADE ++     QD  S
Sbjct: 120 WRGIARNYVVSRTPTQVASHAQKYFIRQTNVSRRKRRSSLFDIVADERVENSIVQQDFLS 179

Query: 178 ANHTQGETQSNNPLPAPP-ALDEECESMDSTNSNDGEPAPPKPENSQSCIPMVYPAAYVS 236
           AN +  E+QSNNPLP PP  +DEECESMDSTNSNDGE AP +P+  Q C P+VYP AYV+
Sbjct: 180 ANSSHAESQSNNPLPTPPTTVDEECESMDSTNSNDGETAPAEPDGPQCCYPVVYP-AYVA 238

Query: 237 PFFPFTYPYWSAYNTEPTQKETHEVLKPTAVHSKSPINVDELVGMSKLSLGESIGQNGPS 296
           PFFPF+ P++S Y+ E T KETHEVLKPTAVHSKSP+NVDEL+GMSKLSLGESIG +GPS
Sbjct: 239 PFFPFSIPFYSGYSAETTNKETHEVLKPTAVHSKSPLNVDELIGMSKLSLGESIGHSGPS 298

Query: 297 SLSLKLDEGSSRQSAFHANPASGSSGMNSSGSPIHAL 333
           SLSLKL EGSSR+SAFHANPASGS  M+S GSPIHA+
Sbjct: 299 SLSLKLLEGSSRRSAFHANPASGSENMSSGGSPIHAV 335

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224138664|ref|XP_002326659.1| predicted protein [Populus trichocarpa] gi|222833981|gb|EEE72458.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449459046|ref|XP_004147257.1| PREDICTED: transcription factor MYB1R1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225468749|ref|XP_002274350.1| PREDICTED: transcription factor MYB1R1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296085699|emb|CBI29498.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|355320018|emb|CBY88798.1| myb transcription factor [Humulus lupulus] Back     alignment and taxonomy information
>gi|224074185|ref|XP_002304291.1| predicted protein [Populus trichocarpa] gi|222841723|gb|EEE79270.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|351723019|ref|NP_001237520.1| MYB transcription factor MYB93 [Glycine max] gi|110931692|gb|ABH02845.1| MYB transcription factor MYB93 [Glycine max] Back     alignment and taxonomy information
>gi|7705206|gb|AAB32591.2| MybSt1 [Solanum tuberosum] Back     alignment and taxonomy information
>gi|302398961|gb|ADL36775.1| MYBR domain class transcription factor [Malus x domestica] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query333
TAIR|locus:2171519365 AT5G47390 [Arabidopsis thalian 0.669 0.610 0.711 4.5e-82
TAIR|locus:2094942387 AT3G16350 [Arabidopsis thalian 0.828 0.713 0.460 1.2e-67
TAIR|locus:2020653261 AT1G70000 [Arabidopsis thalian 0.579 0.739 0.454 9.3e-43
TAIR|locus:2151621317 AT5G61620 [Arabidopsis thalian 0.711 0.747 0.385 6.1e-39
TAIR|locus:2027181265 AT1G74840 [Arabidopsis thalian 0.492 0.618 0.48 8.3e-39
TAIR|locus:2011216285 AT1G19000 [Arabidopsis thalian 0.531 0.621 0.479 3.5e-36
TAIR|locus:2165106233 AT5G56840 [Arabidopsis thalian 0.462 0.660 0.469 6e-32
TAIR|locus:2028461314 AT1G49010 [Arabidopsis thalian 0.534 0.566 0.410 2.7e-29
TAIR|locus:2159607298 AT5G08520 [Arabidopsis thalian 0.492 0.550 0.414 1.9e-28
TAIR|locus:2042872298 AT2G38090 [Arabidopsis thalian 0.279 0.312 0.659 3.1e-28
TAIR|locus:2171519 AT5G47390 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 823 (294.8 bits), Expect = 4.5e-82, P = 4.5e-82
 Identities = 168/236 (71%), Positives = 182/236 (77%)

Query:     1 MTRRCSHCSHNGHNSRTCPNRGVKIFGVRLTDGSIRKSASMGNLSHYAGSTSGHNNNNAS 60
             MTRRCSHC+HNGHNSRTCPNRGVK+FGVRLT+GSIRKSASMGNLSHY GS SG  +   S
Sbjct:     1 MTRRCSHCNHNGHNSRTCPNRGVKLFGVRLTEGSIRKSASMGNLSHYTGSGSG-GHGTGS 59

Query:    61 NTPDSPGETPDHHA-DGYASEDFVPGSSSSRERKKGVPWTEEEHRMFLLGLQKLGKGDWR 119
             NTP SPG+ PDH A DGYASEDFV GSSSSRERKKG PWTEEEHRMFLLGLQKLGKGDWR
Sbjct:    60 NTPGSPGDVPDHVAGDGYASEDFVAGSSSSRERKKGTPWTEEEHRMFLLGLQKLGKGDWR 119

Query:   120 GIARNYVVSRTPTQVASHAQKYFIRQSNVSRRKRRSSLFDIVADE----PLDTPAASQDL 175
             GI+RNYV +RTPTQVASHAQKYFIRQSNVSRRKRRSSLFD+V DE    P+D     +D 
Sbjct:   120 GISRNYVTTRTPTQVASHAQKYFIRQSNVSRRKRRSSLFDMVPDEVGDIPMDLQEPEEDN 179

Query:   176 FSAN-HTQG-----ETQSNNPLPAPPALD-EECESMDSTNSNDGEPAPPKPENSQS 224
                    QG     +T + + L AP  L+ EECESMDSTNS  GEP       S S
Sbjct:   180 IPVETEMQGADSIHQTLAPSSLHAPSILEIEECESMDSTNSTTGEPTATAAAASSS 235
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
GO:0009651 "response to salt stress" evidence=IEP
GO:0009723 "response to ethylene stimulus" evidence=IEP
GO:0009737 "response to abscisic acid stimulus" evidence=IEP
GO:0009739 "response to gibberellin stimulus" evidence=IEP
GO:0009751 "response to salicylic acid stimulus" evidence=IEP
GO:0009753 "response to jasmonic acid stimulus" evidence=IEP
GO:0046686 "response to cadmium ion" evidence=IEP
TAIR|locus:2094942 AT3G16350 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020653 AT1G70000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151621 AT5G61620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027181 AT1G74840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011216 AT1G19000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2165106 AT5G56840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2028461 AT1G49010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2159607 AT5G08520 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042872 AT2G38090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query333
TIGR0155757 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domai 1e-20
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 2e-10
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 3e-10
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 4e-10
cd1166050 cd11660, SANT_TRF, Telomere repeat binding factor- 1e-04
COG5114 432 COG5114, COG5114, Histone acetyltransferase comple 7e-04
>gnl|CDD|130620 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information 
 Score = 83.2 bits (206), Expect = 1e-20
 Identities = 27/57 (47%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 93  KKGVPWTEEEHRMFLLGLQKLGKGDW---RGIARNYVVSR-TPTQVASHAQKYFIRQ 145
           K  V WTE+ H  FL  +QKLG  DW   + I    VV   T  QVASH QKY ++Q
Sbjct: 1   KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLKQ 57

This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif. Length = 57
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|212558 cd11660, SANT_TRF, Telomere repeat binding factor-like DNA-binding domains of the SANT/myb-like family Back     alignment and domain information
>gnl|CDD|227445 COG5114, COG5114, Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 333
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 99.77
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.39
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.03
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.03
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 98.58
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 98.57
KOG0724335 consensus Zuotin and related molecular chaperones 98.38
PLN03212249 Transcription repressor MYB5; Provisional 98.17
PLN03091 459 hypothetical protein; Provisional 98.03
KOG4329445 consensus DNA-binding protein [General function pr 97.98
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 97.95
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 97.88
PLN03212249 Transcription repressor MYB5; Provisional 97.6
PLN03091 459 hypothetical protein; Provisional 97.5
KOG1279506 consensus Chromatin remodeling factor subunit and 97.49
PLN03162526 golden-2 like transcription factor; Provisional 97.26
KOG0048238 consensus Transcription factor, Myb superfamily [T 96.98
KOG0049 939 consensus Transcription factor, Myb superfamily [T 96.45
KOG4167907 consensus Predicted DNA-binding protein, contains 96.32
KOG0048238 consensus Transcription factor, Myb superfamily [T 95.85
KOG0049 939 consensus Transcription factor, Myb superfamily [T 95.3
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 94.85
PF0009818 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc fi 94.72
KOG4468 782 consensus Polycomb-group transcriptional regulator 94.59
PLN031421033 Probable chromatin-remodeling complex ATPase chain 94.5
KOG3554 693 consensus Histone deacetylase complex, MTA1 compon 94.46
KOG0724335 consensus Zuotin and related molecular chaperones 94.23
KOG3841 455 consensus TEF-1 and related transcription factor, 93.94
PF1528840 zf-CCHC_6: Zinc knuckle 93.71
PF1439249 zf-CCHC_4: Zinc knuckle 92.93
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 92.66
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 91.46
smart0042668 TEA TEA domain. 90.91
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 90.64
KOG1194 534 consensus Predicted DNA-binding protein, contains 85.71
PF01285 431 TEA: TEA/ATTS domain family; InterPro: IPR000818 T 83.86
smart0034326 ZnF_C2HC zinc finger. 82.03
KOG0051607 consensus RNA polymerase I termination factor, Myb 81.57
COG5147 512 REB1 Myb superfamily proteins, including transcrip 81.32
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information 
Probab=99.77  E-value=4.9e-19  Score=133.01  Aligned_cols=53  Identities=51%  Similarity=0.727  Sum_probs=48.8

Q ss_pred             CCCCCCCHHHHHHHHHHHHHcCCCCh---hhhhhhhcCCC-CHHHHHhHHHHHHHHH
Q 019948           93 KKGVPWTEEEHRMFLLGLQKLGKGDW---RGIARNYVVSR-TPTQVASHAQKYFIRQ  145 (333)
Q Consensus        93 kk~~~WTeEEH~~FL~GLekyGkGdW---k~IA~~~V~TR-Tp~QV~SHAQKYF~r~  145 (333)
                      |++..||+|||++||+||+.||.|+|   +.|++.++.++ |+.||+|||||||+++
T Consensus         1 k~r~~WT~eeh~~Fl~ai~~~G~g~~a~pk~I~~~~~~~~lT~~qV~SH~QKy~~k~   57 (57)
T TIGR01557         1 KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLKQ   57 (57)
T ss_pred             CCCCCCCHHHHHHHHHHHHHhCCCcccchHHHHHHcCCCCCCHHHHHHHHHHHHccC
Confidence            45689999999999999999999999   99997777899 9999999999999863

This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by Pfam model pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif.
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG4329 consensus DNA-binding protein [General function prediction only] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03162 golden-2 like transcription factor; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>PF00098 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3841 consensus TEF-1 and related transcription factor, TEAD family [Transcription] Back     alignment and domain information
>PF15288 zf-CCHC_6: Zinc knuckle Back     alignment and domain information
>PF14392 zf-CCHC_4: Zinc knuckle Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00426 TEA TEA domain Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PF01285 TEA: TEA/ATTS domain family; InterPro: IPR000818 Transcriptional enhancer activators are nuclear proteins that contain a TEA/ATTSdomain, a DNA-binding region of 66-68 amino acids Back     alignment and domain information
>smart00343 ZnF_C2HC zinc finger Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query333
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 3e-25
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 2e-20
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 1e-14
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 1e-14
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 2e-13
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 2e-12
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 6e-11
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 4e-10
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 5e-09
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 9e-08
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 2e-07
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 2e-07
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 4e-07
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 5e-07
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 5e-07
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 3e-06
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 8e-06
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 1e-05
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 2e-05
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 4e-05
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 2e-04
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 5e-04
2crg_A70 Metastasis associated protein MTA3; transcription 7e-04
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 9e-04
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
 Score = 95.6 bits (238), Expect = 3e-25
 Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 2/70 (2%)

Query: 87  SSSRERKKGVPWTEEEHRMFLLGLQKLGKGDWRGIARNYVVSRTPTQVASHAQKYFIRQS 146
            SS      V WT EE  +F  GL K G+  W  I++  + SRT  QV S+A++YF  + 
Sbjct: 1   GSSGSSGYSVKWTIEEKELFEQGLAKFGR-RWTKISK-LIGSRTVLQVKSYARQYFKNKV 58

Query: 147 NVSRRKRRSS 156
                K   +
Sbjct: 59  KCGLDKETPN 68
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Length = 64 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Length = 74 Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Length = 70 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query333
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.56
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.42
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.4
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.37
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.36
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.34
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 99.28
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.23
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 99.21
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 99.21
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 99.2
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.17
2crg_A70 Metastasis associated protein MTA3; transcription 99.14
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.11
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.07
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.05
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.01
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 98.99
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 98.96
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.49
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 98.91
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 98.84
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 98.82
2cjj_A93 Radialis; plant development, DNA-binding protein, 98.79
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 98.78
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 98.76
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.75
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 98.75
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 98.75
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.71
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 98.71
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 98.7
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 98.7
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 98.7
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 98.66
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 98.63
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 98.63
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.54
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 98.51
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 98.49
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 98.48
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 98.47
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 98.32
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.16
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 97.64
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 97.51
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.39
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 97.29
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 96.55
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 96.09
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 95.77
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 95.28
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 94.79
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 94.38
1dsq_A26 Nucleic acid binding protein P14; CCHC type zinc f 93.95
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 93.89
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 93.7
2hzd_A82 Transcriptional enhancer factor TEF-1; DNA-binding 92.55
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 90.39
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 89.37
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 89.66
1a6b_B40 Momulv, zinc finger protein NCP10; nucleocapsid pr 88.89
1nc8_A29 Nucleocapsid protein; HIV-2, RNA recognition, zinc 87.55
1u6p_A56 GAG polyprotein; MLV, A-minor K-turn, stem loop, b 83.0
2a51_A39 Nucleocapsid protein; sivlhoest, structure, NCP8, 82.97
2bl6_A37 Nucleocapsid protein P11; lentivirus, polyprotein, 82.45
1a1t_A55 Nucleocapsid protein; stem-loop RNA, viral protein 80.35
2bl6_A37 Nucleocapsid protein P11; lentivirus, polyprotein, 80.05
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
Probab=99.56  E-value=5.2e-15  Score=112.70  Aligned_cols=63  Identities=35%  Similarity=0.558  Sum_probs=58.0

Q ss_pred             CCCCCHHHHHHHHHHHHHcCCCChhhhhhhhcCCCCHHHHHhHHHHHHHHHhhhccccCCCcccc
Q 019948           95 GVPWTEEEHRMFLLGLQKLGKGDWRGIARNYVVSRTPTQVASHAQKYFIRQSNVSRRKRRSSLFD  159 (333)
Q Consensus        95 ~~~WTeEEH~~FL~GLekyGkGdWk~IA~~~V~TRTp~QV~SHAQKYF~r~~~~~krkrR~Sl~D  159 (333)
                      ..+||+||+++|++++++||. +|..||+ +|++||..||+.|+++||.+..+....+++.+||+
T Consensus         9 ~~~WT~eEd~~l~~~~~~~G~-~W~~Ia~-~~~~Rt~~q~k~r~~~~l~~~~~~g~~~~~~si~s   71 (72)
T 2cu7_A            9 SVKWTIEEKELFEQGLAKFGR-RWTKISK-LIGSRTVLQVKSYARQYFKNKVKCGLDKETPNQKT   71 (72)
T ss_dssp             CCCCCHHHHHHHHHHHHHTCS-CHHHHHH-HHSSSCHHHHHHHHHHHHHHHSCSCTTCCCSCCCC
T ss_pred             CCCCCHHHHHHHHHHHHHHCc-CHHHHHH-HcCCCCHHHHHHHHHHHHHHHHhcCCCCCcccccc
Confidence            469999999999999999999 9999995 99999999999999999999887777788888875
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1dsq_A Nucleic acid binding protein P14; CCHC type zinc finger, virus/viral protein; NMR {Mouse mammary tumor virus} SCOP: g.40.1.1 Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2hzd_A Transcriptional enhancer factor TEF-1; DNA-binding, helix-turn-helix, gene regulation; NMR {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>1a6b_B Momulv, zinc finger protein NCP10; nucleocapsid protein, intercalation, nucleic acid, retrovirus, viral protein/DNA complex; HET: DNA; NMR {Synthetic} SCOP: g.40.1.1 Back     alignment and structure
>1nc8_A Nucleocapsid protein; HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus 2} SCOP: g.40.1.1 PDB: 2di2_A Back     alignment and structure
>1u6p_A GAG polyprotein; MLV, A-minor K-turn, stem loop, bulge, G-U mismatch, G-A MIS U mismatch, A-C mismatch, zinc finger, NC, viral protein-RN; HET: AP7; NMR {Moloney murine leukemia virus} SCOP: g.40.1.1 PDB: 1wwd_A 1wwe_A 1wwf_A 1wwg_A Back     alignment and structure
>2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} Back     alignment and structure
>2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} Back     alignment and structure
>1a1t_A Nucleocapsid protein; stem-loop RNA, viral protein/RNA complex; NMR {Human immunodeficiency virus 1} SCOP: g.40.1.1 PDB: 1mfs_A 1f6u_A* 1aaf_A 2l4l_A 2exf_A 2jzw_A* 1bj6_A* 1esk_A 1q3y_A 1q3z_A 2e1x_A 2iwj_A Back     alignment and structure
>2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 333
d1irza_64 a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis th 2e-19
d2crga157 a.4.1.3 (A:8-64) Metastasis associated protein MTA 2e-16
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 1e-10
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 1e-09
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 5e-08
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 9e-08
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 3e-07
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 2e-06
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 2e-06
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 2e-05
d2cqqa159 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 2e-05
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 2e-04
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 0.001
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: GARP response regulators
domain: Arr10-B
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 78.8 bits (194), Expect = 2e-19
 Identities = 21/64 (32%), Positives = 27/64 (42%), Gaps = 3/64 (4%)

Query: 89  SRERKKGVPWTEEEHRMFLLGLQKLGKGDWR--GIARNYVV-SRTPTQVASHAQKYFIRQ 145
           + ++K  V WT E H  FL  +  LG        I     V   T   VASH QK+ +  
Sbjct: 1   TAQKKPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVAL 60

Query: 146 SNVS 149
             VS
Sbjct: 61  KKVS 64
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query333
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 99.63
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.52
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.44
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 99.31
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.28
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.21
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.16
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.16
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.11
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.1
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.01
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 98.99
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 98.85
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 98.59
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 98.39
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.25
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 97.97
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 97.79
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 94.38
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 93.25
d1nc8a_29 HIV nucleocapsid {Human immunodeficiency virus typ 88.01
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 87.66
d2exfa142 HIV nucleocapsid {Human immunodeficiency virus typ 86.54
d2exfa142 HIV nucleocapsid {Human immunodeficiency virus typ 83.41
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: GARP response regulators
domain: Arr10-B
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.63  E-value=1.8e-16  Score=119.16  Aligned_cols=57  Identities=33%  Similarity=0.420  Sum_probs=49.0

Q ss_pred             CcCCCCCCCHHHHHHHHHHHHHcCCCCh--hhhhhhh-cCCCCHHHHHhHHHHHHHHHhh
Q 019948           91 ERKKGVPWTEEEHRMFLLGLQKLGKGDW--RGIARNY-VVSRTPTQVASHAQKYFIRQSN  147 (333)
Q Consensus        91 ~rkk~~~WTeEEH~~FL~GLekyGkGdW--k~IA~~~-V~TRTp~QV~SHAQKYF~r~~~  147 (333)
                      .||.+..||+|||++|+.||+.||.+.|  +.|.+.+ |+++|..||+||+||||+++.+
T Consensus         3 ~kk~R~~WT~elH~~Fv~Av~~lG~~~atpk~I~~~m~v~~lT~~qV~SHlQKYrl~l~k   62 (64)
T d1irza_           3 QKKPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVALKK   62 (64)
T ss_dssp             CCCSSCSSCHHHHHHHHHHHHHHCTTTCCHHHHHHHHCCTTCCHHHHHHHHHHHHHHHHS
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHhCccccchHHHHHHcCCCCCCHHHHHHHHHHHHHHHHh
Confidence            4566789999999999999999998555  6886533 8899999999999999999864
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nc8a_ g.40.1.1 (A:) HIV nucleocapsid {Human immunodeficiency virus type 2 [TaxId: 11709]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Back     information, alignment and structure
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Back     information, alignment and structure