Citrus Sinensis ID: 020014

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330--
MGKKKKNNNSNNENHNKENNNNNGNNEAEKKEEEEEGDAVAEKKKDDKKSSVTVILKVDMHCEGCANKIVRYARSFEGVEAVKAEVAANKITIVGAVDPSKIREKLDKKTKKKIDLISPQPKKDNKDKEPKQDNKPKDNKSPDDKKPKEPPVMTAVLKLGLHCQGCIEKILKIVSKTKGVMDKSIDKQKDTVTVKGTMDAKALAEVLKERLKRPVEIVPPKKEKEKEKNDEKESNGGDNNNSGGNGGSKKKKGGGGGGGGQEVGDGGGGGGGGKMEESRMEYFPMGVPGSGYGHGYQIHGGYEYGYPVGGYYHQPAAPQMFSDENPNACVVM
cccccccccccccccccccccccccccccccHHHHHcHHHHHcccccccccEEEEEEEEccHHHHHHHHHHHHHccccEEEEEEEccccEEEEEEEccHHHHHHHHHHHHcccEEEcccccccccccccccccccccccccccccccccccccEEEcccccccHHHHHHHHHHHHcccccEEEEccccccEEEEEEEccHHHHHHHHHHHccccEEEccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccHHHHHHHHHHHHcccccEEEEEEccccEEEEEEEccHHHHHHHHHHHccccEEEEccccccccccccccccccccccccccccccccccEEEEEEEEEEccHHHHHHHHHHHHHccccEEEEEcccccEEEEEEEccHHHHHHHHHHHHcccEEEEcccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccEcc
mgkkkknnnsnnenhnkennnnngnneaekkeeeeeGDAVAekkkddkksSVTVILKVDMHCEGCANKIVRYARSFEGVEAVKAEVAANKITivgavdpskirEKLDKKTKKkidlispqpkkdnkdkepkqdnkpkdnkspddkkpkeppvMTAVLKLGLHCQGCIEKILKIVSKTkgvmdksidkqkdtvtVKGTMDAKALAEVLKERLkrpveivppkkekekekndekesnggdnnnsggnggskkkkggggggggqevgdggggggggkmeesrmeyfpmgvpgsgyghgyqihggyeygypvggyyhqpaapqmfsdenpnacvvm
mgkkkknnnsnnenhnkennnnngnneaekkeeeeegdavaekkkddkkssVTVILKVDMHCEGCANKIVRYARSFEGVEAVKaevaankitivgavdpskirekldkktkkkidlispqpkkdnkdkepkqdnkpkdnkspddkkpkepPVMTAVLKLGLHCQGCIEKILKIVsktkgvmdksidkqkdtvtvkgtMDAKALAEVLkerlkrpveivppkkekekekndekesnggdnnnsggnggsKKKKGGGGGGGGQEVGDGGGGGGGGKMEESRMEYFPMGVPGSGYGHGYQIHGGYEYGYPVGGYYHQPAAPQMFSDENPNACVVM
MgkkkknnnsnnenhnkennnnngnneaekkeeeeegdavaekkkddkkssVTVILKVDMHCEGCANKIVRYARSFegveavkaevaaNKITIVGAVDPSKIREkldkktkkkidliSpqpkkdnkdkepkqdnkpkdnkspddkkpkeppVMTAVLKLGLHCQGCIEKILKIVSKTKGVMDKSIDKQKDTVTVKGTMDAKALAEVLKERLKRPVEIVPPkkekekekndekesnggdnnnsggnggskkkkggggggggqevgdggggggggkMEESRMEYFPMGVPgsgyghgyqihggyeygypvggyyHQPAAPQMFSDENPNACVVM
***************************************************VTVILKVDMHCEGCANKIVRYARSFEGVEAVKAEVAANKITIVGAVD******************************************************MTAVLKLGLHCQGCIEKILKIVSKTKGVM****************************************************************************************************YFPMGVPGSGYGHGYQIHGGYEYGYPVGGYYHQ******************
*****************************************************VILKVDMHCEGCANKIVRYARSFEGVEAVKAEVAANKITIVGAVDPSKIREKLDKKTKKKIDLISPQPKKDNKDKEPKQDNKPKDNKSPDDKKPKEPPVMTAVLKLGLHCQGCIEKILKIVSKTKGVMDKSIDKQKDTVTVKGTMDAKALAEVLKERLKRPVEI*******************************************************************MGVPGSGYGHGYQIHGGYEYGYPVGGYYHQPAAPQMFSDENPNACVVM
***********NENHNKENNNNN****************************VTVILKVDMHCEGCANKIVRYARSFEGVEAVKAEVAANKITIVGAVDPSKIREKLDKKTKKKIDLISPQ****************************EPPVMTAVLKLGLHCQGCIEKILKIVSKTKGVMDKSIDKQKDTVTVKGTMDAKALAEVLKERLKRPVEIVPP****************************************QEVGD*********MEESRMEYFPMGVPGSGYGHGYQIHGGYEYGYPVGGYYHQPAAPQMFSDENPNACVVM
************************************************KSSVTVILKVDMHCEGCANKIVRYARSFEGVEAVKAEVAANKITIVGAVDPSKIREKLDKKTKKKIDLISPQP***************************EPPVMTAVLKLGLHCQGCIEKILKIVSKTKGVMDKSIDKQKDTVTVKGTMDAKALAEVLKERLKRPVEIVPPK***************************************************GKMEESRMEYFPMGVPGSGYGHGYQIHGGYEYGYPVGGYYHQPAAPQMFSDENPNACVV*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKKKKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDDKKSSVTVILKVDMHCEGCANKIVRYARSFEGVEAVKAEVAANKITIVGAVDPSKIREKLDKKTKKKIDLISPQPKKDNKDKEPKQDNKPKDNKSPDDKKPKEPPVMTAVLKLGLHCQGCIEKILKIVSKTKGVMDKSIDKQKDTVTVKGTMDAKALAEVLKERLKRPVEIVPPKKEKEKEKNDEKESNGGDNNNSGGNGGSKKKKGGGGGGGGQEVGDGGGGGGGGKMEESRMEYFPMGVPGSGYGHGYQIHGGYEYGYPVGGYYHQPAAPQMFSDENPNACVVM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query332 2.2.26 [Sep-21-2011]
Q9SZN7153 Heavy metal-associated is no no 0.207 0.450 0.420 1e-07
>sp|Q9SZN7|HIP26_ARATH Heavy metal-associated isoprenylated plant protein 26 OS=Arabidopsis thaliana GN=HIPP26 PE=1 SV=1 Back     alignment and function desciption
 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 43/69 (62%)

Query: 53  TVILKVDMHCEGCANKIVRYARSFEGVEAVKAEVAANKITIVGAVDPSKIREKLDKKTKK 112
           TV +KV M CEGC  K+ R     +GV +V  E  A+K+T+VG VDP+K+  ++  +T K
Sbjct: 27  TVEIKVKMDCEGCERKVRRSVEGMKGVSSVTLEPKAHKVTVVGYVDPNKVVARMSHRTGK 86

Query: 113 KIDLISPQP 121
           K++L    P
Sbjct: 87  KVELWPYVP 95
Heavy-metal-binding protein. Binds lead, cadmium and copper. May be involved in heavy-metal transport.
Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query332
118488613313 unknown [Populus trichocarpa] 0.840 0.891 0.518 3e-63
224118406343 predicted protein [Populus trichocarpa] 0.888 0.860 0.502 9e-63
118487366344 unknown [Populus trichocarpa] 0.891 0.860 0.488 2e-62
225436508313 PREDICTED: uncharacterized protein LOC10 0.909 0.964 0.487 5e-57
224106826285 predicted protein [Populus trichocarpa] 0.789 0.919 0.489 4e-55
356544663 639 PREDICTED: uncharacterized protein LOC10 0.807 0.419 0.461 3e-53
255565413358 metal ion binding protein, putative [Ric 0.807 0.748 0.467 7e-52
358348017336 hypothetical protein MTR_117s0012 [Medic 0.810 0.800 0.535 4e-49
449456040267 PREDICTED: uncharacterized protein LOC10 0.780 0.970 0.461 5e-49
297797021284 hypothetical protein ARALYDRAFT_496228 [ 0.822 0.961 0.511 9e-49
>gi|118488613|gb|ABK96119.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  248 bits (632), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 167/322 (51%), Positives = 203/322 (63%), Gaps = 43/322 (13%)

Query: 42  EKKKDDKKSSVTVILKVDMHCEGCANKIVRYARSFEGVEAVKAEVAANKITIVGAVDPSK 101
           EKK+++K   + V+LKV+MHCEGC + I+++AR+FEGVE+V+AE ++NK+T++G VDP K
Sbjct: 4   EKKQENK--PIPVVLKVEMHCEGCVSTILKHARAFEGVESVEAEASSNKLTVIGKVDPLK 61

Query: 102 IREKLDKKTKKKIDLISPQPKKDNK---DKEPKQDNKPKDNKSPDDKKPKEPPVMTAVLK 158
           IR+ L  KTKKK++LISPQP+K +    +K  K+D K  D K   D KPKE PV+TAVLK
Sbjct: 62  IRDYLHYKTKKKVELISPQPQKQDTTTANKNNKEDKKSNDKKPDSDAKPKEAPVITAVLK 121

Query: 159 LGLHCQGCIEKILKIVSKTKGVMDKSIDKQKDTVTVKGTMDAKALAEVLKERLKRPVEIV 218
           LGLHCQGCIEKI KIVSKTKGV +  IDKQK+ VTVKGTMD KAL E LK RLKRPV+IV
Sbjct: 122 LGLHCQGCIEKIEKIVSKTKGVHETVIDKQKELVTVKGTMDVKALTETLKSRLKRPVDIV 181

Query: 219 PPKKEKEKEKNDEKESNGGDNNNSGGNGGSKKKKGGGGGGGGQEVGDGGGGGGGGKMEES 278
           PPKKEKE  K+ E        N +GG GG KK  GG GG  G   G         KMEE+
Sbjct: 182 PPKKEKEGGKDGE--------NVAGGGGGKKKGGGGNGGQDGGGGGGAAAAAPAAKMEEN 233

Query: 279 RMEYFPMGVPGSGYGHGY-------------QIHGGYEYGYPVGGYYHQPAAPQM----- 320
           RMEY  M  PG G G+GY              IHG    G+PV   Y             
Sbjct: 234 RMEY--MVQPGFGSGYGYVGQPLHGNGYVVQPIHGNGYVGHPVYAPYGPGYGYGYGYGHG 291

Query: 321 ----------FSDENPNACVVM 332
                     F+DENPNAC +M
Sbjct: 292 PVQGYPDHLRFNDENPNACSIM 313

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224118406|ref|XP_002331474.1| predicted protein [Populus trichocarpa] gi|222873552|gb|EEF10683.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|118487366|gb|ABK95511.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225436508|ref|XP_002276537.1| PREDICTED: uncharacterized protein LOC100261829 [Vitis vinifera] gi|297734927|emb|CBI17161.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224106826|ref|XP_002314298.1| predicted protein [Populus trichocarpa] gi|222850706|gb|EEE88253.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356544663|ref|XP_003540767.1| PREDICTED: uncharacterized protein LOC100797817 [Glycine max] Back     alignment and taxonomy information
>gi|255565413|ref|XP_002523697.1| metal ion binding protein, putative [Ricinus communis] gi|223537001|gb|EEF38637.1| metal ion binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|358348017|ref|XP_003638046.1| hypothetical protein MTR_117s0012 [Medicago truncatula] gi|355503981|gb|AES85184.1| hypothetical protein MTR_117s0012 [Medicago truncatula] Back     alignment and taxonomy information
>gi|449456040|ref|XP_004145758.1| PREDICTED: uncharacterized protein LOC101219496 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297797021|ref|XP_002866395.1| hypothetical protein ARALYDRAFT_496228 [Arabidopsis lyrata subsp. lyrata] gi|297312230|gb|EFH42654.1| hypothetical protein ARALYDRAFT_496228 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query332
TAIR|locus:2142614392 AT5G03380 [Arabidopsis thalian 0.198 0.168 0.560 2.5e-30
TAIR|locus:2057951386 AT2G36950 [Arabidopsis thalian 0.189 0.163 0.578 9.6e-30
TAIR|locus:2046183245 AT2G28090 [Arabidopsis thalian 0.204 0.277 0.529 5.6e-25
TAIR|locus:2075497246 AT3G02960 "AT3G02960" [Arabido 0.201 0.272 0.358 2.1e-22
TAIR|locus:2167366355 FP3 "farnesylated protein 3" [ 0.207 0.194 0.347 1e-19
TAIR|locus:2153969319 AT5G24580 "AT5G24580" [Arabido 0.195 0.203 0.338 5.5e-13
TAIR|locus:2163300290 AT5G50740 [Arabidopsis thalian 0.195 0.224 0.348 2.5e-09
TAIR|locus:2018768287 AT1G29000 [Arabidopsis thalian 0.207 0.240 0.304 1.4e-11
TAIR|locus:2133544150 AT4G08570 "AT4G08570" [Arabido 0.201 0.446 0.347 1.2e-10
TAIR|locus:2082425 473 AT3G06130 [Arabidopsis thalian 0.168 0.118 0.410 1.4e-09
TAIR|locus:2142614 AT5G03380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 180 (68.4 bits), Expect = 2.5e-30, Sum P(3) = 2.5e-30
 Identities = 37/66 (56%), Positives = 44/66 (66%)

Query:   154 TAVLKLGLHCQGCIEKILKIVSKTKGVMDKSIDKQKDTVTVKGTMDAKALAEVLKERLKR 213
             T VLK  LHC+GC  KI +IV+K KGV   +ID  KD V VKG +D K L   L E+LKR
Sbjct:   155 TVVLKTKLHCEGCEHKIKRIVNKIKGVNSVAIDSAKDLVIVKGIIDVKQLTPYLNEKLKR 214

Query:   214 PVEIVP 219
              VE+VP
Sbjct:   215 TVEVVP 220
GO:0005886 "plasma membrane" evidence=ISM
GO:0030001 "metal ion transport" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA;ISS
GO:0010200 "response to chitin" evidence=RCA
TAIR|locus:2057951 AT2G36950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046183 AT2G28090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075497 AT3G02960 "AT3G02960" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167366 FP3 "farnesylated protein 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153969 AT5G24580 "AT5G24580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163300 AT5G50740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018768 AT1G29000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133544 AT4G08570 "AT4G08570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082425 AT3G06130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.163.16.1
SubName- Full=Putative uncharacterized protein; (290 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query332
pfam0040362 pfam00403, HMA, Heavy-metal-associated domain 5e-08
pfam0040362 pfam00403, HMA, Heavy-metal-associated domain 4e-06
cd0037163 cd00371, HMA, Heavy-metal-associated domain (HMA) 3e-05
cd0037163 cd00371, HMA, Heavy-metal-associated domain (HMA) 2e-04
pfam0717291 pfam07172, GRP, Glycine rich protein family 0.001
PTZ00146 293 PTZ00146, PTZ00146, fibrillarin; Provisional 0.002
PTZ00146 293 PTZ00146, PTZ00146, fibrillarin; Provisional 0.004
PLN02957238 PLN02957, PLN02957, copper, zinc superoxide dismut 0.004
>gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain Back     alignment and domain information 
 Score = 48.8 bits (117), Expect = 5e-08
 Identities = 16/60 (26%), Positives = 26/60 (43%)

Query: 54  VILKVDMHCEGCANKIVRYARSFEGVEAVKAEVAANKITIVGAVDPSKIREKLDKKTKKK 113
            +    M C GCA K+ +      GV +V  ++   K+T+ G  DP K+ +      K  
Sbjct: 1   TLRVPGMTCAGCAKKVEKALSKLPGVSSVSVDLETGKVTVTGDPDPLKLEKLKKAIEKAG 60

Length = 62
>gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain Back     alignment and domain information
>gnl|CDD|238219 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones Back     alignment and domain information
>gnl|CDD|238219 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones Back     alignment and domain information
>gnl|CDD|219320 pfam07172, GRP, Glycine rich protein family Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|215516 PLN02957, PLN02957, copper, zinc superoxide dismutase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 332
PRK10671 834 copA copper exporting ATPase; Provisional 99.35
PF0040362 HMA: Heavy-metal-associated domain; InterPro: IPR0 99.23
KOG0207 951 consensus Cation transport ATPase [Inorganic ion t 99.17
KOG160373 consensus Copper chaperone [Inorganic ion transpor 99.09
PF0040362 HMA: Heavy-metal-associated domain; InterPro: IPR0 99.09
KOG0207 951 consensus Cation transport ATPase [Inorganic ion t 99.01
KOG160373 consensus Copper chaperone [Inorganic ion transpor 98.95
COG260871 CopZ Copper chaperone [Inorganic ion transport and 98.93
COG260871 CopZ Copper chaperone [Inorganic ion transport and 98.88
KOG4656247 consensus Copper chaperone for superoxide dismutas 98.56
KOG4656247 consensus Copper chaperone for superoxide dismutas 98.51
PLN02957238 copper, zinc superoxide dismutase 97.94
PRK10671 834 copA copper exporting ATPase; Provisional 97.76
PLN02957238 copper, zinc superoxide dismutase 97.63
COG2217 713 ZntA Cation transport ATPase [Inorganic ion transp 97.52
TIGR0000368 copper ion binding protein. This model describes a 97.28
COG2217 713 ZntA Cation transport ATPase [Inorganic ion transp 96.95
TIGR0000368 copper ion binding protein. This model describes a 96.61
PRK11033 741 zntA zinc/cadmium/mercury/lead-transporting ATPase 95.56
PRK11033 741 zntA zinc/cadmium/mercury/lead-transporting ATPase 94.51
TIGR0205292 MerP mercuric transport protein periplasmic compon 88.64
cd0037163 HMA Heavy-metal-associated domain (HMA) is a conse 83.28
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information 
Probab=99.35  E-value=1.8e-11  Score=131.91  Aligned_cols=160  Identities=16%  Similarity=0.338  Sum_probs=115.8

Q ss_pred             eEEEEEEe-ecChhHHHHHHHHHhcCCCccEEEEeccCceEEEeeecCchhhHhhhhhcccccccccCCCCCCCCCCCCC
Q 020014           52 VTVILKVD-MHCEGCANKIVRYARSFEGVEAVKAEVAANKITIVGAVDPSKIREKLDKKTKKKIDLISPQPKKDNKDKEP  130 (332)
Q Consensus        52 ~~v~lkV~-M~C~~Ca~kIe~aL~~l~GV~~V~vd~~s~kvtV~g~~dp~~l~~~i~~k~G~~velis~~p~~~~~~~e~  130 (332)
                      ++++|.|. |+|++|+.+|+++|++++||..+.+++.  +++|.+..++..+...++ .+||.+.+.++...........
T Consensus         3 ~~~~l~V~gmtC~~C~~~i~~al~~~~gv~~v~v~~~--~~~v~~~~~~~~i~~~i~-~~Gy~~~~~~~~~~~~~~~~~~   79 (834)
T PRK10671          3 QTIDLTLDGLSCGHCVKRVKESLEQRPDVEQADVSIT--EAHVTGTASAEALIETIK-QAGYDASVSHPKAKPLTESSIP   79 (834)
T ss_pred             eEEEEEECCcccHHHHHHHHHHHhcCCCcceEEEeee--EEEEEecCCHHHHHHHHH-hcCCcccccccccccccccccC
Confidence            56899998 9999999999999999999999999994  556666678889999999 9999988754211100000000


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCceeEEEee-cccchhhHHHHHHHHhcCCCceeEEeecCCCEEEEEecCCHHHHHHHHHH
Q 020014          131 KQDNKPKDNKSPDDKKPKEPPVMTAVLKL-GLHCQGCIEKILKIVSKTKGVMDKSIDKQKDTVTVKGTMDAKALAEVLKE  209 (332)
Q Consensus       131 ~~~~kk~~~~~~~~~k~~~~~~~~~~lkV-gm~C~~Ca~kIek~L~kl~GV~sv~vd~~~~~vtV~g~~d~~~L~~~L~k  209 (332)
                      .+.........+..   ......++.|.| +|+|..|+..|++.|..++||.++.+++.++++.|.+..++..+...+. 
T Consensus        80 ~~~~~~~~~~~~~~---~~~~~~~~~l~V~Gm~Ca~Ca~~Ie~~L~~~~GV~~a~vnl~t~~~~V~~~~s~~~I~~~I~-  155 (834)
T PRK10671         80 SEALTAASEELPAA---TADDDDSQQLLLSGMSCASCVSRVQNALQSVPGVTQARVNLAERTALVMGSASPQDLVQAVE-  155 (834)
T ss_pred             chhhhhhhhhcccc---ccCcCceEEEEeCCcCcHHHHHHHHHHHhcCCCceeeeeecCCCeEEEEccCCHHHHHHHHH-
Confidence            00000000000000   001123567889 9999999999999999999999999999999988876678888888888 


Q ss_pred             cCCCceEEc
Q 020014          210 RLKRPVEIV  218 (332)
Q Consensus       210 k~G~~a~vv  218 (332)
                      .+||.+.+.
T Consensus       156 ~~Gy~a~~~  164 (834)
T PRK10671        156 KAGYGAEAI  164 (834)
T ss_pred             hcCCCcccc
Confidence            799886543

>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00003 copper ion binding protein Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00003 copper ion binding protein Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>TIGR02052 MerP mercuric transport protein periplasmic component Back     alignment and domain information
>cd00371 HMA Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query332
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 99.79
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 99.75
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 99.71
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 99.36
4a4j_A69 Pacszia, cation-transporting ATPase PACS; hydrolas 99.25
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 99.2
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 99.17
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 99.16
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 99.15
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 99.08
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 99.07
4a4j_A69 Pacszia, cation-transporting ATPase PACS; hydrolas 99.07
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 99.07
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 99.04
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 99.02
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 99.02
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 99.01
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 98.97
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 98.96
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 98.95
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 98.94
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 98.94
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 98.93
2l3m_A71 Copper-ION-binding protein; structural genomics, c 98.93
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 98.92
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 98.91
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 98.91
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 98.9
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 98.9
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 98.89
1mwy_A73 ZNTA; open-faced beta-sandwich fold, beta-alpha-be 98.87
2kyz_A67 Heavy metal binding protein; structural genomics, 98.87
1yg0_A66 COP associated protein; open-faced beta-sandwich, 98.86
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 98.86
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 98.85
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 98.83
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 98.83
1opz_A76 Potential copper-transporting ATPase; mutation, fo 98.82
2l3m_A71 Copper-ION-binding protein; structural genomics, c 98.8
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 98.8
2kkh_A95 Putative heavy metal transporter; zinc transport, 98.8
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 98.79
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 98.77
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 98.77
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 98.76
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 98.76
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 98.75
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 98.75
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 98.74
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 98.71
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 98.7
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 98.7
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 98.69
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 98.68
1mwy_A73 ZNTA; open-faced beta-sandwich fold, beta-alpha-be 98.68
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 98.67
2kyz_A67 Heavy metal binding protein; structural genomics, 98.65
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 98.65
1opz_A76 Potential copper-transporting ATPase; mutation, fo 98.64
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 98.64
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 98.63
2kkh_A95 Putative heavy metal transporter; zinc transport, 98.63
1yg0_A66 COP associated protein; open-faced beta-sandwich, 98.6
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 98.6
2aj0_A71 Probable cadmium-transporting ATPase; ferrodoxin-l 98.58
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 98.57
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 98.57
1jk9_B249 CCS, copper chaperone for superoxide dismutase; pr 98.56
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 98.52
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 98.5
2aj0_A71 Probable cadmium-transporting ATPase; ferrodoxin-l 98.43
1jk9_B249 CCS, copper chaperone for superoxide dismutase; pr 98.43
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 98.4
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 98.3
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 97.95
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 97.7
1nwa_A203 Peptide methionine sulfoxide reductase MSRA; oxido 90.51
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
Probab=99.79  E-value=1.7e-18  Score=144.59  Aligned_cols=138  Identities=17%  Similarity=0.330  Sum_probs=115.8

Q ss_pred             ceEEEEEEe-ecChhHHHHHHHHHhcCCCccEEEEeccCceEEEeee---cCchhhHhhhhhcccccccccCCCCCCCCC
Q 020014           51 SVTVILKVD-MHCEGCANKIVRYARSFEGVEAVKAEVAANKITIVGA---VDPSKIREKLDKKTKKKIDLISPQPKKDNK  126 (332)
Q Consensus        51 ~~~v~lkV~-M~C~~Ca~kIe~aL~~l~GV~~V~vd~~s~kvtV~g~---~dp~~l~~~i~~k~G~~velis~~p~~~~~  126 (332)
                      +.++.|.|. |+|++|+.+|+++|..++||..+.+++.+++++|...   +++..|..+|+ .+||.+.++....     
T Consensus         3 ~~~~~~~v~gm~C~~C~~~ie~~l~~~~gv~~~~v~~~~~~~~v~~~~~~~~~~~i~~~i~-~~G~~~~~~~~~~-----   76 (149)
T 2ew9_A            3 PQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQ-DLGFEAAVMEDYA-----   76 (149)
T ss_dssp             CEEEEEEEECCCSSSHHHHHHHHHHTTSSCCCEEEETTTTEEEEEECTTTCCHHHHHHHHH-HHTCEEEECSCSC-----
T ss_pred             cEEEEEEECCeecHHHHHHHHHHHhcCCCcEEEEEEecCCEEEEEEcCCCCCHHHHHHHHh-cCCCceEeecccc-----
Confidence            567889998 9999999999999999999999999999999999752   45567888888 7888765432100     


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCceeEEEee-cccchhhHHHHHHHHhcCCCceeEEeecCCCEEEEEec---CCHHH
Q 020014          127 DKEPKQDNKPKDNKSPDDKKPKEPPVMTAVLKL-GLHCQGCIEKILKIVSKTKGVMDKSIDKQKDTVTVKGT---MDAKA  202 (332)
Q Consensus       127 ~~e~~~~~kk~~~~~~~~~k~~~~~~~~~~lkV-gm~C~~Ca~kIek~L~kl~GV~sv~vd~~~~~vtV~g~---~d~~~  202 (332)
                                             ....++.|.| ||+|++|+.+|+++|.+++||.++.+|+.+++++|...   ++++.
T Consensus        77 -----------------------~~~~~~~~~v~gm~C~~C~~~ie~~l~~~~gv~~~~v~~~~~~~~v~~~~~~~~~~~  133 (149)
T 2ew9_A           77 -----------------------GSDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEIIGPRD  133 (149)
T ss_dssp             -----------------------CSSSEEEEEEESCCSHHHHHHHHHHHHHSSSCCEEEEETTTTEEEEECCTTTSCHHH
T ss_pred             -----------------------cccceeEEEEEeccCHHHHHHHHHHHhcCCCeEEEEEEcCCCEEEEEECCCCCCHHH
Confidence                                   0123457999 99999999999999999999999999999999999743   67899


Q ss_pred             HHHHHHHcCCCceEEc
Q 020014          203 LAEVLKERLKRPVEIV  218 (332)
Q Consensus       203 L~~~L~kk~G~~a~vv  218 (332)
                      |+..|. ++||.+.++
T Consensus       134 i~~~i~-~~Gy~~~~~  148 (149)
T 2ew9_A          134 IIKIIE-EIGFHASLA  148 (149)
T ss_dssp             HHHHHH-HHTCEEECC
T ss_pred             HHHHHH-hCCCceEec
Confidence            999999 899987654
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Back     alignment and structure
>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A Back     alignment and structure
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Back     alignment and structure
>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Back     alignment and structure
>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Back     alignment and structure
>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Back     alignment and structure
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Back     alignment and structure
>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1nwa_A Peptide methionine sulfoxide reductase MSRA; oxidoreductase, product complex, structural genomics, PSI, protein structure initiative; 1.50A {Mycobacterium tuberculosis} SCOP: d.58.28.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 332
d1qupa272 d.58.17.1 (A:2-73) Copper chaperone for superoxide 6e-10
d1qupa272 d.58.17.1 (A:2-73) Copper chaperone for superoxide 5e-08
d1cc8a_72 d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX 1e-08
d1cc8a_72 d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX 4e-06
d1osda_72 d.58.17.1 (A:) Mercuric ion binding protein MerP { 4e-08
d1osda_72 d.58.17.1 (A:) Mercuric ion binding protein MerP { 7e-05
d1fe0a_66 d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX 5e-08
d1fe0a_66 d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX 4e-05
d1sb6a_64 d.58.17.1 (A:) Copper chaperone {Synechocystis sp. 7e-08
d1sb6a_64 d.58.17.1 (A:) Copper chaperone {Synechocystis sp. 5e-07
d2aw0a_72 d.58.17.1 (A:) Menkes copper-transporting ATPase { 2e-07
d2aw0a_72 d.58.17.1 (A:) Menkes copper-transporting ATPase { 2e-04
d2ggpb172 d.58.17.1 (B:1-72) Copper transporter domain ccc2a 2e-07
d2ggpb172 d.58.17.1 (B:1-72) Copper transporter domain ccc2a 5e-05
d1kvja_79 d.58.17.1 (A:) Menkes copper-transporting ATPase { 5e-07
d1kvja_79 d.58.17.1 (A:) Menkes copper-transporting ATPase { 0.002
d1p6ta172 d.58.17.1 (A:1-72) Potential copper-translocating 8e-07
d1p6ta172 d.58.17.1 (A:1-72) Potential copper-translocating 5e-04
d1cpza_68 d.58.17.1 (A:) Copper chaperone {Enterococcus hira 1e-06
d1cpza_68 d.58.17.1 (A:) Copper chaperone {Enterococcus hira 7e-04
d2qifa169 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt 2e-06
d2qifa169 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt 8e-04
d1p6ta279 d.58.17.1 (A:73-151) Potential copper-translocatin 4e-06
d1p6ta279 d.58.17.1 (A:73-151) Potential copper-translocatin 0.003
d1mwza_73 d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, 7e-06
d1mwza_73 d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, 0.002
d1q8la_84 d.58.17.1 (A:) Menkes copper-transporting ATPase { 0.001
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: Copper chaperone for superoxide dismutase, N-terminal domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 52.9 bits (127), Expect = 6e-10
 Identities = 13/58 (22%), Positives = 26/58 (44%)

Query: 51  SVTVILKVDMHCEGCANKIVRYARSFEGVEAVKAEVAANKITIVGAVDPSKIREKLDK 108
           +      + MHCE C N I    ++  G+ ++  ++    +++  +V PS I   L  
Sbjct: 5   TYEATYAIPMHCENCVNDIKACLKNVPGINSLNFDIEQQIMSVESSVAPSTIINTLRN 62
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72 Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72 Back     information, alignment and structure
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Length = 66 Back     information, alignment and structure
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Length = 66 Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Length = 64 Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Length = 64 Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72 Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72 Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Length = 68 Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Length = 68 Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69 Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69 Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 79 Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 79 Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 73 Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 73 Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query332
d1cc8a_72 ATX1 metallochaperone protein (ATOX1) {Baker's yea 99.51
d1qupa272 Copper chaperone for superoxide dismutase, N-termi 99.49
d1fe0a_66 ATX1 metallochaperone protein (ATOX1) {Human (Homo 99.49
d1cc8a_72 ATX1 metallochaperone protein (ATOX1) {Baker's yea 99.43
d1fe0a_66 ATX1 metallochaperone protein (ATOX1) {Human (Homo 99.4
d1qupa272 Copper chaperone for superoxide dismutase, N-termi 99.4
d1sb6a_64 Copper chaperone {Synechocystis sp. pcc 6803, Scat 99.39
d2ggpb172 Copper transporter domain ccc2a {Baker's yeast (Sa 99.38
d1cpza_68 Copper chaperone {Enterococcus hirae [TaxId: 1354] 99.36
d1osda_72 Mercuric ion binding protein MerP {Ralstonia metal 99.34
d2aw0a_72 Menkes copper-transporting ATPase {Human (Homo sap 99.33
d1kvja_79 Menkes copper-transporting ATPase {Human (Homo sap 99.32
d2qifa169 Copper chaperone {Bacillus subtilis, CopZ [TaxId: 99.3
d1q8la_84 Menkes copper-transporting ATPase {Human (Homo sap 99.3
d1p6ta279 Potential copper-translocating P-type ATPase CopA 99.27
d1p6ta172 Potential copper-translocating P-type ATPase CopA 99.26
d1sb6a_64 Copper chaperone {Synechocystis sp. pcc 6803, Scat 99.24
d1mwza_73 Metal ion-transporting ATPase ZntA, N-terminal dom 99.24
d2ggpb172 Copper transporter domain ccc2a {Baker's yeast (Sa 99.2
d1osda_72 Mercuric ion binding protein MerP {Ralstonia metal 99.2
d1cpza_68 Copper chaperone {Enterococcus hirae [TaxId: 1354] 99.19
d2aw0a_72 Menkes copper-transporting ATPase {Human (Homo sap 99.19
d2qifa169 Copper chaperone {Bacillus subtilis, CopZ [TaxId: 99.18
d1kvja_79 Menkes copper-transporting ATPase {Human (Homo sap 99.17
d1p6ta172 Potential copper-translocating P-type ATPase CopA 99.13
d1q8la_84 Menkes copper-transporting ATPase {Human (Homo sap 99.1
d1p6ta279 Potential copper-translocating P-type ATPase CopA 99.08
d1mwza_73 Metal ion-transporting ATPase ZntA, N-terminal dom 99.05
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: ATX1 metallochaperone protein (ATOX1)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.51  E-value=3.5e-14  Score=105.27  Aligned_cols=65  Identities=22%  Similarity=0.343  Sum_probs=61.6

Q ss_pred             CceeEEEeecccchhhHHHHHHHHhcC-CCceeEEeecCCCEEEEEecCCHHHHHHHHHHcCCCceE
Q 020014          151 PVMTAVLKLGLHCQGCIEKILKIVSKT-KGVMDKSIDKQKDTVTVKGTMDAKALAEVLKERLKRPVE  216 (332)
Q Consensus       151 ~~~~~~lkVgm~C~~Ca~kIek~L~kl-~GV~sv~vd~~~~~vtV~g~~d~~~L~~~L~kk~G~~a~  216 (332)
                      ++.++.|+|+|+|.+|+.+|+++|.++ +||.++.+|+.+++|+|.+.++++.|++.|+ ++||.|.
T Consensus         2 ~~kt~~f~V~MtC~~C~~~Ie~~L~~l~~gV~~v~v~~~~~~v~V~~~~~~~~i~~~i~-~~G~~~~   67 (72)
T d1cc8a_           2 EIKHYQFNVVMTCSGCSGAVNKVLTKLEPDVSKIDISLEKQLVDVYTTLPYDFILEKIK-KTGKEVR   67 (72)
T ss_dssp             CCEEEEEEECCCSHHHHHHHHHHHHTTTTSEEEEEEETTTTEEEEEESSCHHHHHHHHH-TTSSCEE
T ss_pred             CcEEEEEEECcCcHHHHHHHHHHHHcCcCceEEEEEECCCCEEEEeecCCHHHHHHHHH-HHCCccC
Confidence            467889999999999999999999999 5999999999999999999999999999999 9999886
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Back     information, alignment and structure
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Back     information, alignment and structure
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure