Citrus Sinensis ID: 020210

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33
MALEAVVYPKPQDPFGYSCNKDIYSSPGEGGGAWGYDFCFQQEDRTLLGIIDANIIEQGLHANWDSSSSPTIMQHANESWGPNSSPDAYAADQTLSAGSFSPAAAATTGGRRKRRRTKSSKNKEEIENQRMTHIAVERNRRKQMNEYLAILRSLMPPSYVQRGDQASVIGGSINFVKELEQLLQSMEAQKRNTSQLLKAGDNGVSSPFANFFTFPQYSTRSSQSNNLAPDHESSMTENVADIEVNMAESHANIKILTKKRPRQLLKMVASFQNLRLSVLHLNVSTVDQMVLYSVSVKVEEGSQLNTVDEIAAAVHQILLEIEEEATAFS
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccEEEEEEccEEEEEEEccccccHHHHHHHHHHHcccEEEEEEEEEEccEEEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHccc
cccEEEEEcccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHccccccccEEEEEEEcccEEEEEEcccccHHHHHHHHHHHHcccEEEEEEEEEcccEEEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHcc
maleavvypkpqdpfgyscnkdiysspgegggawgydfcfqqedRTLLGIIDANIIeqglhanwdssssptimqhaneswgpnsspdayaadqtlsagsfspaaaattggrrkrrrtkssknKEEIENQRMTHIAVERNRRKQMNEYLAILRslmppsyvqrgdqasvigGSINFVKELEQLLQSMEAQKRNTSQLlkagdngvsspfanfftfpqystrssqsnnlapdhessmtenVADIEVNMAESHANIKILTKKRPRQLLKMVASFQNLRLSVLHLNVSTVDQMVLYSVSVKveegsqlntVDEIAAAVHQILLEIEEEATAFS
maleavvypkpqdpfgysCNKDIYSSPGEGGGAWGYDFCFQQEDRTLLGIIDANIIEQGLHANWDSSSSPTIMQHANESWGPNSSPDAYAADQTlsagsfspaaaattggrrkrrrtkssknkeeienqrmthiavernRRKQMNEYLAILRSLMPPSYVQRGDQASVIGGSINFVKELEQLLQSMEAQKRNTSQLLKAGDNGVSSPFANFFTFPQYSTRSSQSNNLAPDHESSMTENVADIEVNMAESHANIKILTKKRPRQLLKMVASFQNLRLSVLHLNVSTVDQMVLYSVSVKVEEGSQLNTVDEIAAAVHQILLEIEEEATAFS
MALEAVVYPKPQDPFGYSCNKDIYSSPGEGGGAWGYDFCFQQEDRTLLGIIDANIIEQGLHANWDSSSSPTIMQHANESWGPNSSPDAYAADQTLSAGSFSPaaaattggrrkrrrtksskNKEEIENQRMTHIAVERNRRKQMNEYLAILRSLMPPSYVQRGDQASVIGGSINFVKELEQLLQSMEAQKRNTSQLLKAGDNGVSSPFANFFTFPQYSTRSSQSNNLAPDHESSMTENVADIEVNMAESHANIKILTKKRPRQLLKMVASFQNLRLSVLHLNVSTVDQMVLYSVSVKVEEGSQLNTVDEIAAAVHQILLEIEEEATAFS
*************PFGYSCNKDIYSSPGEGGGAWGYDFCFQQEDRTLLGIIDANIIEQGLHANW********************************************************************************NEYLAILRSLMPPSYVQRGDQASVIGGSINFVKELEQ**************************FANFFTF***********************************HANIKILTKKRPRQLLKMVASFQNLRLSVLHLNVSTVDQMVLYSVSVKVEEGSQLNTVDEIAAAVHQILLEI********
MALEAVVYPKPQDPFGYSCNKDIYSSPGEGGGAWGYDFCFQQ***************************************************************************************************K*MNEYLAILRSLMPPSYVQRGDQASVIGGSINFVKELE************************************************************DIEVNMAESHANIKILTKKRPRQLLKMVASFQNLRLSVLHLNVSTVDQMVLYSVSVKVEEGSQLNTVDEIAAAVHQILLEIEEE*****
MALEAVVYPKPQDPFGYSCNKDIYSSPGEGGGAWGYDFCFQQEDRTLLGIIDANIIEQGLHANWDSSSSPTIMQHANESWGPNSSPDAYAADQTLSAGSFSP************************ENQRMTHIAVERNRRKQMNEYLAILRSLMPPSYVQRGDQASVIGGSINFVKELEQLLQSMEAQKRNTSQLLKAGDNGVSSPFANFFTFPQYS*****************TENVADIEVNMAESHANIKILTKKRPRQLLKMVASFQNLRLSVLHLNVSTVDQMVLYSVSVKVEEGSQLNTVDEIAAAVHQILLEIEEEATAFS
*ALEAVVYPKPQDPFGYSCNKDIYSSPGEGGGAWGYDFCFQQEDRTLLGIIDANIIEQGLHANWDSSSSPTIMQHANESWG**********************************************NQRMTHIAVERNRRKQMNEYLAILRSLMPPSYVQRGDQASVIGGSINFVKELEQLLQSMEAQKR*********************************************ENVADIEVNMAESHANIKILTKKRPRQLLKMVASFQNLRLSVLHLNVSTVDQMVLYSVSVKVEEGSQLNTVDEIAAAVHQILLEIEEEA****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALEAVVYPKPQDPFGYSCNKDIYSSPGEGGGAWGYDFCFQQEDRTLLGIIDANIIEQGLHANWDSSSSPTIMQHANESWGPNSSPDAYAADQTLSAGSFSPAAAATTGGRRKRRRTKSSKNKEEIENQRMTHIAVERNRRKQMNEYLAILRSLMPPSYVQRGDQASVIGGSINFxxxxxxxxxxxxxxxxxxxxxxxxGDNGVSSPFANFFTFPQYSTRSSQSNNLAPDHESSMTENVADIEVNMAESHANIKILTKKRPRQLLKMVASFQNLRLSVLHLNVSTVDQMVLYSVSVKVEEGSQLNTVDEIAAAVHQILLEIEEEATAFS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query329 2.2.26 [Sep-21-2011]
Q9C7T4320 Transcription factor bHLH yes no 0.914 0.940 0.521 9e-76
Q9SK91304 Transcription factor bHLH no no 0.878 0.950 0.488 2e-70
Q9M128315 Transcription factor bHLH no no 0.610 0.638 0.473 1e-45
Q56YJ8414 Transcription factor FAMA no no 0.617 0.490 0.454 2e-45
Q9FKQ6296 Transcription factor bHLH no no 0.607 0.675 0.485 2e-43
Q56XR0327 Transcription factor bHLH no no 0.604 0.608 0.465 9e-42
O81037371 Transcription factor bHLH no no 0.562 0.498 0.464 7e-39
Q700E4358 Transcription factor bHLH no no 0.553 0.508 0.441 2e-38
Q9M8K6202 Transcription factor MUTE no no 0.486 0.792 0.364 3e-26
Q700C7364 Transcription factor SPEE no no 0.325 0.293 0.395 1e-20
>sp|Q9C7T4|BH096_ARATH Transcription factor bHLH96 OS=Arabidopsis thaliana GN=BHLH96 PE=2 SV=1 Back     alignment and function desciption
 Score =  283 bits (725), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 179/343 (52%), Positives = 219/343 (63%), Gaps = 42/343 (12%)

Query: 1   MALEAVVYPKPQDPFGYSCNKDIYSSPGEGGGAWGYDFCFQQEDRTLLGIIDANI-IEQG 59
           MALEAVVYP  QDPF Y   KD             YD  FQ+E+         NI + QG
Sbjct: 1   MALEAVVYP--QDPFSYISCKDF----------PFYDLYFQEEEDQDPQDTKNNIKLGQG 48

Query: 60  LHANWDSS---------SSPTIMQHANESWGPNSSPDAYAADQTLSAGSFSPAAAATTGG 110
               + S+         S        +  W P   P   A D   +     P+  A  GG
Sbjct: 49  QGHGFASNNYNGRTGDYSDDYNYNEEDLQW-PRDLPYGSAVD---TESQPPPSDVAAGGG 104

Query: 111 RRKRRRTKSSKNKEEIENQRMTHIAVERNRRKQMNEYLAILRSLMPPSYVQRGDQASVIG 170
           RRKRRRT+SSKNKEEIENQRMTHIAVERNRRKQMNEYLA+LRSLMPP Y QRGDQAS++G
Sbjct: 105 RRKRRRTRSSKNKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPPYYAQRGDQASIVG 164

Query: 171 GSINFVKELEQLLQSMEAQKRNTSQLLKAGDNGV-------SSPFANFFTFPQYSTRSSQ 223
           G+IN++KELE  LQSME   +  ++   AG +         S PF++FF FPQYS R + 
Sbjct: 165 GAINYLKELEHHLQSMEPPVKTATEDTGAGHDQTKTTSASSSGPFSDFFAFPQYSNRPTS 224

Query: 224 SNNLAPDHESSMTENVADIEVNMAESHANIKILTKKRPRQLLKMVASFQNLRLSVLHLNV 283
                    ++  E +A+IEV M ESHA++KIL KKRPRQLLK+V+S Q+LRL++LHLNV
Sbjct: 225 ---------AAAAEGMAEIEVTMVESHASLKILAKKRPRQLLKLVSSIQSLRLTLLHLNV 275

Query: 284 STVDQMVLYSVSVKVEEGSQLNTVDEIAAAVHQILLEIEEEAT 326
           +T D  VLYS+SVKVEEGSQLNTV++IAAAV+QIL  IEEE++
Sbjct: 276 TTRDDSVLYSISVKVEEGSQLNTVEDIAAAVNQILRRIEEESS 318

Arabidopsis thaliana (taxid: 3702)
>sp|Q9SK91|BH094_ARATH Transcription factor bHLH94 OS=Arabidopsis thaliana GN=BHLH94 PE=2 SV=2 Back     alignment and function description
>sp|Q9M128|BH057_ARATH Transcription factor bHLH57 OS=Arabidopsis thaliana GN=BHLH57 PE=2 SV=1 Back     alignment and function description
>sp|Q56YJ8|FAMA_ARATH Transcription factor FAMA OS=Arabidopsis thaliana GN=FMA PE=1 SV=1 Back     alignment and function description
>sp|Q9FKQ6|BH099_ARATH Transcription factor bHLH99 OS=Arabidopsis thaliana GN=BHLH99 PE=2 SV=1 Back     alignment and function description
>sp|Q56XR0|BH071_ARATH Transcription factor bHLH71 OS=Arabidopsis thaliana GN=BHLH71 PE=1 SV=1 Back     alignment and function description
>sp|O81037|BH070_ARATH Transcription factor bHLH70 OS=Arabidopsis thaliana GN=BHLH70 PE=2 SV=1 Back     alignment and function description
>sp|Q700E4|BH067_ARATH Transcription factor bHLH67 OS=Arabidopsis thaliana GN=BHLH67 PE=2 SV=1 Back     alignment and function description
>sp|Q9M8K6|MUTE_ARATH Transcription factor MUTE OS=Arabidopsis thaliana GN=MUTE PE=2 SV=1 Back     alignment and function description
>sp|Q700C7|SPCH_ARATH Transcription factor SPEECHLESS OS=Arabidopsis thaliana GN=SPCH PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query329
356552929324 PREDICTED: transcription factor bHLH96-l 0.917 0.932 0.609 1e-103
359492901310 PREDICTED: transcription factor bHLH96-l 0.914 0.970 0.637 1e-100
255545850338 DNA binding protein, putative [Ricinus c 0.966 0.940 0.613 5e-97
302398607314 BHLH domain class transcription factor [ 0.875 0.917 0.579 2e-96
356515760334 PREDICTED: transcription factor bHLH96-l 0.960 0.946 0.587 7e-91
356508057324 PREDICTED: transcription factor bHLH96-l 0.942 0.956 0.591 6e-90
302398609310 BHLH domain class transcription factor [ 0.896 0.951 0.588 6e-89
357465137321 Transcription factor bHLH96 [Medicago tr 0.927 0.950 0.556 1e-87
356505880318 PREDICTED: transcription factor bHLH96-l 0.920 0.952 0.536 1e-84
449513091311 PREDICTED: transcription factor bHLH96-l 0.917 0.971 0.572 7e-84
>gi|356552929|ref|XP_003544814.1| PREDICTED: transcription factor bHLH96-like [Glycine max] Back     alignment and taxonomy information
 Score =  382 bits (982), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 211/346 (60%), Positives = 248/346 (71%), Gaps = 44/346 (12%)

Query: 1   MALEAVVYPKPQDPFGYSCN-KD-IYSSPGEGGGAWGYDFCFQQEDRTLLGIIDANIIEQ 58
           MALEAVV+P  QDPF Y CN KD +YS  G GGG+           +T +GII+ N I+ 
Sbjct: 1   MALEAVVFP--QDPFTYGCNNKDFLYSLVGGGGGS-----------QTHVGIINNNNIDH 47

Query: 59  GLHANWDSSSSPTIMQHANESWGPNSSPDAYAADQTLSAGSFSP---AAAATTGGRRKRR 115
            LHANWDSSS P+++Q+  + W  +SSP+A   DQ+L A  F P   +A A   GRRKRR
Sbjct: 48  TLHANWDSSS-PSVLQNVKDQWDSHSSPEACTVDQSLPA-VFPPPSSSAEAAAMGRRKRR 105

Query: 116 RTKSSKNKEEIENQRMTHIAVERNRRKQMNEYLAILRSLMPPSYVQRGDQASVIGGSINF 175
           RTKS+KNKEEIENQRMTHIAVERNRRKQMNEYLA+LRSLMPPSYVQRGDQAS+IGG+INF
Sbjct: 106 RTKSAKNKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPPSYVQRGDQASIIGGAINF 165

Query: 176 VKELEQLLQSMEAQKRNTSQLLKAGDNGVSSPFANFFTFPQYSTRSSQ------------ 223
           VKELEQLLQ M+ QKR      K G    SSPFA FF FPQYSTR++Q            
Sbjct: 166 VKELEQLLQCMKGQKRT-----KEGGFSDSSPFAEFFMFPQYSTRATQSSSSSSRGYPGT 220

Query: 224 ---SNNLAPDHESSMTENVADIEVNMAESHANIKILTKKRPRQLLKMVASFQNLRLSVLH 280
              +NN+A +H  +    VADIEV + + HAN+KIL+KKRP  LLKMV   Q+L LS+LH
Sbjct: 221 CEANNNIARNHSWA----VADIEVTLVDGHANMKILSKKRPGLLLKMVVGLQSLGLSILH 276

Query: 281 LNVSTVDQMVLYSVSVKVEEGSQLNTVDEIAAAVHQILLEIEEEAT 326
           LNV+TVD MVL SVSVKVEEG QLNTVDEIAAAVHQ+   ++EEA 
Sbjct: 277 LNVTTVDDMVLTSVSVKVEEGCQLNTVDEIAAAVHQLSRTVQEEAV 322

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359492901|ref|XP_002285733.2| PREDICTED: transcription factor bHLH96-like [Vitis vinifera] gi|302142009|emb|CBI19212.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255545850|ref|XP_002513985.1| DNA binding protein, putative [Ricinus communis] gi|223547071|gb|EEF48568.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|302398607|gb|ADL36598.1| BHLH domain class transcription factor [Malus x domestica] Back     alignment and taxonomy information
>gi|356515760|ref|XP_003526566.1| PREDICTED: transcription factor bHLH96-like [Glycine max] Back     alignment and taxonomy information
>gi|356508057|ref|XP_003522778.1| PREDICTED: transcription factor bHLH96-like [Glycine max] Back     alignment and taxonomy information
>gi|302398609|gb|ADL36599.1| BHLH domain class transcription factor [Malus x domestica] Back     alignment and taxonomy information
>gi|357465137|ref|XP_003602850.1| Transcription factor bHLH96 [Medicago truncatula] gi|324604791|emb|CBX31916.1| basic helix loop helix 1 [Medicago truncatula] gi|355491898|gb|AES73101.1| Transcription factor bHLH96 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356505880|ref|XP_003521717.1| PREDICTED: transcription factor bHLH96-like [Glycine max] Back     alignment and taxonomy information
>gi|449513091|ref|XP_004164228.1| PREDICTED: transcription factor bHLH96-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query329
TAIR|locus:2009537304 AT1G22490 "AT1G22490" [Arabido 0.595 0.644 0.634 1.1e-68
TAIR|locus:2207061320 AT1G72210 "AT1G72210" [Arabido 0.917 0.943 0.498 2e-65
UNIPROTKB|Q6K4B1351 OJ1595_D08.4 "Os09g0468700 pro 0.322 0.301 0.690 1e-63
UNIPROTKB|Q7XLY9362 OSJNBa0086O06.20 "OSJNBa0086O0 0.212 0.193 0.8 1.1e-55
UNIPROTKB|Q6ZGS3373 OJ1148_D05.9 "Putative basic-h 0.212 0.187 0.814 1.8e-54
TAIR|locus:2116977315 AT4G01460 "AT4G01460" [Arabido 0.604 0.631 0.478 1.9e-44
TAIR|locus:2168235296 AT5G65320 "AT5G65320" [Arabido 0.583 0.648 0.495 1.7e-43
TAIR|locus:2093746414 FMA "AT3G24140" [Arabidopsis t 0.586 0.466 0.475 9.6e-41
UNIPROTKB|Q8H7N8329 OJ1217B09.8 "BHLH transcriptio 0.376 0.376 0.624 2.5e-39
TAIR|locus:2044387371 AT2G46810 "AT2G46810" [Arabido 0.559 0.495 0.482 2.1e-38
TAIR|locus:2009537 AT1G22490 "AT1G22490" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 645 (232.1 bits), Expect = 1.1e-68, Sum P(2) = 1.1e-68
 Identities = 130/205 (63%), Positives = 163/205 (79%)

Query:   122 NKEEIENQRMTHIAVERNRRKQMNEYLAILRSLMPPSYVQRGDQASVIGGSINFVKELEQ 181
             NKEEIENQRMTHIAVERNRRKQMNEYLA+LRSLMP SY QRGDQAS++GG+IN+VKELE 
Sbjct:   106 NKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPSSYAQRGDQASIVGGAINYVKELEH 165

Query:   182 LLQSMEAQKRNTSQLL--KAGDNGVSSPFANFFTFPQYSTRSSQSNNLAPDHESSMTENV 239
             +LQSME ++  T      K   + +  PF +FF+FPQYST+SS      P+  SS     
Sbjct:   166 ILQSMEPKRTRTHDPKGDKTSTSSLVGPFTDFFSFPQYSTKSSSD---VPESSSSP---- 218

Query:   240 ADIEVNMAESHANIKILTKKRPRQLLKMVASFQNLRLSVLHLNVSTVDQMVLYSVSVKVE 299
             A+IEV +AESHANIKI+TKK+PRQLLK++ S Q+LRL++LHLNV+T+   +LYS+SV+VE
Sbjct:   219 AEIEVTVAESHANIKIMTKKKPRQLLKLITSLQSLRLTLLHLNVTTLHNSILYSISVRVE 278

Query:   300 EGSQLNTVDEIAAAVHQILLEIEEE 324
             EGSQLNTVD+IA A++Q +  I+EE
Sbjct:   279 EGSQLNTVDDIATALNQTIRRIQEE 303
GO:0003677 "DNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
TAIR|locus:2207061 AT1G72210 "AT1G72210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6K4B1 OJ1595_D08.4 "Os09g0468700 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q7XLY9 OSJNBa0086O06.20 "OSJNBa0086O06.20 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ZGS3 OJ1148_D05.9 "Putative basic-helix-loop-helix transcription factor" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2116977 AT4G01460 "AT4G01460" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2168235 AT5G65320 "AT5G65320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093746 FMA "AT3G24140" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8H7N8 OJ1217B09.8 "BHLH transcription factor" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2044387 AT2G46810 "AT2G46810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9C7T4BH096_ARATHNo assigned EC number0.52180.91480.9406yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00015166001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (310 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query329
pfam0001052 pfam00010, HLH, Helix-loop-helix DNA-binding domai 1e-11
cd0008360 cd00083, HLH, Helix-loop-helix domain, found in sp 6e-11
smart0035353 smart00353, HLH, helix loop helix domain 1e-07
>gnl|CDD|215654 pfam00010, HLH, Helix-loop-helix DNA-binding domain Back     alignment and domain information 
 Score = 58.6 bits (143), Expect = 1e-11
 Identities = 15/52 (28%), Positives = 29/52 (55%)

Query: 129 QRMTHIAVERNRRKQMNEYLAILRSLMPPSYVQRGDQASVIGGSINFVKELE 180
           +R  H   ER RR ++N+    LR L+P    ++  +A ++  +I ++K L+
Sbjct: 1   RRKAHNERERRRRDRINDAFEELRELLPTPPNKKLSKAEILRLAIEYIKHLQ 52

Length = 52
>gnl|CDD|238036 cd00083, HLH, Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>gnl|CDD|197674 smart00353, HLH, helix loop helix domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 329
PF0001055 HLH: Helix-loop-helix DNA-binding domain only nucl 99.45
cd0008360 HLH Helix-loop-helix domain, found in specific DNA 99.41
smart0035353 HLH helix loop helix domain. 99.33
KOG1318411 consensus Helix loop helix transcription factor EB 98.97
KOG1319229 consensus bHLHZip transcription factor BIGMAX [Tra 98.71
cd0489775 ACT_ACR_3 ACT domain-containing protein which is c 98.59
KOG3960284 consensus Myogenic helix-loop-helix transcription 98.43
KOG2483232 consensus Upstream transcription factor 2/L-myc-2 98.28
cd0489572 ACT_ACR_1 ACT domain-containing protein which is c 98.28
cd0489675 ACT_ACR-like_3 ACT domain-containing protein which 98.25
KOG4304250 consensus Transcriptional repressors of the hairy/ 98.23
cd0492776 ACT_ACR-like_2 Second ACT domain, of a novel type 98.18
KOG3561 803 consensus Aryl-hydrocarbon receptor nuclear transl 98.13
cd0490073 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, 98.08
cd0492574 ACT_ACR_2 ACT domain-containing protein which is c 98.01
KOG4029228 consensus Transcription factor HAND2/Transcription 98.0
KOG2588 953 consensus Predicted DNA-binding protein [Transcrip 97.95
cd0492868 ACT_TyrKc Uncharacterized, N-terminal ACT domain o 97.78
KOG4447173 consensus Transcription factor TWIST [Transcriptio 97.73
cd0489970 ACT_ACR-UUR-like_2 C-terminal ACT domains of the b 97.73
cd0492672 ACT_ACR_4 C-terminal ACT domain, of a novel type o 97.57
PLN0321793 transcription factor ATBS1; Provisional 97.54
PF1374076 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. 97.51
KOG0561 373 consensus bHLH transcription factor [Transcription 97.5
cd0486981 ACT_GcvR_2 ACT domains that comprise the Glycine C 97.19
cd0489377 ACT_GcvR_1 ACT domains that comprise the Glycine C 97.16
PRK05007884 PII uridylyl-transferase; Provisional 97.15
PF0184266 ACT: ACT domain; InterPro: IPR002912 The ACT domai 97.13
PF1329180 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. 97.12
PRK00275895 glnD PII uridylyl-transferase; Provisional 97.11
cd0487370 ACT_UUR-ACR-like ACT domains of the bacterial sign 97.07
PRK0019490 hypothetical protein; Validated 97.03
cd0487288 ACT_1ZPV ACT domain proteins similar to the yet un 97.02
cd0487075 ACT_PSP_1 CT domains found N-terminal of phosphose 96.98
PRK05092931 PII uridylyl-transferase; Provisional 96.91
cd0487574 ACT_F4HF-DF N-terminal ACT domain of formyltetrahy 96.87
PRK01759854 glnD PII uridylyl-transferase; Provisional 96.83
PRK04374869 PII uridylyl-transferase; Provisional 96.79
cd0488774 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te 96.74
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 96.48
cd0488673 ACT_ThrD-II-like C-terminal ACT domain of biodegra 96.44
PRK03381774 PII uridylyl-transferase; Provisional 96.43
KOG3910632 consensus Helix loop helix transcription factor [T 96.41
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 96.41
PRK03381774 PII uridylyl-transferase; Provisional 96.39
PRK03059856 PII uridylyl-transferase; Provisional 96.31
cd0488876 ACT_PheB-BS C-terminal ACT domain of a small (~147 96.02
PRK01759854 glnD PII uridylyl-transferase; Provisional 95.99
COG2844867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 95.95
PRK05007 884 PII uridylyl-transferase; Provisional 95.94
PRK00275 895 glnD PII uridylyl-transferase; Provisional 95.68
PRK05092 931 PII uridylyl-transferase; Provisional 95.67
PRK03059856 PII uridylyl-transferase; Provisional 95.56
cd0487671 ACT_RelA-SpoT ACT domain found C-terminal of the R 95.52
PRK04435147 hypothetical protein; Provisional 95.41
cd0487774 ACT_TyrR N-terminal ACT domain of the TyrR protein 95.35
KOG3898254 consensus Transcription factor NeuroD and related 95.33
PRK04374869 PII uridylyl-transferase; Provisional 94.98
cd0488179 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin 94.97
cd0487872 ACT_AHAS N-terminal ACT domain of the Escherichia 94.82
cd0211660 ACT ACT domains are commonly involved in specifica 94.62
PRK08577136 hypothetical protein; Provisional 94.48
KOG3560 712 consensus Aryl-hydrocarbon receptor [Transcription 94.39
cd0488075 ACT_AAAH-PDT-like ACT domain of the nonheme iron-d 94.38
PRK06027 286 purU formyltetrahydrofolate deformylase; Reviewed 94.36
cd0488472 ACT_CBS C-terminal ACT domain of the cystathionine 94.19
PRK13011 286 formyltetrahydrofolate deformylase; Reviewed 94.14
cd0490580 ACT_CM-PDT C-terminal ACT domain of the bifunction 93.96
cd0489469 ACT_ACR-like_1 ACT domain-containing protein which 93.87
cd0487472 ACT_Af1403 N-terminal ACT domain of the yet unchar 93.83
PRK07334403 threonine dehydratase; Provisional 93.74
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel prot 93.6
PRK13010 289 purU formyltetrahydrofolate deformylase; Reviewed 93.49
TIGR00655 280 PurU formyltetrahydrofolate deformylase. This mode 93.28
cd0487971 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te 93.26
cd0490371 ACT_LSD C-terminal ACT domain of the L-serine dehy 92.71
cd0488372 ACT_AcuB C-terminal ACT domain of the Bacillus sub 92.35
cd0490969 ACT_PDH-BS C-terminal ACT domain of the monofuncti 92.17
cd0488568 ACT_ThrD-I Tandem C-terminal ACT domains of threon 92.04
cd0490866 ACT_Bt0572_1 N-terminal ACT domain of a novel prot 91.84
cd0488956 ACT_PDH-BS-like C-terminal ACT domain of the monof 91.72
PRK11895161 ilvH acetolactate synthase 3 regulatory subunit; R 91.66
cd0490474 ACT_AAAH ACT domain of the nonheme iron-dependent, 91.58
TIGR00119157 acolac_sm acetolactate synthase, small subunit. ac 91.27
PRK1115276 ilvM acetolactate synthase 2 regulatory subunit; P 91.0
COG2844 867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 90.99
PRK11589190 gcvR glycine cleavage system transcriptional repre 90.51
KOG3558 768 consensus Hypoxia-inducible factor 1/Neuronal PAS 90.45
CHL00100174 ilvH acetohydroxyacid synthase small subunit 90.39
PRK1356284 acetolactate synthase 1 regulatory subunit; Provis 90.34
cd0493190 ACT_PAH ACT domain of the nonheme iron-dependent a 90.24
PRK0673776 acetolactate synthase 1 regulatory subunit; Valida 89.7
cd0492974 ACT_TPH ACT domain of the nonheme iron-dependent a 89.5
PF1371063 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. 89.24
cd0490169 ACT_3PGDH C-terminal ACT (regulatory) domain of D- 88.96
PRK10872743 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; 88.69
PRK11589 190 gcvR glycine cleavage system transcriptional repre 88.56
COG383090 ACT domain-containing protein [Signal transduction 88.08
cd0490685 ACT_ThrD-I_1 First of two tandem C-terminal ACT do 88.02
COG0788 287 PurU Formyltetrahydrofolate hydrolase [Nucleotide 87.68
KOG3559 598 consensus Transcriptional regulator SIM1 [Transcri 87.47
PRK11092702 bifunctional (p)ppGpp synthetase II/ guanosine-3', 86.51
PRK0817896 acetolactate synthase 1 regulatory subunit; Review 86.43
TIGR00691683 spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( 85.75
COG4492150 PheB ACT domain-containing protein [General functi 85.65
PF05088 1528 Bac_GDH: Bacterial NAD-glutamate dehydrogenase 85.18
PRK08198404 threonine dehydratase; Provisional 84.06
cd04930115 ACT_TH ACT domain of the nonheme iron-dependent ar 83.75
cd0490273 ACT_3PGDH-xct C-terminal ACT (regulatory) domain o 83.1
KOG4395285 consensus Transcription factor Atonal, contains HT 82.59
TIGR01127380 ilvA_1Cterm threonine dehydratase, medium form. A 82.06
>PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) Back     alignment and domain information 
Probab=99.45  E-value=1.8e-13  Score=99.51  Aligned_cols=52  Identities=31%  Similarity=0.585  Sum_probs=48.4

Q ss_pred             hhhhhhHHHHHHHHHHHHHHHHHHhcCCCC---CCCCCchhhhHHHHHHHHHHHH
Q 020210          129 QRMTHIAVERNRRKQMNEYLAILRSLMPPS---YVQRGDQASVIGGSINFVKELE  180 (329)
Q Consensus       129 ~r~~h~~~ER~RR~~mn~~~~~LrslvP~~---~~~k~dKasIL~~AI~YIk~Lq  180 (329)
                      +|..|+.+||+||++||+.|..|+.+||..   ...|.+|++||..||+||++||
T Consensus         1 rR~~h~~~Er~RR~~i~~~~~~L~~llp~~~~~~~~k~~K~~iL~~ai~yI~~Lq   55 (55)
T PF00010_consen    1 RRQKHNERERRRRDRINDCFDELRELLPSCSAGSSRKLSKASILQKAIDYIKQLQ   55 (55)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHCCSSHHCCTTSSSSHHHHHHHHHHHHHHHH
T ss_pred             CCchHHHHHHHHHHHHHHHHHHHHHhccchhccccccCCHHHHHHHHHHHHHHhC
Confidence            467999999999999999999999999995   4578999999999999999997

; InterPro: IPR011598 The helix-loop-helix (HLH) DNA-binding domain consists of a closed bundle of four helices in a left-handed twist with two crossover connections. The HLH domain directs dimerisation, and is juxtaposed to basic regions to create a DNA interaction interface surface that recognises specific DNA sequences. Basic region/HLH (bHLH) proteins regulate diverse biological pathways []. bHLH proteins include MyoD [], SREBPs (sterol regulatory element binding proteins) [], and yeast Pho4 (phosphatase system) []. In certain proteins the bHLH domain contains a leucine-zipper motif. The bHLH/leucine zipper (bHLHZip) domain specifies dimerisation within a network of proteins and determines sequence-specific DNA binding []. bHLHZip domains occur in the transcription factors Myc, Mad, Max and Usf [, ]. This entry is bHLHZip, which covers the bHLH domain and the leucine zipper motif, when present.; PDB: 1NLW_A 1NKP_D 1A93_A 2A93_A 1AM9_C 3U5V_A 1A0A_B 2QL2_C 1UKL_C 1AN4_B ....
>cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>smart00353 HLH helix loop helix domain Back     alignment and domain information
>KOG1318 consensus Helix loop helix transcription factor EB [Transcription] Back     alignment and domain information
>KOG1319 consensus bHLHZip transcription factor BIGMAX [Transcription] Back     alignment and domain information
>cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>KOG3960 consensus Myogenic helix-loop-helix transcription factor [Transcription] Back     alignment and domain information
>KOG2483 consensus Upstream transcription factor 2/L-myc-2 protein [Transcription] Back     alignment and domain information
>cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>KOG4304 consensus Transcriptional repressors of the hairy/E(spl) family (contains HLH) [Transcription] Back     alignment and domain information
>cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>KOG3561 consensus Aryl-hydrocarbon receptor nuclear translocator [Transcription] Back     alignment and domain information
>cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>KOG4029 consensus Transcription factor HAND2/Transcription factor TAL1/TAL2/LYL1 [Transcription] Back     alignment and domain information
>KOG2588 consensus Predicted DNA-binding protein [Transcription] Back     alignment and domain information
>cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains Back     alignment and domain information
>KOG4447 consensus Transcription factor TWIST [Transcription] Back     alignment and domain information
>cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PLN03217 transcription factor ATBS1; Provisional Back     alignment and domain information
>PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A Back     alignment and domain information
>KOG0561 consensus bHLH transcription factor [Transcription] Back     alignment and domain information
>cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold Back     alignment and domain information
>PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>PRK00194 hypothetical protein; Validated Back     alignment and domain information
>cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein Back     alignment and domain information
>cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>KOG3910 consensus Helix loop helix transcription factor [Transcription] Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains Back     alignment and domain information
>PRK04435 hypothetical protein; Provisional Back     alignment and domain information
>cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein Back     alignment and domain information
>KOG3898 consensus Transcription factor NeuroD and related HTH proteins [Transcription] Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains Back     alignment and domain information
>cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) Back     alignment and domain information
>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>PRK08577 hypothetical protein; Provisional Back     alignment and domain information
>KOG3560 consensus Aryl-hydrocarbon receptor [Transcription] Back     alignment and domain information
>cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme Back     alignment and domain information
>cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase Back     alignment and domain information
>cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit Back     alignment and domain information
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB Back     alignment and domain information
>cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) Back     alignment and domain information
>cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains Back     alignment and domain information
>cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate Back     alignment and domain information
>PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed Back     alignment and domain information
>cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>TIGR00119 acolac_sm acetolactate synthase, small subunit Back     alignment and domain information
>PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>KOG3558 consensus Hypoxia-inducible factor 1/Neuronal PAS domain protein NPAS1 [Signal transduction mechanisms; Transcription] Back     alignment and domain information
>CHL00100 ilvH acetohydroxyacid synthase small subunit Back     alignment and domain information
>PRK13562 acetolactate synthase 1 regulatory subunit; Provisional Back     alignment and domain information
>cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) Back     alignment and domain information
>PRK06737 acetolactate synthase 1 regulatory subunit; Validated Back     alignment and domain information
>cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes Back     alignment and domain information
>PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B Back     alignment and domain information
>cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria Back     alignment and domain information
>PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>COG3830 ACT domain-containing protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04906 ACT_ThrD-I_1 First of two tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG3559 consensus Transcriptional regulator SIM1 [Transcription] Back     alignment and domain information
>PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional Back     alignment and domain information
>PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed Back     alignment and domain information
>TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family Back     alignment and domain information
>COG4492 PheB ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>PF05088 Bac_GDH: Bacterial NAD-glutamate dehydrogenase Back     alignment and domain information
>PRK08198 threonine dehydratase; Provisional Back     alignment and domain information
>cd04930 ACT_TH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH) Back     alignment and domain information
>cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>KOG4395 consensus Transcription factor Atonal, contains HTH domain [Transcription] Back     alignment and domain information
>TIGR01127 ilvA_1Cterm threonine dehydratase, medium form Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query329
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 1e-09
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 8e-09
1hlo_A80 Protein (transcription factor MAX); transcriptiona 1e-08
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 1e-08
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 2e-05
1a0a_A63 BHLH, protein (phosphate system positive regulator 1e-04
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Length = 83 Back     alignment and structure
 Score = 53.5 bits (129), Expect = 1e-09
 Identities = 11/65 (16%), Positives = 31/65 (47%)

Query: 128 NQRMTHIAVERNRRKQMNEYLAILRSLMPPSYVQRGDQASVIGGSINFVKELEQLLQSME 187
           ++R  H A+ER RR  + +    LR  +P    ++  +A ++  +  +++ + +   + +
Sbjct: 1   DKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQ 60

Query: 188 AQKRN 192
               +
Sbjct: 61  QDIDD 65
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Length = 88 Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Length = 82 Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Length = 65 Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Length = 63 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query329
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 99.65
1hlo_A80 Protein (transcription factor MAX); transcriptiona 99.61
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 99.6
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 99.58
4h10_B71 Circadian locomoter output cycles protein kaput; B 99.57
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 99.5
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 99.49
1a0a_A63 BHLH, protein (phosphate system positive regulator 99.47
4h10_A73 ARYL hydrocarbon receptor nuclear translocator-LI 99.45
4ati_A118 MITF, microphthalmia-associated transcription fact 99.45
3u5v_A76 Protein MAX, transcription factor E2-alpha chimer; 99.43
1mdy_A68 Protein (MYOD BHLH domain); protein-DNA complex, t 99.35
2ql2_B60 Neurod1, neurogenic differentiation factor 1; basi 99.26
4f3l_A 361 Mclock, circadian locomoter output cycles protein 98.89
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 98.72
2lfh_A68 DNA-binding protein inhibitor ID-3; structural gen 98.68
4ath_A83 MITF, microphthalmia-associated transcription fact 98.37
4aya_A97 DNA-binding protein inhibitor ID-2; cell cycle; 2. 98.24
1zpv_A91 ACT domain protein; structural genomics, PSI, prot 97.59
1u8s_A 192 Glycine cleavage system transcriptional repressor, 96.74
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+b 96.48
2nyi_A195 Unknown protein; protein structure initiative, PSI 96.39
2nyi_A 195 Unknown protein; protein structure initiative, PSI 96.23
1u8s_A192 Glycine cleavage system transcriptional repressor, 95.94
3obi_A 288 Formyltetrahydrofolate deformylase; structural gen 93.97
3o1l_A 302 Formyltetrahydrofolate deformylase; structural gen 93.85
3n0v_A 286 Formyltetrahydrofolate deformylase; formyl transfe 93.77
3p96_A 415 Phosphoserine phosphatase SERB; ssgcid, structural 93.59
3lou_A 292 Formyltetrahydrofolate deformylase; structural gen 92.99
2jhe_A 190 Transcription regulator TYRR; aromatic hydrocarbon 92.51
2f1f_A164 Acetolactate synthase isozyme III small subunit; f 92.01
2fgc_A193 Acetolactate synthase, small subunit; regulatory s 91.13
2pc6_A165 Probable acetolactate synthase isozyme III (small; 90.95
3nrb_A 287 Formyltetrahydrofolate deformylase; N-terminal ACT 90.15
1y7p_A 223 Hypothetical protein AF1403; structural genomics, 88.53
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Back     alignment and structure
Probab=99.65  E-value=3.3e-16  Score=122.50  Aligned_cols=68  Identities=18%  Similarity=0.347  Sum_probs=62.3

Q ss_pred             hhhhhhhhHHHHHHHHHHHHHHHHHHhcCCCCCCCCCchhhhHHHHHHHHHHHHHHHHHHHHHHHhhhh
Q 020210          127 ENQRMTHIAVERNRRKQMNEYLAILRSLMPPSYVQRGDQASVIGGSINFVKELEQLLQSMEAQKRNTSQ  195 (329)
Q Consensus       127 ~~~r~~h~~~ER~RR~~mn~~~~~LrslvP~~~~~k~dKasIL~~AI~YIk~Lq~~v~~L~~~~~~~~~  195 (329)
                      ..+|.+|+.+||+||++||++|..|++|||.. ..|+||++||.+||+||++|+.+++.|+.+...+..
T Consensus         4 ~~rr~~H~~~ErrRR~~in~~f~~L~~lvP~~-~~k~~Ka~IL~~Ai~YI~~Lq~~~~~L~~e~~~L~~   71 (82)
T 1am9_A            4 GEKRTAHNAIEKRYRSSINDKIIELKDLVVGT-EAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRT   71 (82)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCS-SCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hHHHHhhhhHHHHHHHHHHHHHHHHHHhccCC-CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            35688999999999999999999999999983 479999999999999999999999999999887653
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Back     alignment and structure
>4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A Back     alignment and structure
>3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* Back     alignment and structure
>1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* Back     alignment and structure
>2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} Back     alignment and structure
>4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} Back     alignment and structure
>1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} Back     alignment and structure
>1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 329
d1mdya_68 a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus muscul 1e-14
d1nkpb_83 a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T 2e-14
d1nkpa_88 a.38.1.1 (A:) Myc proto-oncogene protein {Human (H 3e-13
d1a0aa_63 a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Sa 1e-11
d1nlwa_79 a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [T 2e-11
d1an4a_65 a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapien 5e-11
d1am9a_80 a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxI 1e-10
d1uklc_61 a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId 7e-09
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 68 Back     information, alignment and structure

class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: Myod B/HLH domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 65.7 bits (160), Expect = 1e-14
 Identities = 15/64 (23%), Positives = 30/64 (46%)

Query: 121 KNKEEIENQRMTHIAVERNRRKQMNEYLAILRSLMPPSYVQRGDQASVIGGSINFVKELE 180
           K K    ++R      ER R  ++NE    L+     +  QR  +  ++  +I +++ L+
Sbjct: 4   KRKTTNADRRKAATMRERRRLSKVNEAFETLKRSTSSNPNQRLPKVEILRNAIRYIEGLQ 63

Query: 181 QLLQ 184
            LL+
Sbjct: 64  ALLR 67
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 63 Back     information, alignment and structure
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query329
d1am9a_80 SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} 99.59
d1mdya_68 Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 99.59
d1nkpb_83 Max protein {Human (Homo sapiens) [TaxId: 9606]} 99.58
d1nlwa_79 Mad protein {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 99.53
d1a0aa_63 Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce 99.51
d1an4a_65 Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 99.42
d1uklc_61 SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} 99.33
d1zpva183 UPF0237 protein SP0238 {Streptococcus pneumoniae [ 97.74
d1u8sa186 putative transcriptional repressor VC2159 {Vibrio 97.44
d1u8sa293 putative transcriptional repressor VC2159 {Vibrio 97.11
d1y7pa277 Hypothetical protein AF1403, N-terminal domain {Ar 95.45
d2f06a171 Hypothetical protein BT0572 {Bacteroides thetaiota 94.37
d2f06a270 Hypothetical protein BT0572 {Bacteroides thetaiota 92.32
d2fgca278 Acetolactate synthase small subunit, IlvH {Thermot 91.01
d1sc6a384 Phosphoglycerate dehydrogenase, regulatory (C-term 90.02
d2f1fa176 Acetolactate synthase small subunit, IlvH {Escheri 88.91
d2pc6a277 Acetolactate synthase small subunit, IlvH {Nitroso 88.57
d2qmwa280 Prephenate dehydratase C-terminal domain {Staphylo 88.17
d1phza197 Phenylalanine hydroxylase N-terminal domain {Rat ( 84.71
d1ygya378 Phosphoglycerate dehydrogenase, regulatory (C-term 81.36
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: SREBP-1a
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.59  E-value=1.3e-15  Score=116.61  Aligned_cols=67  Identities=18%  Similarity=0.352  Sum_probs=61.4

Q ss_pred             hhhhhhhhHHHHHHHHHHHHHHHHHHhcCCCCCCCCCchhhhHHHHHHHHHHHHHHHHHHHHHHHhhh
Q 020210          127 ENQRMTHIAVERNRRKQMNEYLAILRSLMPPSYVQRGDQASVIGGSINFVKELEQLLQSMEAQKRNTS  194 (329)
Q Consensus       127 ~~~r~~h~~~ER~RR~~mn~~~~~LrslvP~~~~~k~dKasIL~~AI~YIk~Lq~~v~~L~~~~~~~~  194 (329)
                      ..+|..|+.+||+||++||+.|..|++|||.. ..|.+|++||..||+||++|+++++.|..+...+.
T Consensus         4 ~~kR~~H~~~Er~RR~~in~~~~~L~~llP~~-~~k~~K~~iL~~a~~yI~~L~~~~~~L~~e~~~lk   70 (80)
T d1am9a_           4 GEKRTAHNAIEKRYRSSINDKIIELKDLVVGT-EAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLR   70 (80)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCS-SCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             chHHHHHHHHHHHHHHHHHHHHHHHHhcCCCC-CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            35688999999999999999999999999984 56899999999999999999999999998887664
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure