Citrus Sinensis ID: 020217
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 329 | ||||||
| 255539282 | 458 | glyceraldehyde 3-phosphate dehydrogenase | 0.829 | 0.596 | 0.864 | 1e-136 | |
| 224086078 | 452 | predicted protein [Populus trichocarpa] | 0.832 | 0.606 | 0.858 | 1e-134 | |
| 381393062 | 452 | glyceraldehyde-3-phosphate dehydrogenase | 0.832 | 0.606 | 0.832 | 1e-132 | |
| 224061855 | 440 | predicted protein [Populus trichocarpa] | 0.799 | 0.597 | 0.871 | 1e-131 | |
| 351726690 | 451 | glyceraldehyde-3-phosphate dehydrogenase | 0.832 | 0.607 | 0.818 | 1e-131 | |
| 255641007 | 452 | unknown [Glycine max] | 0.835 | 0.608 | 0.807 | 1e-130 | |
| 449455619 | 451 | PREDICTED: glyceraldehyde-3-phosphate de | 0.829 | 0.605 | 0.84 | 1e-130 | |
| 358248146 | 451 | uncharacterized protein LOC100806482 [Gl | 0.832 | 0.607 | 0.818 | 1e-130 | |
| 147795191 | 453 | hypothetical protein VITISV_021576 [Viti | 0.832 | 0.604 | 0.836 | 1e-130 | |
| 327198779 | 450 | glyceraldehyde-3-phosphate dehydrogenase | 0.829 | 0.606 | 0.825 | 1e-130 |
| >gi|255539282|ref|XP_002510706.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis] gi|223551407|gb|EEF52893.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 489 bits (1260), Expect = e-136, Method: Compositional matrix adjust.
Identities = 237/274 (86%), Positives = 253/274 (92%), Gaps = 1/274 (0%)
Query: 1 MASHSALAPSRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASF 60
MA+H+ALAPSRIPA TR+PSK+ HSFPTQCS+KRL+VAEF+GLRA++ TYA A +ASF
Sbjct: 1 MATHAALAPSRIPASTRLPSKSAHSFPTQCSSKRLEVAEFSGLRASSCMTYAKNASEASF 60
Query: 61 FDAVTAQLTPKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVND 120
FD V AQ+ PKVA S P + ETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+VVND
Sbjct: 61 FDLVAAQMAPKVAT-STPTRAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVND 119
Query: 121 SGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIV 180
SGGVKNASHLLKYDS+LGTFKADVKIVDN TISVDGK IKVVSNRDPL+LPWAELGIDIV
Sbjct: 120 SGGVKNASHLLKYDSMLGTFKADVKIVDNTTISVDGKPIKVVSNRDPLKLPWAELGIDIV 179
Query: 181 IEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASC 240
IEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDY HEVANIVSNASC
Sbjct: 180 IEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYSHEVANIVSNASC 239
Query: 241 TTNCLAPFVKVMDEELGIVKGAMTTTHSYTGDQA 274
TTNCLAPFVKVMDEE GIVKG MTTTHSYTGD +
Sbjct: 240 TTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDXS 273
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224086078|ref|XP_002307806.1| predicted protein [Populus trichocarpa] gi|222857255|gb|EEE94802.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|381393062|gb|AFG28405.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri] | Back alignment and taxonomy information |
|---|
| >gi|224061855|ref|XP_002300632.1| predicted protein [Populus trichocarpa] gi|222842358|gb|EEE79905.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|351726690|ref|NP_001237135.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max] gi|77540212|gb|ABA86964.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255641007|gb|ACU20783.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449455619|ref|XP_004145550.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like [Cucumis sativus] gi|449485095|ref|XP_004157068.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|358248146|ref|NP_001240080.1| uncharacterized protein LOC100806482 [Glycine max] gi|255636463|gb|ACU18570.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|147795191|emb|CAN69459.1| hypothetical protein VITISV_021576 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|327198779|emb|CBL43264.1| glyceraldehyde-3-phosphate dehydrogenase [Solanum tuberosum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 329 | ||||||
| TAIR|locus:2009864 | 447 | GAPB "glyceraldehyde-3-phospha | 0.817 | 0.601 | 0.807 | 4.4e-116 | |
| TAIR|locus:2010361 | 399 | GAPA-2 "glyceraldehyde 3-phosp | 0.714 | 0.588 | 0.672 | 6.6e-81 | |
| TAIR|locus:2090802 | 396 | GAPA "glyceraldehyde 3-phospha | 0.708 | 0.588 | 0.682 | 9.7e-80 | |
| UNIPROTKB|Q829W3 | 335 | gap2 "Glyceraldehyde-3-phospha | 0.565 | 0.555 | 0.550 | 8.3e-51 | |
| TIGR_CMR|CHY_0280 | 335 | CHY_0280 "glyceraldehyde-3-pho | 0.562 | 0.552 | 0.555 | 3.2e-49 | |
| TIGR_CMR|BA_5369 | 334 | BA_5369 "glyceraldehyde 3-phos | 0.559 | 0.550 | 0.521 | 1.6e-47 | |
| TAIR|locus:2032810 | 420 | GAPCP-2 "glyceraldehyde-3-phos | 0.781 | 0.611 | 0.431 | 8.8e-47 | |
| TAIR|locus:2206435 | 422 | GAPCP-1 "glyceraldehyde-3-phos | 0.793 | 0.618 | 0.427 | 8.8e-47 | |
| TIGR_CMR|DET_0590 | 334 | DET_0590 "glyceraldehyde-3-pho | 0.623 | 0.613 | 0.466 | 4.8e-46 | |
| TIGR_CMR|BA_4827 | 342 | BA_4827 "glyceraldehyde 3-phos | 0.553 | 0.532 | 0.510 | 1e-45 |
| TAIR|locus:2009864 GAPB "glyceraldehyde-3-phosphate dehydrogenase B subunit" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1144 (407.8 bits), Expect = 4.4e-116, P = 4.4e-116
Identities = 223/276 (80%), Positives = 245/276 (88%)
Query: 1 MASHSALAPSRIPAITRIPSKTT-HSFPTQCSTKRLDVAEFAGLRANAGATYATGARDAS 59
MA+H+ALA SRIP R+ SK+ HSFP QCS+KRL+VAEF+GLR ++ G +AS
Sbjct: 1 MATHAALAVSRIPVTQRLQSKSAIHSFPAQCSSKRLEVAEFSGLRMSS-----IGG-EAS 54
Query: 60 FFDAVTAQLTPKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVN 119
FFDAV AQ+ PK S PV+ ETVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VVV+N
Sbjct: 55 FFDAVAAQIIPKAVTTSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLN 114
Query: 120 DSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDI 179
DSGGVKNASHLLKYDS+LGTFKA+VKIVDNETISVDGKLIKVVSNRDPL+LPWAELGIDI
Sbjct: 115 DSGGVKNASHLLKYDSMLGTFKAEVKIVDNETISVDGKLIKVVSNRDPLKLPWAELGIDI 174
Query: 180 VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNAS 239
VIEGTGVFVDGPGAGKHIQAGA KVIITAPAKGADIPTYV+GVNE+DY H+VANI+SNAS
Sbjct: 175 VIEGTGVFVDGPGAGKHIQAGASKVIITAPAKGADIPTYVMGVNEQDYGHDVANIISNAS 234
Query: 240 CTTNCLAPFVKVMDEELGIVKGAMTTTHSYTGDQAL 275
CTTNCLAPF KV+DEE GIVKG MTTTHSYTGDQ L
Sbjct: 235 CTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRL 270
|
|
| TAIR|locus:2010361 GAPA-2 "glyceraldehyde 3-phosphate dehydrogenase A subunit 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2090802 GAPA "glyceraldehyde 3-phosphate dehydrogenase A subunit" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q829W3 gap2 "Glyceraldehyde-3-phosphate dehydrogenase" [Streptomyces avermitilis MA-4680 (taxid:227882)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_0280 CHY_0280 "glyceraldehyde-3-phosphate dehydrogenase, type I" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_5369 BA_5369 "glyceraldehyde 3-phosphate dehydrogenase" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2032810 GAPCP-2 "glyceraldehyde-3-phosphate dehydrogenase of plastid 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2206435 GAPCP-1 "glyceraldehyde-3-phosphate dehydrogenase of plastid 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|DET_0590 DET_0590 "glyceraldehyde-3-phosphate dehydrogenase, type I" [Dehalococcoides ethenogenes 195 (taxid:243164)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_4827 BA_4827 "glyceraldehyde 3-phosphate dehydrogenase" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_fgenesh4_pm.C_LG_V0707 | SubName- Full=Putative uncharacterized protein; (453 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| eugene3.00080776 | • | • | • | 0.940 | |||||||
| grail3.0154005402 | • | • | • | 0.940 | |||||||
| estExt_fgenesh4_pm.C_LG_VIII0335 | • | • | • | 0.932 | |||||||
| estExt_fgenesh4_pm.C_LG_X0655 | • | • | • | 0.932 | |||||||
| grail3.0049021504 | • | • | • | 0.913 | |||||||
| estExt_fgenesh4_pg.C_LG_I1744 | • | • | • | 0.913 | |||||||
| estExt_Genewise1_v1.C_LG_IV0988 | • | • | • | 0.913 | |||||||
| estExt_Genewise1_v1.C_LG_X2172 | • | • | • | 0.913 | |||||||
| estExt_Genewise1_v1.C_LG_XIV0740 | • | • | 0.908 | ||||||||
| eugene3.00091331 | • | • | • | • | 0.908 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 329 | |||
| PLN02237 | 442 | PLN02237, PLN02237, glyceraldehyde-3-phosphate deh | 1e-171 | |
| PLN03096 | 395 | PLN03096, PLN03096, glyceraldehyde-3-phosphate deh | 1e-128 | |
| PRK07403 | 337 | PRK07403, PRK07403, glyceraldehyde-3-phosphate deh | 2e-97 | |
| TIGR01534 | 326 | TIGR01534, GAPDH-I, glyceraldehyde-3-phosphate deh | 7e-85 | |
| COG0057 | 335 | COG0057, GapA, Glyceraldehyde-3-phosphate dehydrog | 1e-80 | |
| PRK07729 | 343 | PRK07729, PRK07729, glyceraldehyde-3-phosphate deh | 4e-79 | |
| pfam00044 | 148 | pfam00044, Gp_dh_N, Glyceraldehyde 3-phosphate deh | 9e-71 | |
| smart00846 | 149 | smart00846, Gp_dh_N, Glyceraldehyde 3-phosphate de | 2e-66 | |
| PLN02272 | 421 | PLN02272, PLN02272, glyceraldehyde-3-phosphate deh | 4e-65 | |
| PTZ00023 | 337 | PTZ00023, PTZ00023, glyceraldehyde-3-phosphate deh | 1e-53 | |
| PRK13535 | 336 | PRK13535, PRK13535, erythrose 4-phosphate dehydrog | 1e-52 | |
| PLN02358 | 338 | PLN02358, PLN02358, glyceraldehyde-3-phosphate deh | 1e-48 | |
| PRK15425 | 331 | PRK15425, gapA, glyceraldehyde-3-phosphate dehydro | 7e-48 | |
| PTZ00434 | 361 | PTZ00434, PTZ00434, cytosolic glyceraldehyde 3-pho | 7e-46 | |
| TIGR01532 | 325 | TIGR01532, E4PD_g-proteo, erythrose-4-phosphate de | 2e-45 | |
| PRK08289 | 477 | PRK08289, PRK08289, glyceraldehyde-3-phosphate deh | 1e-43 | |
| PRK08955 | 334 | PRK08955, PRK08955, glyceraldehyde-3-phosphate deh | 2e-43 | |
| PTZ00353 | 342 | PTZ00353, PTZ00353, glycosomal glyceraldehyde-3-ph | 5e-12 | |
| pfam02800 | 157 | pfam02800, Gp_dh_C, Glyceraldehyde 3-phosphate deh | 3e-09 | |
| TIGR01296 | 338 | TIGR01296, asd_B, aspartate-semialdehyde dehydroge | 0.004 |
| >gnl|CDD|215131 PLN02237, PLN02237, glyceraldehyde-3-phosphate dehydrogenase B | Back alignment and domain information |
|---|
Score = 482 bits (1241), Expect = e-171
Identities = 230/273 (84%), Positives = 246/273 (90%), Gaps = 9/273 (3%)
Query: 3 SHSALAPSRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFD 62
+H+ALA SRIPA TR+PSK +H KRL+VAEF+GLRA++ T+A AR+ASFFD
Sbjct: 1 THAALASSRIPATTRLPSKASH--------KRLEVAEFSGLRASSCVTFAKNAREASFFD 52
Query: 63 AVTAQLTPKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSG 122
V +QL PK AGS PV+ ETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSG
Sbjct: 53 VVASQLAPK-VAGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSG 111
Query: 123 GVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIE 182
GVKNASHLLKYDS+LGTFKADVKIVD+ETISVDGK IKVVSNRDPL+LPWAELGIDIVIE
Sbjct: 112 GVKNASHLLKYDSMLGTFKADVKIVDDETISVDGKPIKVVSNRDPLKLPWAELGIDIVIE 171
Query: 183 GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTT 242
GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNE DYDHEVANIVSNASCTT
Sbjct: 172 GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEDDYDHEVANIVSNASCTT 231
Query: 243 NCLAPFVKVMDEELGIVKGAMTTTHSYTGDQAL 275
NCLAPFVKV+DEE GIVKG MTTTHSYTGDQ L
Sbjct: 232 NCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRL 264
|
Length = 442 |
| >gnl|CDD|215572 PLN03096, PLN03096, glyceraldehyde-3-phosphate dehydrogenase A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180962 PRK07403, PRK07403, glyceraldehyde-3-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233453 TIGR01534, GAPDH-I, glyceraldehyde-3-phosphate dehydrogenase, type I | Back alignment and domain information |
|---|
| >gnl|CDD|223135 COG0057, GapA, Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|236079 PRK07729, PRK07729, glyceraldehyde-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|215675 pfam00044, Gp_dh_N, Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|214851 smart00846, Gp_dh_N, Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|177912 PLN02272, PLN02272, glyceraldehyde-3-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|173322 PTZ00023, PTZ00023, glyceraldehyde-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184122 PRK13535, PRK13535, erythrose 4-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165999 PLN02358, PLN02358, glyceraldehyde-3-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|185323 PRK15425, gapA, glyceraldehyde-3-phosphate dehydrogenase A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185614 PTZ00434, PTZ00434, cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130595 TIGR01532, E4PD_g-proteo, erythrose-4-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|236219 PRK08289, PRK08289, glyceraldehyde-3-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|169599 PRK08955, PRK08955, glyceraldehyde-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|173546 PTZ00353, PTZ00353, glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217235 pfam02800, Gp_dh_C, Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|233347 TIGR01296, asd_B, aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 329 | |||
| PLN02237 | 442 | glyceraldehyde-3-phosphate dehydrogenase B | 100.0 | |
| PTZ00434 | 361 | cytosolic glyceraldehyde 3-phosphate dehydrogenase | 100.0 | |
| PLN03096 | 395 | glyceraldehyde-3-phosphate dehydrogenase A; Provis | 100.0 | |
| PRK08289 | 477 | glyceraldehyde-3-phosphate dehydrogenase; Reviewed | 100.0 | |
| PRK07403 | 337 | glyceraldehyde-3-phosphate dehydrogenase; Reviewed | 100.0 | |
| COG0057 | 335 | GapA Glyceraldehyde-3-phosphate dehydrogenase/eryt | 100.0 | |
| PRK15425 | 331 | gapA glyceraldehyde-3-phosphate dehydrogenase A; P | 100.0 | |
| PRK07729 | 343 | glyceraldehyde-3-phosphate dehydrogenase; Validate | 100.0 | |
| PTZ00023 | 337 | glyceraldehyde-3-phosphate dehydrogenase; Provisio | 100.0 | |
| PLN02272 | 421 | glyceraldehyde-3-phosphate dehydrogenase | 100.0 | |
| TIGR01534 | 327 | GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, | 100.0 | |
| PTZ00353 | 342 | glycosomal glyceraldehyde-3-phosphate dehydrogenas | 100.0 | |
| PRK13535 | 336 | erythrose 4-phosphate dehydrogenase; Provisional | 100.0 | |
| PLN02358 | 338 | glyceraldehyde-3-phosphate dehydrogenase | 100.0 | |
| PRK08955 | 334 | glyceraldehyde-3-phosphate dehydrogenase; Validate | 100.0 | |
| TIGR01532 | 325 | E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas | 100.0 | |
| KOG0657 | 285 | consensus Glyceraldehyde 3-phosphate dehydrogenase | 100.0 | |
| PF00044 | 151 | Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, | 100.0 | |
| smart00846 | 149 | Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, | 100.0 | |
| TIGR01546 | 333 | GAPDH-II_archae glyceraldehyde-3-phosphate dehydro | 100.0 | |
| PRK04207 | 341 | glyceraldehyde-3-phosphate dehydrogenase; Provisio | 100.0 | |
| PRK14874 | 334 | aspartate-semialdehyde dehydrogenase; Provisional | 99.93 | |
| TIGR01296 | 339 | asd_B aspartate-semialdehyde dehydrogenase (peptid | 99.92 | |
| PRK06901 | 322 | aspartate-semialdehyde dehydrogenase; Provisional | 99.92 | |
| TIGR01745 | 366 | asd_gamma aspartate-semialdehyde dehydrogenase, ga | 99.87 | |
| COG0136 | 334 | Asd Aspartate-semialdehyde dehydrogenase [Amino ac | 99.87 | |
| PRK08040 | 336 | putative semialdehyde dehydrogenase; Provisional | 99.78 | |
| PRK06728 | 347 | aspartate-semialdehyde dehydrogenase; Provisional | 99.78 | |
| PRK06598 | 369 | aspartate-semialdehyde dehydrogenase; Reviewed | 99.77 | |
| PLN02383 | 344 | aspartate semialdehyde dehydrogenase | 99.73 | |
| PRK08664 | 349 | aspartate-semialdehyde dehydrogenase; Reviewed | 99.72 | |
| TIGR00978 | 341 | asd_EA aspartate-semialdehyde dehydrogenase (non-p | 99.72 | |
| PRK05671 | 336 | aspartate-semialdehyde dehydrogenase; Reviewed | 99.71 | |
| PF02800 | 157 | Gp_dh_C: Glyceraldehyde 3-phosphate dehydrogenase, | 99.57 | |
| PRK00436 | 343 | argC N-acetyl-gamma-glutamyl-phosphate reductase; | 99.54 | |
| TIGR01850 | 346 | argC N-acetyl-gamma-glutamyl-phosphate reductase, | 99.47 | |
| PLN02968 | 381 | Probable N-acetyl-gamma-glutamyl-phosphate reducta | 99.41 | |
| PRK11863 | 313 | N-acetyl-gamma-glutamyl-phosphate reductase; Provi | 99.41 | |
| PRK08300 | 302 | acetaldehyde dehydrogenase; Validated | 99.35 | |
| KOG4777 | 361 | consensus Aspartate-semialdehyde dehydrogenase [Am | 99.29 | |
| TIGR01851 | 310 | argC_other N-acetyl-gamma-glutamyl-phosphate reduc | 99.22 | |
| TIGR03215 | 285 | ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati | 99.07 | |
| PF01118 | 121 | Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi | 98.7 | |
| smart00859 | 122 | Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin | 97.76 | |
| COG0002 | 349 | ArgC Acetylglutamate semialdehyde dehydrogenase [A | 97.68 | |
| PRK13301 | 267 | putative L-aspartate dehydrogenase; Provisional | 97.67 | |
| PRK13303 | 265 | L-aspartate dehydrogenase; Provisional | 97.32 | |
| PRK06270 | 341 | homoserine dehydrogenase; Provisional | 97.18 | |
| TIGR00036 | 266 | dapB dihydrodipicolinate reductase. | 97.14 | |
| TIGR01921 | 324 | DAP-DH diaminopimelate dehydrogenase. This model r | 97.04 | |
| PRK13304 | 265 | L-aspartate dehydrogenase; Reviewed | 96.81 | |
| PF01113 | 124 | DapB_N: Dihydrodipicolinate reductase, N-terminus; | 96.81 | |
| COG1712 | 255 | Predicted dinucleotide-utilizing enzyme [General f | 96.67 | |
| PRK00048 | 257 | dihydrodipicolinate reductase; Provisional | 96.67 | |
| PRK06392 | 326 | homoserine dehydrogenase; Provisional | 96.58 | |
| PRK13302 | 271 | putative L-aspartate dehydrogenase; Provisional | 96.55 | |
| PRK08374 | 336 | homoserine dehydrogenase; Provisional | 96.47 | |
| COG0460 | 333 | ThrA Homoserine dehydrogenase [Amino acid transpor | 96.46 | |
| PRK06813 | 346 | homoserine dehydrogenase; Validated | 96.17 | |
| PRK06349 | 426 | homoserine dehydrogenase; Provisional | 96.16 | |
| PRK11579 | 346 | putative oxidoreductase; Provisional | 95.87 | |
| COG0289 | 266 | DapB Dihydrodipicolinate reductase [Amino acid tra | 95.78 | |
| cd01076 | 227 | NAD_bind_1_Glu_DH NAD(P) binding domain of glutama | 95.75 | |
| COG2344 | 211 | AT-rich DNA-binding protein [General function pred | 95.75 | |
| PF01408 | 120 | GFO_IDH_MocA: Oxidoreductase family, NAD-binding R | 95.69 | |
| PF03447 | 117 | NAD_binding_3: Homoserine dehydrogenase, NAD bindi | 95.45 | |
| COG4569 | 310 | MhpF Acetaldehyde dehydrogenase (acetylating) [Sec | 95.4 | |
| cd05211 | 217 | NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of | 94.96 | |
| cd05313 | 254 | NAD_bind_2_Glu_DH NAD(P) binding domain of glutama | 94.6 | |
| PRK05447 | 385 | 1-deoxy-D-xylulose 5-phosphate reductoisomerase; P | 94.5 | |
| PRK09414 | 445 | glutamate dehydrogenase; Provisional | 94.36 | |
| PF02826 | 178 | 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy | 94.3 | |
| PLN02477 | 410 | glutamate dehydrogenase | 93.72 | |
| PLN02700 | 377 | homoserine dehydrogenase family protein | 93.53 | |
| PRK10206 | 344 | putative oxidoreductase; Provisional | 93.44 | |
| PRK05472 | 213 | redox-sensing transcriptional repressor Rex; Provi | 93.37 | |
| PLN02696 | 454 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | 93.12 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 93.03 | |
| PLN02775 | 286 | Probable dihydrodipicolinate reductase | 93.0 | |
| PRK14030 | 445 | glutamate dehydrogenase; Provisional | 92.76 | |
| PRK09466 | 810 | metL bifunctional aspartate kinase II/homoserine d | 92.72 | |
| PRK09436 | 819 | thrA bifunctional aspartokinase I/homoserine dehyd | 92.62 | |
| COG4091 | 438 | Predicted homoserine dehydrogenase [Amino acid tra | 92.44 | |
| PRK08410 | 311 | 2-hydroxyacid dehydrogenase; Provisional | 92.35 | |
| PTZ00079 | 454 | NADP-specific glutamate dehydrogenase; Provisional | 91.99 | |
| PRK06487 | 317 | glycerate dehydrogenase; Provisional | 91.78 | |
| PF03807 | 96 | F420_oxidored: NADP oxidoreductase coenzyme F420-d | 91.52 | |
| TIGR03736 | 244 | PRTRC_ThiF PRTRC system ThiF family protein. A nov | 91.3 | |
| PRK06932 | 314 | glycerate dehydrogenase; Provisional | 91.05 | |
| COG0673 | 342 | MviM Predicted dehydrogenases and related proteins | 90.71 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 90.45 | |
| COG0111 | 324 | SerA Phosphoglycerate dehydrogenase and related de | 90.26 | |
| PLN02928 | 347 | oxidoreductase family protein | 90.09 | |
| PRK11790 | 409 | D-3-phosphoglycerate dehydrogenase; Provisional | 89.62 | |
| PRK15409 | 323 | bifunctional glyoxylate/hydroxypyruvate reductase | 89.49 | |
| PRK06436 | 303 | glycerate dehydrogenase; Provisional | 89.47 | |
| PRK13243 | 333 | glyoxylate reductase; Reviewed | 89.29 | |
| PRK07574 | 385 | formate dehydrogenase; Provisional | 89.26 | |
| TIGR02130 | 275 | dapB_plant dihydrodipicolinate reductase. This nar | 88.94 | |
| COG2910 | 211 | Putative NADH-flavin reductase [General function p | 88.59 | |
| PRK15469 | 312 | ghrA bifunctional glyoxylate/hydroxypyruvate reduc | 88.2 | |
| PLN02306 | 386 | hydroxypyruvate reductase | 87.9 | |
| COG1052 | 324 | LdhA Lactate dehydrogenase and related dehydrogena | 87.84 | |
| PTZ00117 | 319 | malate dehydrogenase; Provisional | 87.61 | |
| PRK08229 | 341 | 2-dehydropantoate 2-reductase; Provisional | 87.54 | |
| PF03435 | 386 | Saccharop_dh: Saccharopine dehydrogenase ; InterPr | 87.43 | |
| CHL00194 | 317 | ycf39 Ycf39; Provisional | 87.39 | |
| PRK05476 | 425 | S-adenosyl-L-homocysteine hydrolase; Provisional | 87.29 | |
| PRK15438 | 378 | erythronate-4-phosphate dehydrogenase PdxB; Provis | 87.11 | |
| PLN03139 | 386 | formate dehydrogenase; Provisional | 87.0 | |
| PF05368 | 233 | NmrA: NmrA-like family; InterPro: IPR008030 NmrA i | 86.88 | |
| PRK12480 | 330 | D-lactate dehydrogenase; Provisional | 86.09 | |
| PF03446 | 163 | NAD_binding_2: NAD binding domain of 6-phosphogluc | 86.05 | |
| cd08230 | 355 | glucose_DH Glucose dehydrogenase. Glucose dehydrog | 85.95 | |
| KOG1502 | 327 | consensus Flavonol reductase/cinnamoyl-CoA reducta | 85.77 | |
| TIGR03649 | 285 | ergot_EASG ergot alkaloid biosynthesis protein, AF | 85.7 | |
| COG1063 | 350 | Tdh Threonine dehydrogenase and related Zn-depende | 85.54 | |
| PRK14031 | 444 | glutamate dehydrogenase; Provisional | 85.37 | |
| PF02629 | 96 | CoA_binding: CoA binding domain; InterPro: IPR0037 | 84.19 | |
| PLN02819 | 1042 | lysine-ketoglutarate reductase/saccharopine dehydr | 84.04 | |
| PLN00016 | 378 | RNA-binding protein; Provisional | 83.81 | |
| PLN00106 | 323 | malate dehydrogenase | 83.75 | |
| PRK11880 | 267 | pyrroline-5-carboxylate reductase; Reviewed | 83.73 | |
| TIGR01202 | 308 | bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl | 83.38 | |
| PRK00257 | 381 | erythronate-4-phosphate dehydrogenase; Validated | 83.3 | |
| TIGR01327 | 525 | PGDH D-3-phosphoglycerate dehydrogenase. This mode | 83.22 | |
| PRK13581 | 526 | D-3-phosphoglycerate dehydrogenase; Provisional | 83.08 | |
| PRK06522 | 304 | 2-dehydropantoate 2-reductase; Reviewed | 83.0 | |
| PF10727 | 127 | Rossmann-like: Rossmann-like domain; InterPro: IPR | 82.97 | |
| PRK08306 | 296 | dipicolinate synthase subunit A; Reviewed | 82.83 | |
| PF00056 | 141 | Ldh_1_N: lactate/malate dehydrogenase, NAD binding | 82.3 | |
| PF13380 | 116 | CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 | 82.15 | |
| cd01483 | 143 | E1_enzyme_family Superfamily of activating enzymes | 82.13 | |
| PRK08605 | 332 | D-lactate dehydrogenase; Validated | 82.03 | |
| COG0039 | 313 | Mdh Malate/lactate dehydrogenases [Energy producti | 81.87 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 81.63 | |
| PRK13403 | 335 | ketol-acid reductoisomerase; Provisional | 81.38 | |
| COG3804 | 350 | Uncharacterized conserved protein related to dihyd | 81.36 | |
| COG0771 | 448 | MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas | 81.02 | |
| PTZ00082 | 321 | L-lactate dehydrogenase; Provisional | 80.81 |
| >PLN02237 glyceraldehyde-3-phosphate dehydrogenase B | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.4e-84 Score=643.36 Aligned_cols=291 Identities=80% Similarity=1.201 Sum_probs=267.2
Q ss_pred cccCCCCCCCCcccccCCCCCCCCCCcccccccccccccCccccccccccccCCCcCHHHHHHhhcccccccCCCCcccc
Q 020217 3 SHSALAPSRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLTPKVAAGSVPVKKE 82 (329)
Q Consensus 3 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 82 (329)
+|||||++|||+++|++|+++ .++.+|++|+|||++++++|.....+.+|.+.+..++..+. .+....+..
T Consensus 1 ~~~~~~~~~~~~~~~~~~~~~--------~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~ 71 (442)
T PLN02237 1 THAALASSRIPATTRLPSKAS--------HKRLEVAEFSGLRASSCVTFAKNAREASFFDVVASQLAPKV-AGSTPVRGE 71 (442)
T ss_pred CcchhcccCCccccccccccc--------cccccccccccccccccccccccccchhHHHHhhhhhhhhh-ccccccccc
Confidence 699999999999999999986 26778999999999999999877788899999999998765 334455667
Q ss_pred ccCeeeEEEEcCChhHHHHHHHHHhCCCCCceEEEEeCCCChhhhhhhccccccccccCceEEEecCCeEEECCeEEEEE
Q 020217 83 TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVV 162 (329)
Q Consensus 83 ~~~~vkVaInGfGRIGR~vlR~l~~r~~~~l~vVaInd~~d~~~~ayLLkyDS~hG~F~g~V~v~~~~~L~inGk~I~V~ 162 (329)
++|++||||||||||||+++|+++++.+++++||+|||+.++++++|||||||+||+|+++|++.+++.|.+||+.|+|+
T Consensus 72 ~~~~ikVgINGFGRIGR~vlR~~~~~~~~~ievVaINd~~~~~~~ayLlkyDS~hG~f~~~v~~~~~~~L~v~Gk~I~V~ 151 (442)
T PLN02237 72 TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSMLGTFKADVKIVDDETISVDGKPIKVV 151 (442)
T ss_pred ccceEEEEEECCChHHHHHHHHHHHccCCCeEEEEECCCCCHHHHHHHHccccCCCCcCCceEECCCCEEEECCEEEEEE
Confidence 78989999999999999999998875435699999999999999999999999999999999864578899999999999
Q ss_pred ecCCCCCCCCccCCCcEEEcCCCCCCChhhHHHHHHcCCCEEEEeCCCCCCCCCeEEeccCccccCCCCCceEEcCCchh
Q 020217 163 SNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTT 242 (329)
Q Consensus 163 ~~~~P~~idW~~~GiDiVvesTG~f~~~e~a~~Hl~aGakkVIISAPsk~~DiP~iV~GVN~~~~~~~~~~IISnASCTT 242 (329)
++++|.++||+++|+||||||||.|+++++++.|+++|||||+||+|++++|+|+||||||++.|++.+++|||||||||
T Consensus 152 ~~~dp~~l~W~~~gVDiViE~TG~f~s~e~a~~hl~aGAkkV~iSAP~~d~dvptvV~GVN~~~~~~~~~~IISnaSCTT 231 (442)
T PLN02237 152 SNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEDDYDHEVANIVSNASCTT 231 (442)
T ss_pred EcCCchhCChhhcCCCEEEEccChhhhHHHHHHHHhCCCEEEEECCCCCCCCCceEecccCHHHhCcCCCCEEECCchHH
Confidence 99999999999999999999999999999999999999999999999987678999999999999864378999999999
Q ss_pred hhhhhHHHhhhhhcCceEEEEEEEeeccCCCCCCC-CCcchhhhhccccccCCCchhhhcc
Q 020217 243 NCLAPFVKVMDEELGIVKGAMTTTHSYTGDQALGC-FTQGLEESESCSVEHCPNEHRCRQG 302 (329)
Q Consensus 243 n~LaPvlKvL~d~fGI~~g~vTTvHa~T~dQ~l~D-~~~d~~r~r~a~~~i~p~~~~~~~~ 302 (329)
|||+|++|+|||+|||++|+|||||+||+||+++| +|+||||+|+|++||||++.---+.
T Consensus 232 NcLAPvlkvL~d~fGI~~g~mTTvHs~T~dQ~~~D~~h~D~Rr~Raaa~nIIPtsTGAAkA 292 (442)
T PLN02237 232 NCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKA 292 (442)
T ss_pred HHHHHHHHHHHHhcCeeEEEEEEEEeccCCcccccCCCcccccccccccccccCCcchhhh
Confidence 99999999999999999999999999999999999 9999999999999999998765443
|
|
| >PTZ00434 cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional | Back alignment and domain information |
|---|
| >PRK08289 glyceraldehyde-3-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK07403 glyceraldehyde-3-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15425 gapA glyceraldehyde-3-phosphate dehydrogenase A; Provisional | Back alignment and domain information |
|---|
| >PRK07729 glyceraldehyde-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PTZ00023 glyceraldehyde-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02272 glyceraldehyde-3-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01534 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, type I | Back alignment and domain information |
|---|
| >PTZ00353 glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13535 erythrose 4-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02358 glyceraldehyde-3-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >KOG0657 consensus Glyceraldehyde 3-phosphate dehydrogenase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF00044 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; InterPro: IPR020828 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate | Back alignment and domain information |
|---|
| >smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain | Back alignment and domain information |
|---|
| >TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II | Back alignment and domain information |
|---|
| >PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14874 aspartate-semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) | Back alignment and domain information |
|---|
| >PRK06901 aspartate-semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial | Back alignment and domain information |
|---|
| >COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08040 putative semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06728 aspartate-semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PLN02383 aspartate semialdehyde dehydrogenase | Back alignment and domain information |
|---|
| >PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) | Back alignment and domain information |
|---|
| >PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF02800 Gp_dh_C: Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain; InterPro: IPR020829 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate | Back alignment and domain information |
|---|
| >PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated | Back alignment and domain information |
|---|
| >TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form | Back alignment and domain information |
|---|
| >PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase | Back alignment and domain information |
|---|
| >PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08300 acetaldehyde dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG4777 consensus Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form | Back alignment and domain information |
|---|
| >TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) | Back alignment and domain information |
|---|
| >PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate | Back alignment and domain information |
|---|
| >smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain | Back alignment and domain information |
|---|
| >COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13301 putative L-aspartate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13303 L-aspartate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06270 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00036 dapB dihydrodipicolinate reductase | Back alignment and domain information |
|---|
| >TIGR01921 DAP-DH diaminopimelate dehydrogenase | Back alignment and domain information |
|---|
| >PRK13304 L-aspartate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] | Back alignment and domain information |
|---|
| >COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00048 dihydrodipicolinate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06392 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13302 putative L-aspartate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08374 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06813 homoserine dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06349 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11579 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 | Back alignment and domain information |
|---|
| >COG2344 AT-rich DNA-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot | Back alignment and domain information |
|---|
| >PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway | Back alignment and domain information |
|---|
| >COG4569 MhpF Acetaldehyde dehydrogenase (acetylating) [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 | Back alignment and domain information |
|---|
| >PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PRK09414 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related | Back alignment and domain information |
|---|
| >PLN02477 glutamate dehydrogenase | Back alignment and domain information |
|---|
| >PLN02700 homoserine dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK10206 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK05472 redox-sensing transcriptional repressor Rex; Provisional | Back alignment and domain information |
|---|
| >PLN02696 1-deoxy-D-xylulose-5-phosphate reductoisomerase | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02775 Probable dihydrodipicolinate reductase | Back alignment and domain information |
|---|
| >PRK14030 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional | Back alignment and domain information |
|---|
| >PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional | Back alignment and domain information |
|---|
| >COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08410 2-hydroxyacid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PTZ00079 NADP-specific glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06487 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain | Back alignment and domain information |
|---|
| >TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein | Back alignment and domain information |
|---|
| >PRK06932 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02928 oxidoreductase family protein | Back alignment and domain information |
|---|
| >PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional | Back alignment and domain information |
|---|
| >PRK06436 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13243 glyoxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK07574 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02130 dapB_plant dihydrodipicolinate reductase | Back alignment and domain information |
|---|
| >COG2910 Putative NADH-flavin reductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional | Back alignment and domain information |
|---|
| >PLN02306 hydroxypyruvate reductase | Back alignment and domain information |
|---|
| >COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00117 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08229 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase | Back alignment and domain information |
|---|
| >CHL00194 ycf39 Ycf39; Provisional | Back alignment and domain information |
|---|
| >PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional | Back alignment and domain information |
|---|
| >PLN03139 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA | Back alignment and domain information |
|---|
| >PRK12480 D-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 | Back alignment and domain information |
|---|
| >cd08230 glucose_DH Glucose dehydrogenase | Back alignment and domain information |
|---|
| >KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family | Back alignment and domain information |
|---|
| >COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK14031 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases | Back alignment and domain information |
|---|
| >PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase | Back alignment and domain information |
|---|
| >PLN00016 RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >PLN00106 malate dehydrogenase | Back alignment and domain information |
|---|
| >PRK11880 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase | Back alignment and domain information |
|---|
| >PRK00257 erythronate-4-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase | Back alignment and domain information |
|---|
| >PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06522 2-dehydropantoate 2-reductase; Reviewed | Back alignment and domain information |
|---|
| >PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PRK08306 dipicolinate synthase subunit A; Reviewed | Back alignment and domain information |
|---|
| >PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] | Back alignment and domain information |
|---|
| >PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A | Back alignment and domain information |
|---|
| >cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins | Back alignment and domain information |
|---|
| >PRK08605 D-lactate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13403 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >COG3804 Uncharacterized conserved protein related to dihydrodipicolinate reductase [Function unknown] | Back alignment and domain information |
|---|
| >COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PTZ00082 L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 329 | ||||
| 2pkq_O | 368 | Crystal Structure Of The Photosynthetic A2b2-Glycer | 1e-102 | ||
| 1nbo_O | 337 | The Dual Coenzyme Specificity Of Photosynthetic Gly | 2e-85 | ||
| 1rm5_O | 337 | Crystal Structure Of Mutant S188a Of Photosynthetic | 2e-85 | ||
| 1rm3_O | 337 | Crystal Structure Of Mutant T33a Of Photosynthetic | 2e-85 | ||
| 2pkr_O | 365 | Crystal Structure Of (A+cte)4 Chimeric Form Of Phot | 3e-85 | ||
| 3k2b_A | 337 | Crystal Structure Of Photosynthetic A4 Isoform Glyc | 3e-83 | ||
| 1jn0_O | 335 | Crystal Structure Of The Non-Regulatory A4 Isoform | 2e-81 | ||
| 3b1j_A | 339 | Crystal Structure Of Dehydrogenese Length = 339 | 1e-66 | ||
| 2d2i_A | 380 | Crystal Structure Of Nadp-Dependent Glyceraldehyde- | 6e-66 | ||
| 2ep7_A | 342 | Structural Study Of Project Id Aq_1065 From Aquifex | 5e-56 | ||
| 3dbv_O | 334 | Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit | 2e-53 | ||
| 1gd1_O | 334 | Structure Of Holo-Glyceraldehyde-3-Phosphate Dehydr | 3e-51 | ||
| 1dbv_O | 334 | Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit | 3e-50 | ||
| 1npt_O | 334 | Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit | 3e-50 | ||
| 1nq5_O | 334 | Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit | 3e-50 | ||
| 1cer_O | 331 | Determinants Of Enzyme Thermostability Observed In | 2e-49 | ||
| 4dib_A | 345 | The Crystal Structure Of Glyceraldehyde-3-Phosphate | 2e-48 | ||
| 2g82_O | 331 | High Resolution Structures Of Thermus Aquaticus Gly | 2e-48 | ||
| 1hdg_O | 332 | The Crystal Structure Of Holo-glyceraldehyde-3-phos | 2e-48 | ||
| 1vc2_A | 331 | Crystal Structure Of Glyceraldehyde 3-Phosphate Deh | 4e-48 | ||
| 3l0d_A | 356 | Crystal Structure Of Glyceraldehyde-3-phosphate Deh | 4e-47 | ||
| 3hja_A | 356 | Crystal Structure Of Glyceraldehyde-3-Phosphate Deh | 9e-46 | ||
| 3gnq_A | 344 | Crystal Structure Of Glyceraldehyde-3-Phosphate Deh | 6e-45 | ||
| 3doc_A | 335 | Crystal Structure Of Trka Glyceraldehyde-3-Phosphat | 9e-45 | ||
| 2i5p_O | 342 | Crystal Structure Of Glyceraldehyde-3-Phosphate Deh | 2e-44 | ||
| 1obf_O | 335 | The Crystal Structure Of Glyceraldehyde 3-Phosphate | 1e-42 | ||
| 1vsu_A | 359 | Crystal Structure Of Apo-Glyceraldehyde 3-Phosphate | 2e-42 | ||
| 3cps_A | 354 | Crystal Structure Of Cryptosporidium Parvum Glycera | 2e-42 | ||
| 3cif_A | 359 | Crystal Structure Of C153s Mutant Glyceraldehyde 3- | 2e-41 | ||
| 3k73_Q | 336 | Crystal Structure Of Phosphate Bound Holo Glycerald | 3e-41 | ||
| 3vaz_P | 344 | Crystal Structure Of Staphylococcal Gapdh1 In A Hex | 4e-41 | ||
| 3lvf_P | 338 | Crystal Structure Of Holo Glyceraldehyde-3-Phosphat | 4e-41 | ||
| 3lc7_O | 339 | Crystal Structure Of Apo Glyceraldehyde-3-Phosphate | 4e-41 | ||
| 1gae_O | 330 | Comparison Of The Structures Of Wild Type And A N31 | 5e-41 | ||
| 1s7c_A | 331 | Crystal Structure Of Mes Buffer Bound Form Of Glyce | 6e-41 | ||
| 1gad_O | 330 | Comparison Of The Structures Of Wild Type And A N31 | 7e-41 | ||
| 3lc1_P | 336 | Crystal Structure Of H178n Mutant Of Glyceraldehyde | 2e-40 | ||
| 3pym_A | 332 | Structure Of Gapdh 3 From S.Cerevisiae At 2.0 A Res | 3e-40 | ||
| 3hq4_R | 336 | Crystal Structure Of C151s Mutant Of Glyceraldehyde | 3e-40 | ||
| 4iq8_A | 340 | Crystal Structure Of Glyceraldehyde-3-phosphate Deh | 3e-40 | ||
| 3k9q_Q | 336 | Crsytal Strcuture Of C151g Mutant Of Glyceraldehyde | 6e-40 | ||
| 3e5r_O | 337 | Crystal Structure And Functional Analysis Of Glycer | 7e-40 | ||
| 2vyn_A | 331 | Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotet | 8e-40 | ||
| 3e6a_O | 336 | Crystal Structure And Functional Analysis Of Glycer | 1e-39 | ||
| 1ywg_O | 337 | The Structure Of Glyceraldehyde-3-Phosphate Dehydro | 2e-39 | ||
| 2b4r_O | 345 | Crystal Structure Of Glyceraldehyde-3-Phosphate Deh | 2e-39 | ||
| 3ksd_Q | 336 | Crystal Structure Of C151s+h178n Mutant Of Glyceral | 2e-39 | ||
| 3h9e_B | 346 | Crystal Structure Of Human Sperm-Specific Glycerald | 3e-39 | ||
| 1znq_O | 338 | Crsytal Structure Of Human Liver Gapdh Length = 338 | 4e-38 | ||
| 1u8f_O | 335 | Crystal Structure Of Human Placental Glyceraldehyde | 4e-38 | ||
| 2x0n_A | 359 | Structure Of Glycosomal Glyceraldehyde-3-Phosphate | 7e-37 | ||
| 1j0x_O | 332 | Crystal Structure Of The Rabbit Muscle Glyceraldehy | 1e-36 | ||
| 1ihx_A | 333 | Crystal Structure Of Two D-Glyceraldehyde-3-Phospha | 2e-36 | ||
| 1dc4_A | 330 | Structural Analysis Of Glyceraldehyde 3-Phosphate D | 2e-36 | ||
| 1a7k_A | 360 | Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase | 2e-36 | ||
| 1gyp_A | 358 | Crystal Structure Of Glycosomal Glyceraldehyde-3-Ph | 2e-36 | ||
| 2vyn_D | 334 | Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotet | 3e-36 | ||
| 1szj_G | 333 | Structure Of Holo-Glyceraldehyde-3-Phosphate-Dehydr | 4e-36 | ||
| 1gpd_G | 334 | Studies Of Asymmetry In The Three-Dimensional Struc | 7e-36 | ||
| 4gpd_1 | 333 | The Structure Of Lobster Apo-D-Glyceraldehyde-3-Pho | 7e-36 | ||
| 3gpd_R | 334 | Twinning In Crystals Of Human Skeletal Muscle D-Gly | 1e-35 | ||
| 1k3t_A | 359 | Structure Of Glycosomal Glyceraldehyde-3-Phosphate | 1e-35 | ||
| 1dss_G | 333 | Structure Of Active-Site Carboxymethylated D-Glycer | 6e-35 | ||
| 3sth_A | 361 | Crystal Structure Of Glyceraldehyde-3-Phosphate Deh | 7e-35 | ||
| 3dmt_C | 359 | Structure Of Glycosomal Glyceraldehyde-3-Phosphate | 1e-34 | ||
| 2xf8_A | 338 | Structure Of The D-Erythrose-4-Phosphate Dehydrogen | 5e-34 | ||
| 2x5j_O | 339 | Crystal Structure Of The Apoform Of The D-Erythrose | 5e-34 | ||
| 2x5k_O | 339 | Structure Of An Active Site Mutant Of The D-Erythro | 4e-32 |
| >pdb|2PKQ|O Chain O, Crystal Structure Of The Photosynthetic A2b2-Glyceraldehyde-3- Phosphate Dehydrogenase, Complexed With Nadp Length = 368 | Back alignment and structure |
|
| >pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase Interpreted By The Crystal Structure Of A4 Isoform Complexed With Nad Length = 337 | Back alignment and structure |
| >pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp Length = 337 | Back alignment and structure |
| >pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp Length = 337 | Back alignment and structure |
| >pdb|2PKR|O Chain O, Crystal Structure Of (A+cte)4 Chimeric Form Of Photosyntetic Glyceraldehyde-3-Phosphate Dehydrogenase, Complexed With Nadp Length = 365 | Back alignment and structure |
| >pdb|3K2B|A Chain A, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- Phosphate Dehydrogenase Complexed With Nad, From Arabidopsis Thaliana Length = 337 | Back alignment and structure |
| >pdb|1JN0|O Chain O, Crystal Structure Of The Non-Regulatory A4 Isoform Of Spinach Chloroplast Glyceraldehyde-3-Phosphate Dehydrogenase Complexed With Nadp Length = 335 | Back alignment and structure |
| >pdb|3B1J|A Chain A, Crystal Structure Of Dehydrogenese Length = 339 | Back alignment and structure |
| >pdb|2D2I|A Chain A, Crystal Structure Of Nadp-Dependent Glyceraldehyde-3- Phosphate Dehydrogenase From Synechococcus Sp. Complexed With Nadp+ Length = 380 | Back alignment and structure |
| >pdb|2EP7|A Chain A, Structural Study Of Project Id Aq_1065 From Aquifex Aeolicus Vf5 Length = 342 | Back alignment and structure |
| >pdb|3DBV|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Leu 33 Replaced By Thr, Thr 34 Replaced By Gly, Asp 36 Replaced By Gly, Leu 187 Replaced By Ala, And Pro 188 Replaced By Ser Complexed With Nad+ Length = 334 | Back alignment and structure |
| >pdb|1GD1|O Chain O, Structure Of Holo-Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Stearothermophilus At 1.8 Angstroms Resolution Length = 334 | Back alignment and structure |
| >pdb|1DBV|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Asp 32 Replaced By Gly, Leu 187 Replaced By Ala, And Pro 188 Replaced By Ser Complexed With Nad+ Length = 334 | Back alignment and structure |
| >pdb|1NPT|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 Replaced By Ala Complexed With Nad+ Length = 334 | Back alignment and structure |
| >pdb|1NQ5|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 Replaced By Ser Complexed With Nad+ Length = 334 | Back alignment and structure |
| >pdb|1CER|O Chain O, Determinants Of Enzyme Thermostability Observed In The Molecular Structure Of Thermus Aquaticus D-Glyceraldehyde- 3-Phosphate Dehydrogenase At 2.5 Angstroms Resolution Length = 331 | Back alignment and structure |
| >pdb|4DIB|A Chain A, The Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Anthracis Str. Sterne Length = 345 | Back alignment and structure |
| >pdb|2G82|O Chain O, High Resolution Structures Of Thermus Aquaticus Glyceraldehyde-3- Phosphate Dehydrogenase: Role Of 220's Loop Motion In Catalysis Length = 331 | Back alignment and structure |
| >pdb|1HDG|O Chain O, The Crystal Structure Of Holo-glyceraldehyde-3-phosphate Dehydrogenase From The Hyperthermophilic Bacterium Thermotoga Maritima At 2.5 Angstroms Resolution Length = 332 | Back alignment and structure |
| >pdb|1VC2|A Chain A, Crystal Structure Of Glyceraldehyde 3-Phosphate Dehydrogenase From Thermus Thermophilus Hb8 Length = 331 | Back alignment and structure |
| >pdb|3L0D|A Chain A, Crystal Structure Of Glyceraldehyde-3-phosphate Dehydrogenase From Bartonella Henselae With Bound Nad Length = 356 | Back alignment and structure |
| >pdb|3HJA|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Borrelia Burgdorferi Length = 356 | Back alignment and structure |
| >pdb|3GNQ|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase, Type I From Burkholderia Pseudomallei Length = 344 | Back alignment and structure |
| >pdb|3DOC|A Chain A, Crystal Structure Of Trka Glyceraldehyde-3-Phosphate Dehydrogenase From Brucella Melitensis Length = 335 | Back alignment and structure |
| >pdb|2I5P|O Chain O, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase Isoform 1 From K. Marxianus Length = 342 | Back alignment and structure |
| >pdb|1OBF|O Chain O, The Crystal Structure Of Glyceraldehyde 3-Phosphate Dehydrogenase From Alcaligenes Xylosoxidans At 1.7 Resolution. Length = 335 | Back alignment and structure |
| >pdb|1VSU|A Chain A, Crystal Structure Of Apo-Glyceraldehyde 3-Phosphate Dehydrogenase From Cryptosporidium Parvum Length = 359 | Back alignment and structure |
| >pdb|3CPS|A Chain A, Crystal Structure Of Cryptosporidium Parvum Glyceraldehyde-3-Phosphate Dehydrogenase Length = 354 | Back alignment and structure |
| >pdb|3CIF|A Chain A, Crystal Structure Of C153s Mutant Glyceraldehyde 3-Phosphate Dehydrogenase From Cryptosporidium Parvum Length = 359 | Back alignment and structure |
| >pdb|3K73|Q Chain Q, Crystal Structure Of Phosphate Bound Holo Glyceraldehyde-3-Phosphate Dehydrogenase 1 From Mrsa252 At 2.5 Angstrom Resolution Length = 336 | Back alignment and structure |
| >pdb|3VAZ|P Chain P, Crystal Structure Of Staphylococcal Gapdh1 In A Hexagonal Space Group Length = 344 | Back alignment and structure |
| >pdb|3LVF|P Chain P, Crystal Structure Of Holo Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) From Methicillin Resistant Staphylococcus Aureus Mrsa252 At 1.7 Angstrom Resolution Length = 338 | Back alignment and structure |
| >pdb|3LC7|O Chain O, Crystal Structure Of Apo Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) From Methicllin Resistant Staphylococcus Aureus (Mrsa252) Length = 339 | Back alignment and structure |
| >pdb|1GAE|O Chain O, Comparison Of The Structures Of Wild Type And A N313t Mutant Of Escherichia Coli Glyceraldehyde 3-Phosphate Dehydrogenases: Implication For Nad Binding And Cooperativity Length = 330 | Back alignment and structure |
| >pdb|1S7C|A Chain A, Crystal Structure Of Mes Buffer Bound Form Of Glyceraldehyde 3- Phosphate Dehydrogenase From Escherichia Coli Length = 331 | Back alignment and structure |
| >pdb|1GAD|O Chain O, Comparison Of The Structures Of Wild Type And A N313t Mutant Of Escherichia Coli Glyceraldehyde 3-Phosphate Dehydrogenases: Implication For Nad Binding And Cooperativity Length = 330 | Back alignment and structure |
| >pdb|3LC1|P Chain P, Crystal Structure Of H178n Mutant Of Glyceraldehyde-3-Phosphate- Dehydrogenase 1 (Gapdh 1) From Staphylococcus Aureus Mrsa252 Complexed With Nad At 2.0 Angstrom Resolution. Length = 336 | Back alignment and structure |
| >pdb|3PYM|A Chain A, Structure Of Gapdh 3 From S.Cerevisiae At 2.0 A Resolution Length = 332 | Back alignment and structure |
| >pdb|3HQ4|R Chain R, Crystal Structure Of C151s Mutant Of Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) Complexed With Nad From Staphylococcus Aureus Mrsa252 At 2.2 Angstrom Resolution Length = 336 | Back alignment and structure |
| >pdb|4IQ8|A Chain A, Crystal Structure Of Glyceraldehyde-3-phosphate Dehydrogenase 3 From Saccharomyces Cerevisiae Length = 340 | Back alignment and structure |
| >pdb|3K9Q|Q Chain Q, Crsytal Strcuture Of C151g Mutant Of Glyceraldehyde 3-Phosphate Dehydrogenase 1 From Methicillin Resistant Staphylococcus Aureus (Mrsa252) At 2.5 Angstrom Resolution Length = 336 | Back alignment and structure |
| >pdb|3E5R|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 3-Phosphate Dehydrogenase From Oryza Sativa Length = 337 | Back alignment and structure |
| >pdb|2VYN|A Chain A, Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotetramer Length = 331 | Back alignment and structure |
| >pdb|3E6A|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 3-Phosphate Dehydrogenase From Oryza Sativa Length = 336 | Back alignment and structure |
| >pdb|1YWG|O Chain O, The Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Plasmodium Falciparum Length = 337 | Back alignment and structure |
| >pdb|2B4R|O Chain O, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Plasmodium Falciparum At 2.25 Angstrom Resolution Reveals Intriguing Extra Electron Density In The Active Site Length = 345 | Back alignment and structure |
| >pdb|3KSD|Q Chain Q, Crystal Structure Of C151s+h178n Mutant Of Glyceraldehyde-3-phosphate Dehydrogenase 1 (gapdh1) From Staphylococcus Aureus Mrsa252 Complexed With Nad At 2.2 Angstrom Resolution Length = 336 | Back alignment and structure |
| >pdb|1ZNQ|O Chain O, Crsytal Structure Of Human Liver Gapdh Length = 338 | Back alignment and structure |
| >pdb|1U8F|O Chain O, Crystal Structure Of Human Placental Glyceraldehyde-3- Phosphate Dehydrogenase At 1.75 Resolution Length = 335 | Back alignment and structure |
| >pdb|2X0N|A Chain A, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Brucei Determined From Laue Data Length = 359 | Back alignment and structure |
| >pdb|1J0X|O Chain O, Crystal Structure Of The Rabbit Muscle Glyceraldehyde-3- Phosphate Dehydrogenase (Gapdh) Length = 332 | Back alignment and structure |
| >pdb|1IHX|A Chain A, Crystal Structure Of Two D-Glyceraldehyde-3-Phosphate Dehydrogenase Complexes: A Case Of Asymmetry Length = 333 | Back alignment and structure |
| >pdb|1DC4|A Chain A, Structural Analysis Of Glyceraldehyde 3-Phosphate Dehydrogenase From Escherichia Coli: Direct Evidence For Substrate Binding And Cofactor-Induced Conformational Changes Length = 330 | Back alignment and structure |
| >pdb|1A7K|A Chain A, Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase In A Monoclinic Crystal Form Length = 360 | Back alignment and structure |
| >pdb|1GYP|A Chain A, Crystal Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Leishmania Mexicana: Implications For Structure-Based Drug Design And A New Position For The Inorganic Phosphate Binding Site Length = 358 | Back alignment and structure |
| >pdb|2VYN|D Chain D, Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotetramer Length = 334 | Back alignment and structure |
| >pdb|1SZJ|G Chain G, Structure Of Holo-Glyceraldehyde-3-Phosphate-Dehydrogenase From Palinurus Versicolor Refined 2.0 Angstrom Resolution Length = 333 | Back alignment and structure |
| >pdb|1GPD|G Chain G, Studies Of Asymmetry In The Three-Dimensional Structure Of Lobster D- Glyceraldehyde-3-Phosphate Dehydrogenase Length = 334 | Back alignment and structure |
| >pdb|4GPD|1 Chain 1, The Structure Of Lobster Apo-D-Glyceraldehyde-3-Phosphate Dehydrogenase At 3.0 Angstroms Resolution Length = 333 | Back alignment and structure |
| >pdb|3GPD|R Chain R, Twinning In Crystals Of Human Skeletal Muscle D-Glyceraldehyde-3- Phosphate Dehydrogenase Length = 334 | Back alignment and structure |
| >pdb|1K3T|A Chain A, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Cruzi Complexed With Chalepin, A Coumarin Derivative Inhibitor Length = 359 | Back alignment and structure |
| >pdb|1DSS|G Chain G, Structure Of Active-Site Carboxymethylated D-Glyceraldehyde-3- Phosphate Dehydrogenase From Palinurus Versicolor Length = 333 | Back alignment and structure |
| >pdb|3STH|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Toxoplasma Gondii Length = 361 | Back alignment and structure |
| >pdb|3DMT|C Chain C, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Cruzi In Complex With The Irreversible Iodoacetate Inhibitor Length = 359 | Back alignment and structure |
| >pdb|2XF8|A Chain A, Structure Of The D-Erythrose-4-Phosphate Dehydrogenase From E.Coli In Complex With A Nad Cofactor Analog (3- Chloroacetyl Adenine Pyridine Dinucleotide) And Sulfate Anion Length = 338 | Back alignment and structure |
| >pdb|2X5J|O Chain O, Crystal Structure Of The Apoform Of The D-Erythrose-4-Phosphate Dehydrogenase From E. Coli Length = 339 | Back alignment and structure |
| >pdb|2X5K|O Chain O, Structure Of An Active Site Mutant Of The D-Erythrose-4-Phosphate Dehydrogenase From E. Coli Length = 339 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 329 | |||
| 3b1j_A | 339 | Glyceraldehyde 3-phosphate dehydrogenase (NADP+); | 1e-122 | |
| 2d2i_A | 380 | Glyceraldehyde 3-phosphate dehydrogenase; rossmann | 1e-121 | |
| 1rm4_O | 337 | Glyceraldehyde 3-phosphate dehydrogenase A; rossma | 1e-120 | |
| 3doc_A | 335 | Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, | 1e-116 | |
| 4dib_A | 345 | GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n | 1e-116 | |
| 1hdg_O | 332 | Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o | 1e-116 | |
| 2ep7_A | 342 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o | 1e-115 | |
| 3cmc_O | 334 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m | 1e-115 | |
| 2g82_O | 331 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G | 1e-114 | |
| 2x5j_O | 339 | E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid | 1e-112 | |
| 1obf_O | 335 | Glyceraldehyde 3-phosphate dehydrogenase; glycolyt | 1e-112 | |
| 3hja_A | 356 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n | 1e-109 | |
| 3lvf_P | 338 | GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase | 3e-99 | |
| 3cps_A | 354 | Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g | 1e-91 | |
| 1gad_O | 330 | D-glyceraldehyde-3-phosphate dehydrogenase; oxidor | 2e-90 | |
| 3h9e_O | 346 | Glyceraldehyde-3-phosphate dehydrogenase, testis-; | 5e-89 | |
| 2b4r_O | 345 | Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st | 2e-88 | |
| 3ids_C | 359 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase, g | 5e-88 | |
| 3pym_A | 332 | GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase | 8e-88 | |
| 3e5r_O | 337 | PP38, glyceraldehyde-3-phosphate dehydrogenase, cy | 3e-87 | |
| 1u8f_O | 335 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l | 2e-85 | |
| 2yyy_A | 343 | Glyceraldehyde-3-phosphate dehydrogenase; glyceral | 2e-57 | |
| 2czc_A | 334 | Glyceraldehyde-3-phosphate dehydrogenase; glycolys | 9e-57 | |
| 1cf2_P | 337 | Protein (glyceraldehyde-3-phosphate dehydrogenase) | 5e-55 | |
| 1b7g_O | 340 | Protein (glyceraldehyde 3-phosphate dehydrogenase; | 4e-42 | |
| 3bio_A | 304 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 7e-04 |
| >3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Length = 339 | Back alignment and structure |
|---|
Score = 352 bits (907), Expect = e-122
Identities = 114/190 (60%), Positives = 147/190 (77%), Gaps = 1/190 (0%)
Query: 86 KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVK 145
++VAINGFGRIGRNFLRCW GR+++ L+VV +N++ + A+HLL+YDS+LG F AD+
Sbjct: 2 TIRVAINGFGRIGRNFLRCWFGRQNTDLEVVAINNTSDARTAAHLLEYDSVLGRFNADIS 61
Query: 146 IVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVI 205
D +I+V+GK +K+V +R+PL LPW E ID+VIE TGVFV GA KHIQAGAKKV+
Sbjct: 62 -YDENSITVNGKTMKIVCDRNPLNLPWKEWDIDLVIESTGVFVTAEGASKHIQAGAKKVL 120
Query: 206 ITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNCLAPFVKVMDEELGIVKGAMTT 265
ITAP KG + TYV+GVN+ +Y HE ++SNASCTTNCLAP KV+ + GI+KG MTT
Sbjct: 121 ITAPGKGEGVGTYVIGVNDSEYRHEDFAVISNASCTTNCLAPVAKVLHDNFGIIKGTMTT 180
Query: 266 THSYTGDQAL 275
THSYT DQ +
Sbjct: 181 THSYTLDQRI 190
|
| >2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Length = 380 | Back alignment and structure |
|---|
| >1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Length = 337 | Back alignment and structure |
|---|
| >3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Length = 335 | Back alignment and structure |
|---|
| >4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Length = 345 | Back alignment and structure |
|---|
| >1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Length = 332 | Back alignment and structure |
|---|
| >2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Length = 342 | Back alignment and structure |
|---|
| >3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Length = 334 | Back alignment and structure |
|---|
| >2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Length = 331 | Back alignment and structure |
|---|
| >2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Length = 339 | Back alignment and structure |
|---|
| >1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Length = 335 | Back alignment and structure |
|---|
| >3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Length = 356 | Back alignment and structure |
|---|
| >3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Length = 338 | Back alignment and structure |
|---|
| >3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Length = 354 | Back alignment and structure |
|---|
| >1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Length = 330 | Back alignment and structure |
|---|
| >3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Length = 346 | Back alignment and structure |
|---|
| >2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Length = 345 | Back alignment and structure |
|---|
| >3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* Length = 359 | Back alignment and structure |
|---|
| >3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Length = 332 | Back alignment and structure |
|---|
| >3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Length = 337 | Back alignment and structure |
|---|
| >1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Length = 335 | Back alignment and structure |
|---|
| >2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Length = 343 | Back alignment and structure |
|---|
| >2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Length = 334 | Back alignment and structure |
|---|
| >1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Length = 337 | Back alignment and structure |
|---|
| >1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Length = 340 | Back alignment and structure |
|---|
| >3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Length = 304 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 329 | |||
| 3doc_A | 335 | Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, | 100.0 | |
| 3lvf_P | 338 | GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase | 100.0 | |
| 4dib_A | 345 | GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n | 100.0 | |
| 3pym_A | 332 | GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase | 100.0 | |
| 3ids_C | 359 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase, g | 100.0 | |
| 3v1y_O | 337 | PP38, glyceraldehyde-3-phosphate dehydrogenase, cy | 100.0 | |
| 3h9e_O | 346 | Glyceraldehyde-3-phosphate dehydrogenase, testis-; | 100.0 | |
| 3hja_A | 356 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n | 100.0 | |
| 1obf_O | 335 | Glyceraldehyde 3-phosphate dehydrogenase; glycolyt | 100.0 | |
| 2ep7_A | 342 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o | 100.0 | |
| 2b4r_O | 345 | Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st | 100.0 | |
| 2g82_O | 331 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G | 100.0 | |
| 2d2i_A | 380 | Glyceraldehyde 3-phosphate dehydrogenase; rossmann | 100.0 | |
| 1rm4_O | 337 | Glyceraldehyde 3-phosphate dehydrogenase A; rossma | 100.0 | |
| 3b1j_A | 339 | Glyceraldehyde 3-phosphate dehydrogenase (NADP+); | 100.0 | |
| 3cmc_O | 334 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m | 100.0 | |
| 3cps_A | 354 | Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g | 100.0 | |
| 1hdg_O | 332 | Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o | 100.0 | |
| 1gad_O | 330 | D-glyceraldehyde-3-phosphate dehydrogenase; oxidor | 100.0 | |
| 2x5j_O | 339 | E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid | 100.0 | |
| 3e5r_O | 337 | PP38, glyceraldehyde-3-phosphate dehydrogenase, cy | 100.0 | |
| 1u8f_O | 335 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l | 100.0 | |
| 2yyy_A | 343 | Glyceraldehyde-3-phosphate dehydrogenase; glyceral | 100.0 | |
| 2yv3_A | 331 | Aspartate-semialdehyde dehydrogenase; aspartate pa | 100.0 | |
| 2r00_A | 336 | Aspartate-semialdehyde dehydrogenase; conformation | 100.0 | |
| 1cf2_P | 337 | Protein (glyceraldehyde-3-phosphate dehydrogenase) | 99.98 | |
| 2hjs_A | 340 | USG-1 protein homolog; aspartate-semialdehyde dehy | 99.98 | |
| 2czc_A | 334 | Glyceraldehyde-3-phosphate dehydrogenase; glycolys | 99.97 | |
| 1b7g_O | 340 | Protein (glyceraldehyde 3-phosphate dehydrogenase; | 99.97 | |
| 1t4b_A | 367 | Aspartate-semialdehyde dehydrogenase; asadh, HOSR, | 99.96 | |
| 2ep5_A | 350 | 350AA long hypothetical aspartate-semialdehyde deh | 99.95 | |
| 1xyg_A | 359 | Putative N-acetyl-gamma-glutamyl-phosphate reduct; | 99.94 | |
| 1ys4_A | 354 | Aspartate-semialdehyde dehydrogenase; oxidoreducta | 99.94 | |
| 2ozp_A | 345 | N-acetyl-gamma-glutamyl-phosphate reductase; amino | 99.94 | |
| 3pwk_A | 366 | Aspartate-semialdehyde dehydrogenase; NADP binding | 99.92 | |
| 3tz6_A | 344 | Aspartate-semialdehyde dehydrogenase; asadh, ASD, | 99.92 | |
| 3pzr_A | 370 | Aspartate-semialdehyde dehydrogenase; NADP, oxidor | 99.91 | |
| 3uw3_A | 377 | Aspartate-semialdehyde dehydrogenase; structural g | 99.91 | |
| 4dpk_A | 359 | Malonyl-COA/succinyl-COA reductase; dinucleotide b | 99.9 | |
| 4dpl_A | 359 | Malonyl-COA/succinyl-COA reductase; dinucleotide b | 99.9 | |
| 2nqt_A | 352 | N-acetyl-gamma-glutamyl-phosphate reductase; apopr | 99.89 | |
| 3hsk_A | 381 | Aspartate-semialdehyde dehydrogenase; candida albi | 99.86 | |
| 3dr3_A | 337 | N-acetyl-gamma-glutamyl-phosphate reductase; csgid | 99.84 | |
| 1vkn_A | 351 | N-acetyl-gamma-glutamyl-phosphate reductase; TM178 | 99.66 | |
| 1nvm_B | 312 | Acetaldehyde dehydrogenase (acylating), 4-hydroxy- | 97.8 | |
| 1f06_A | 320 | MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH | 97.52 | |
| 3bio_A | 304 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 97.22 | |
| 3ohs_X | 334 | Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d | 97.08 | |
| 4hkt_A | 331 | Inositol 2-dehydrogenase; structural genomics, nys | 96.96 | |
| 3i23_A | 349 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 96.91 | |
| 3euw_A | 344 | MYO-inositol dehydrogenase; protein structure init | 96.91 | |
| 3ezy_A | 344 | Dehydrogenase; structural genomics, unknown functi | 96.89 | |
| 3mz0_A | 344 | Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; | 96.87 | |
| 3kux_A | 352 | Putative oxidoreductase; oxidoreductase family, cs | 96.74 | |
| 2ejw_A | 332 | HDH, homoserine dehydrogenase; NAD-dependent, oxid | 96.69 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 96.68 | |
| 3ec7_A | 357 | Putative dehydrogenase; alpha-beta, structural gen | 96.68 | |
| 3ijp_A | 288 | DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, | 96.65 | |
| 3gdo_A | 358 | Uncharacterized oxidoreductase YVAA; structural ge | 96.64 | |
| 3ing_A | 325 | Homoserine dehydrogenase; NP_394635.1, structural | 96.63 | |
| 3fhl_A | 362 | Putative oxidoreductase; NAD-binding domain, PSI-2 | 96.63 | |
| 2ho3_A | 325 | Oxidoreductase, GFO/IDH/MOCA family; streptococcus | 96.61 | |
| 3c1a_A | 315 | Putative oxidoreductase; ZP_00056571.1, oxidoreduc | 96.6 | |
| 3db2_A | 354 | Putative NADPH-dependent oxidoreductase; two domai | 96.6 | |
| 3qy9_A | 243 | DHPR, dihydrodipicolinate reductase; rossmann fold | 96.58 | |
| 3cea_A | 346 | MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore | 96.57 | |
| 3e18_A | 359 | Oxidoreductase; dehydrogenase, NAD-binding, struct | 96.57 | |
| 3e9m_A | 330 | Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, | 96.57 | |
| 3f4l_A | 345 | Putative oxidoreductase YHHX; structural genomics, | 96.57 | |
| 3e82_A | 364 | Putative oxidoreductase; NAD, GFO/IDH/MOCA family, | 96.48 | |
| 1ydw_A | 362 | AX110P-like protein; structural genomics, protein | 96.47 | |
| 3q2i_A | 354 | Dehydrogenase; rossmann fold, UDP-sugar binding, N | 96.46 | |
| 2dc1_A | 236 | L-aspartate dehydrogenase; NAD, oxidoreductase; HE | 96.44 | |
| 3evn_A | 329 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 96.42 | |
| 1tlt_A | 319 | Putative oxidoreductase (virulence factor MVIM HO; | 96.41 | |
| 1p9l_A | 245 | Dihydrodipicolinate reductase; oxidoreductase, lys | 96.39 | |
| 3rc1_A | 350 | Sugar 3-ketoreductase; sugar biosynthesis, TDP bin | 96.39 | |
| 4f3y_A | 272 | DHPR, dihydrodipicolinate reductase; structural ge | 96.38 | |
| 3upl_A | 446 | Oxidoreductase; rossmann fold, NADPH binding; 1.50 | 96.36 | |
| 4had_A | 350 | Probable oxidoreductase protein; structural genomi | 96.34 | |
| 3uuw_A | 308 | Putative oxidoreductase with NAD(P)-binding rossm | 96.32 | |
| 1xea_A | 323 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 96.26 | |
| 1j5p_A | 253 | Aspartate dehydrogenase; TM1643, structural genomi | 96.16 | |
| 4gqa_A | 412 | NAD binding oxidoreductase; structural genomics, P | 96.14 | |
| 3m2t_A | 359 | Probable dehydrogenase; PSI, SGXNY, structural gen | 96.13 | |
| 3mtj_A | 444 | Homoserine dehydrogenase; rossmann-fold, PSI, MCSG | 96.12 | |
| 2ixa_A | 444 | Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver | 96.12 | |
| 3do5_A | 327 | HOM, homoserine dehydrogenase; NP_069768.1, putati | 96.11 | |
| 3moi_A | 387 | Probable dehydrogenase; structural genomics, PSI2, | 96.08 | |
| 3c8m_A | 331 | Homoserine dehydrogenase; structural genomics, APC | 96.04 | |
| 1h6d_A | 433 | Precursor form of glucose-fructose oxidoreductase; | 96.01 | |
| 4fb5_A | 393 | Probable oxidoreductase protein; PSI-biology, nysg | 95.86 | |
| 4ew6_A | 330 | D-galactose-1-dehydrogenase protein; nysgrc, PSI-b | 95.82 | |
| 1dih_A | 273 | Dihydrodipicolinate reductase; oxidoreductase; HET | 95.79 | |
| 4h3v_A | 390 | Oxidoreductase domain protein; structural genomics | 95.73 | |
| 1zh8_A | 340 | Oxidoreductase; TM0312, structural genomics, JO ce | 95.7 | |
| 2dt5_A | 211 | AT-rich DNA-binding protein; REX, NADH, NAD, rossm | 95.59 | |
| 1lc0_A | 294 | Biliverdin reductase A; oxidoreductase, tetrapyrro | 95.46 | |
| 2glx_A | 332 | 1,5-anhydro-D-fructose reductase; NADP(H) dependen | 95.36 | |
| 3ip3_A | 337 | Oxidoreductase, putative; structural genomics, PSI | 94.62 | |
| 3keo_A | 212 | Redox-sensing transcriptional repressor REX; DNA b | 94.56 | |
| 3o9z_A | 312 | Lipopolysaccaride biosynthesis protein WBPB; oxido | 94.46 | |
| 2p2s_A | 336 | Putative oxidoreductase; YP_050235.1, structural g | 94.37 | |
| 2vt3_A | 215 | REX, redox-sensing transcriptional repressor REX; | 94.32 | |
| 3u3x_A | 361 | Oxidoreductase; structural genomics, PSI-biology, | 94.11 | |
| 3oa2_A | 318 | WBPB; oxidoreductase, sugar biosynthesis, dehydrog | 94.09 | |
| 1r0k_A | 388 | 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N | 94.03 | |
| 3v5n_A | 417 | Oxidoreductase; structural genomics, PSI-biology, | 93.68 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 93.38 | |
| 2nvw_A | 479 | Galactose/lactose metabolism regulatory protein GA | 93.0 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 92.98 | |
| 3oqb_A | 383 | Oxidoreductase; structural genomics, protein struc | 92.88 | |
| 3btv_A | 438 | Galactose/lactose metabolism regulatory protein GA | 92.75 | |
| 3dty_A | 398 | Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram | 92.68 | |
| 1ebf_A | 358 | Homoserine dehydrogenase; dinucleotide, NAD, dimer | 92.61 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 92.0 | |
| 1y81_A | 138 | Conserved hypothetical protein; hyperthermophIle, | 91.97 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 91.94 | |
| 3ff4_A | 122 | Uncharacterized protein; structural genomics, PSI- | 91.69 | |
| 3abi_A | 365 | Putative uncharacterized protein PH1688; L-lysine | 91.54 | |
| 2duw_A | 145 | Putative COA-binding protein; ligand binding prote | 90.61 | |
| 3e48_A | 289 | Putative nucleoside-diphosphate-sugar epimerase; a | 90.6 | |
| 2nu8_A | 288 | Succinyl-COA ligase [ADP-forming] subunit alpha; c | 90.6 | |
| 3kb6_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 90.2 | |
| 4g2n_A | 345 | D-isomer specific 2-hydroxyacid dehydrogenase, Na; | 90.15 | |
| 3c1o_A | 321 | Eugenol synthase; phenylpropene, PIP reductase, sh | 90.1 | |
| 2bma_A | 470 | Glutamate dehydrogenase (NADP+); malaria, drug des | 90.04 | |
| 1qyd_A | 313 | Pinoresinol-lariciresinol reductase; NADPH-depende | 89.97 | |
| 2pi1_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 89.91 | |
| 4gmf_A | 372 | Yersiniabactin biosynthetic protein YBTU; rossmann | 89.88 | |
| 3m2p_A | 311 | UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J | 89.88 | |
| 3evt_A | 324 | Phosphoglycerate dehydrogenase; structural genomic | 89.87 | |
| 1iuk_A | 140 | Hypothetical protein TT1466; structural genomics, | 89.66 | |
| 3pp8_A | 315 | Glyoxylate/hydroxypyruvate reductase A; structural | 89.52 | |
| 3hg7_A | 324 | D-isomer specific 2-hydroxyacid dehydrogenase FAM | 89.42 | |
| 2yq5_A | 343 | D-isomer specific 2-hydroxyacid dehydrogenase; oxi | 89.26 | |
| 1xdw_A | 331 | NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas | 89.23 | |
| 1qp8_A | 303 | Formate dehydrogenase; oxidoreductase; HET: NDP; 2 | 89.14 | |
| 2r6j_A | 318 | Eugenol synthase 1; phenylpropene, PIP reductase, | 89.1 | |
| 1dxy_A | 333 | D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc | 89.02 | |
| 2d59_A | 144 | Hypothetical protein PH1109; COA binding, structur | 89.0 | |
| 3gg9_A | 352 | D-3-phosphoglycerate dehydrogenase oxidoreductase; | 88.95 | |
| 2g76_A | 335 | 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor | 88.65 | |
| 1gtm_A | 419 | Glutamate dehydrogenase; oxidoreductase, NAD, NADP | 88.6 | |
| 3jtm_A | 351 | Formate dehydrogenase, mitochondrial; mitochondrio | 88.52 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 88.42 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 88.41 | |
| 4hy3_A | 365 | Phosphoglycerate oxidoreductase; PSI-biology, stru | 88.3 | |
| 1gdh_A | 320 | D-glycerate dehydrogenase; oxidoreductase(CHOH (D) | 88.24 | |
| 4e5n_A | 330 | Thermostable phosphite dehydrogenase; D-2-hydroxya | 88.24 | |
| 1mx3_A | 347 | CTBP1, C-terminal binding protein 1; nuclear prote | 88.17 | |
| 3aog_A | 440 | Glutamate dehydrogenase; NAD(H), oxidoreducta; HET | 88.04 | |
| 2cuk_A | 311 | Glycerate dehydrogenase/glyoxylate reductase; stru | 87.85 | |
| 1wwk_A | 307 | Phosphoglycerate dehydrogenase; riken structural g | 87.83 | |
| 3gvx_A | 290 | Glycerate dehydrogenase related protein; NYSGXRC, | 87.82 | |
| 4dgs_A | 340 | Dehydrogenase; structural genomics, PSI-biology, N | 87.8 | |
| 3oet_A | 381 | Erythronate-4-phosphate dehydrogenase; structural | 87.6 | |
| 1qyc_A | 308 | Phenylcoumaran benzylic ether reductase PT1; NADPH | 87.55 | |
| 1j4a_A | 333 | D-LDH, D-lactate dehydrogenase; NAD-dependent dehy | 87.54 | |
| 1sc6_A | 404 | PGDH, D-3-phosphoglycerate dehydrogenase; alloster | 87.4 | |
| 2ekl_A | 313 | D-3-phosphoglycerate dehydrogenase; structural gen | 87.15 | |
| 2o4c_A | 380 | Erythronate-4-phosphate dehydrogenase; erythronate | 87.13 | |
| 2w2k_A | 348 | D-mandelate dehydrogenase; 2-hydroxyacid dehydroge | 86.8 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 86.65 | |
| 2gas_A | 307 | Isoflavone reductase; NADPH-dependent reductase, o | 86.5 | |
| 3i6i_A | 346 | Putative leucoanthocyanidin reductase 1; rossmann | 86.31 | |
| 3a06_A | 376 | 1-deoxy-D-xylulose 5-phosphate reductoisomerase; M | 86.13 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 85.89 | |
| 3ba1_A | 333 | HPPR, hydroxyphenylpyruvate reductase; two domain | 85.82 | |
| 2nac_A | 393 | NAD-dependent formate dehydrogenase; oxidoreductas | 85.72 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 85.6 | |
| 2gcg_A | 330 | Glyoxylate reductase/hydroxypyruvate reductase; NA | 85.26 | |
| 2d0i_A | 333 | Dehydrogenase; structural genomics, NPPSFA, nation | 85.16 | |
| 2dbq_A | 334 | Glyoxylate reductase; D-3-phosphoglycerate dehydro | 85.15 | |
| 2j6i_A | 364 | Formate dehydrogenase; oxidoreductase, D-specific- | 85.05 | |
| 3k5p_A | 416 | D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, | 84.68 | |
| 3d4o_A | 293 | Dipicolinate synthase subunit A; NP_243269.1, stru | 84.61 | |
| 4ina_A | 405 | Saccharopine dehydrogenase; structural genomics, P | 84.01 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 83.94 | |
| 4huj_A | 220 | Uncharacterized protein; PSI-biology, nysgrc, stru | 83.91 | |
| 2rir_A | 300 | Dipicolinate synthase, A chain; structural genomic | 83.71 | |
| 1vpd_A | 299 | Tartronate semialdehyde reductase; structural geno | 83.55 | |
| 1oi7_A | 288 | Succinyl-COA synthetase alpha chain; SCS, ligase, | 83.17 | |
| 2tmg_A | 415 | Protein (glutamate dehydrogenase); metabolic role, | 83.01 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 82.77 | |
| 3l9w_A | 413 | Glutathione-regulated potassium-efflux system Pro | 82.62 | |
| 3gt0_A | 247 | Pyrroline-5-carboxylate reductase; structural geno | 82.59 | |
| 1v9l_A | 421 | Glutamate dehydrogenase; protein-NAD complex, oxid | 82.49 | |
| 3r3j_A | 456 | Glutamate dehydrogenase; rossman fold, oxidoreduct | 82.43 | |
| 2yfq_A | 421 | Padgh, NAD-GDH, NAD-specific glutamate dehydrogena | 82.34 | |
| 2vns_A | 215 | Metalloreductase steap3; metal-binding, transmembr | 81.68 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 81.49 | |
| 4ezb_A | 317 | Uncharacterized conserved protein; structural geno | 81.46 | |
| 2ew2_A | 316 | 2-dehydropantoate 2-reductase, putative; alpha-str | 81.29 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 81.24 | |
| 2ahr_A | 259 | Putative pyrroline carboxylate reductase; pyrrolin | 81.02 | |
| 3ggo_A | 314 | Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b | 80.89 | |
| 1yb4_A | 295 | Tartronic semialdehyde reductase; structural genom | 80.86 | |
| 3g0o_A | 303 | 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine | 80.78 | |
| 3two_A | 348 | Mannitol dehydrogenase; cinnamyl-alcohol dehydroge | 80.77 | |
| 3c24_A | 286 | Putative oxidoreductase; YP_511008.1, structural g | 80.76 | |
| 3mw9_A | 501 | GDH 1, glutamate dehydrogenase 1; allostery, inhib | 80.45 | |
| 1ygy_A | 529 | PGDH, D-3-phosphoglycerate dehydrogenase; oxidored | 80.37 |
| >3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.5e-72 Score=544.97 Aligned_cols=209 Identities=44% Similarity=0.726 Sum_probs=200.6
Q ss_pred CeeeEEEEcCChhHHHHHHHHHhCCCCCceEEEEeCCCChhhhhhhccccccccccCceEEEecCCeEEECCeEEEEEec
Q 020217 85 AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSN 164 (329)
Q Consensus 85 ~~vkVaInGfGRIGR~vlR~l~~r~~~~l~vVaInd~~d~~~~ayLLkyDS~hG~F~g~V~v~~~~~L~inGk~I~V~~~ 164 (329)
|++||||||||||||+++|+++++..+++++|+|||+.|+++++|||||||+||+|+++|++ ++++|.|||++|+|+++
T Consensus 1 m~~kv~INGfGrIGr~v~Ra~~~~~~~~~~ivaiNd~~d~~~~a~l~kyDS~hG~f~~~v~~-~~~~l~i~Gk~I~v~~e 79 (335)
T 3doc_A 1 MAVRVAINGFGRIGRNILRAIVESGRTDIQVVAINDLGPVETNAHLLRYDSVHGRFPKEVEV-AGDTIDVGYGPIKVHAV 79 (335)
T ss_dssp CCEEEEEECCSHHHHHHHHHHHHTTCCSEEEEEEECSSCHHHHHHHHHEETTTEECSSCCEE-CSSEEESSSSEEEEECC
T ss_pred CCEEEEEECCCcHHHHHHHHHHhccCCCeEEEEEeCCCCHHHHHHHhcccCCCCCCCCeEEE-ecCEEEECCEEEEEEee
Confidence 56899999999999999999998743479999999999999999999999999999999998 58899999999999999
Q ss_pred CCCCCCCCccCCCcEEEcCCCCCCChhhHHHHHHcCCCEEEEeCCCCCCCCCeEEeccCccccCCCCCceEEcCCchhhh
Q 020217 165 RDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNC 244 (329)
Q Consensus 165 ~~P~~idW~~~GiDiVvesTG~f~~~e~a~~Hl~aGakkVIISAPsk~~DiP~iV~GVN~~~~~~~~~~IISnASCTTn~ 244 (329)
++|+++||+++|+||||||||.|+++++++.|+++||||||||+|+++ ++||||||||++.|+++ ++|||||||||||
T Consensus 80 ~dp~~i~w~~~gvDiVlesTG~f~s~e~a~~hl~aGAkkViIsaps~d-~~p~vV~gVN~~~~~~~-~~IISNasCTTn~ 157 (335)
T 3doc_A 80 RNPAELPWKEENVDIALECTGIFTSRDKAALHLEAGAKRVIVSAPADG-ADLTVVYGVNNDKLTKD-HLVISNASCTTNC 157 (335)
T ss_dssp SSTTSSCTTTTTCSEEEECSSSCCSHHHHTHHHHTTCSEEEESSCCTT-CSEECCTTTTGGGCCTT-CCEEECCCHHHHH
T ss_pred cccccccccccCCCEEEEccCccCCHHHHHHHHHcCCCEEEECCCCCC-CCCEEecccCHHHhCcc-CCeEecCchhhhh
Confidence 999999999999999999999999999999999999999999999986 68999999999999886 8999999999999
Q ss_pred hhhHHHhhhhhcCceEEEEEEEeeccCCCCCCC-CCcchhhhhccccccCCCc
Q 020217 245 LAPFVKVMDEELGIVKGAMTTTHSYTGDQALGC-FTQGLEESESCSVEHCPNE 296 (329)
Q Consensus 245 LaPvlKvL~d~fGI~~g~vTTvHa~T~dQ~l~D-~~~d~~r~r~a~~~i~p~~ 296 (329)
|+|++|+|||+|||++++||||||||++|+++| +++||||+|++++||||.+
T Consensus 158 Lap~lk~L~d~fGI~~g~mTTvha~T~~q~~~D~p~kd~r~~r~aa~NiIP~~ 210 (335)
T 3doc_A 158 LAPVAQVLNDTIGIEKGFMTTIHSYTGDQPTLDTMHKDLYRARAAALSMIPTS 210 (335)
T ss_dssp HHHHHHHHHHHTCEEEEEEEEEEECCTTSCSSCCCCSSTTTTSCTTSSCEEEE
T ss_pred hHHhHHHHHHHcCEEEEEEEeeeeccchhhhhcCccccccccccCcceEecCC
Confidence 999999999999999999999999999999999 8899999999999999985
|
| >3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3vaz_P* 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* | Back alignment and structure |
|---|
| >4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* | Back alignment and structure |
|---|
| >3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* | Back alignment and structure |
|---|
| >3v1y_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosol; rossmann fold; HET: NAD; 1.86A {Oryza sativa japonica group} PDB: 3e5r_O* 3e6a_O | Back alignment and structure |
|---|
| >3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* | Back alignment and structure |
|---|
| >3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} | Back alignment and structure |
|---|
| >1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* | Back alignment and structure |
|---|
| >2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* | Back alignment and structure |
|---|
| >2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* | Back alignment and structure |
|---|
| >2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A | Back alignment and structure |
|---|
| >1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* | Back alignment and structure |
|---|
| >3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* | Back alignment and structure |
|---|
| >3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* | Back alignment and structure |
|---|
| >3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* | Back alignment and structure |
|---|
| >1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* | Back alignment and structure |
|---|
| >2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* | Back alignment and structure |
|---|
| >3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O | Back alignment and structure |
|---|
| >1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 | Back alignment and structure |
|---|
| >2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2yv3_A Aspartate-semialdehyde dehydrogenase; aspartate pathway, structural genomics; 2.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* | Back alignment and structure |
|---|
| >1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* | Back alignment and structure |
|---|
| >2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A | Back alignment and structure |
|---|
| >1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A | Back alignment and structure |
|---|
| >3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A | Back alignment and structure |
|---|
| >3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A | Back alignment and structure |
|---|
| >3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* | Back alignment and structure |
|---|
| >4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* | Back alignment and structure |
|---|
| >2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A | Back alignment and structure |
|---|
| >3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} | Back alignment and structure |
|---|
| >3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A | Back alignment and structure |
|---|
| >1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* | Back alignment and structure |
|---|
| >3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X | Back alignment and structure |
|---|
| >4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A | Back alignment and structure |
|---|
| >3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* | Back alignment and structure |
|---|
| >3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} | Back alignment and structure |
|---|
| >2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} | Back alignment and structure |
|---|
| >3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A | Back alignment and structure |
|---|
| >3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} | Back alignment and structure |
|---|
| >3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} | Back alignment and structure |
|---|
| >3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} | Back alignment and structure |
|---|
| >3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A | Back alignment and structure |
|---|
| >3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* | Back alignment and structure |
|---|
| >2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} | Back alignment and structure |
|---|
| >1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 | Back alignment and structure |
|---|
| >1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* | Back alignment and structure |
|---|
| >3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* | Back alignment and structure |
|---|
| >4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* | Back alignment and structure |
|---|
| >4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} | Back alignment and structure |
|---|
| >1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 | Back alignment and structure |
|---|
| >1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* | Back alignment and structure |
|---|
| >4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* | Back alignment and structure |
|---|
| >3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* | Back alignment and structure |
|---|
| >1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* | Back alignment and structure |
|---|
| >4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} | Back alignment and structure |
|---|
| >4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} | Back alignment and structure |
|---|
| >1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* | Back alignment and structure |
|---|
| >4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} | Back alignment and structure |
|---|
| >1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 | Back alignment and structure |
|---|
| >2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* | Back alignment and structure |
|---|
| >1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* | Back alignment and structure |
|---|
| >2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} | Back alignment and structure |
|---|
| >3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* | Back alignment and structure |
|---|
| >3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* | Back alignment and structure |
|---|
| >2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} | Back alignment and structure |
|---|
| >2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* | Back alignment and structure |
|---|
| >3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A* | Back alignment and structure |
|---|
| >3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} | Back alignment and structure |
|---|
| >3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A | Back alignment and structure |
|---|
| >3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* | Back alignment and structure |
|---|
| >3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} | Back alignment and structure |
|---|
| >3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} | Back alignment and structure |
|---|
| >2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* | Back alignment and structure |
|---|
| >3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} | Back alignment and structure |
|---|
| >3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A | Back alignment and structure |
|---|
| >3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A | Back alignment and structure |
|---|
| >3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} | Back alignment and structure |
|---|
| >2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* | Back alignment and structure |
|---|
| >1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} | Back alignment and structure |
|---|
| >1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* | Back alignment and structure |
|---|
| >1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* | Back alignment and structure |
|---|
| >3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A | Back alignment and structure |
|---|
| >3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} | Back alignment and structure |
|---|
| >1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* | Back alignment and structure |
|---|
| >1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* | Back alignment and structure |
|---|
| >3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A | Back alignment and structure |
|---|
| >2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* | Back alignment and structure |
|---|
| >1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* | Back alignment and structure |
|---|
| >2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} | Back alignment and structure |
|---|
| >3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* | Back alignment and structure |
|---|
| >3a06_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; MEP pathway, isoprene biosynthesis, metal- NADP, oxidoreductase; HET: NDP; 2.00A {Thermotoga maritima} PDB: 3a14_A* | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* | Back alignment and structure |
|---|
| >2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A | Back alignment and structure |
|---|
| >2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* | Back alignment and structure |
|---|
| >2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A | Back alignment and structure |
|---|
| >3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 | Back alignment and structure |
|---|
| >2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* | Back alignment and structure |
|---|
| >3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 | Back alignment and structure |
|---|
| >3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} | Back alignment and structure |
|---|
| >2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A | Back alignment and structure |
|---|
| >3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* | Back alignment and structure |
|---|
| >1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} | Back alignment and structure |
|---|
| >3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} SCOP: c.2.1.7 c.58.1.1 PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* | Back alignment and structure |
|---|
| >1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 329 | ||||
| d1rm4a1 | 172 | c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosp | 4e-61 | |
| d1hdgo1 | 169 | c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosp | 2e-59 | |
| d1u8fo1 | 169 | c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosp | 1e-57 | |
| d1gado1 | 166 | c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosp | 6e-57 | |
| d1dssg1 | 169 | c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosp | 5e-54 | |
| d1k3ta1 | 190 | c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosp | 2e-51 | |
| d3cmco1 | 171 | c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosp | 4e-49 | |
| d1cf2o1 | 171 | c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosp | 1e-48 | |
| d2g82a1 | 168 | c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosp | 8e-46 | |
| d2b4ro1 | 166 | c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosp | 1e-44 | |
| d2czca2 | 172 | c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosp | 1e-43 | |
| d1obfo1 | 173 | c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosp | 2e-43 | |
| d1b7go1 | 178 | c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosp | 4e-42 | |
| d1obfo2 | 162 | d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate de | 1e-14 | |
| d1rm4a2 | 163 | d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate de | 8e-14 | |
| d1u8fo2 | 164 | d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate de | 1e-13 | |
| d2g82a2 | 162 | d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate de | 2e-13 | |
| d3cmco2 | 163 | d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate de | 2e-13 | |
| d1k3ta2 | 169 | d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate de | 1e-11 | |
| d1cf2o2 | 165 | d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate de | 3e-11 | |
| d1b7go2 | 162 | d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate de | 6e-10 | |
| d1lc0a1 | 172 | c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase { | 0.003 |
| >d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 172 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain domain: Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) species: Spinach (Spinacia oleracea) [TaxId: 3562]
Score = 190 bits (485), Expect = 4e-61
Identities = 121/167 (72%), Positives = 137/167 (82%), Gaps = 2/167 (1%)
Query: 87 LKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKI 146
LKVAINGFGRIGRNFLRCWHGRKDSPLDVVV+ND+GGVK ASHLLKYDS+LGTF ADVK
Sbjct: 1 LKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVKT 60
Query: 147 VDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVII 206
+ ISVDGK+IKVVS+R+P+ LPW ++GID+VIEGTGVFVD GAGKH+QAGAKKV+I
Sbjct: 61 AGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVLI 120
Query: 207 TAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNCLAPFVKVMD 253
TAP KG DIPTYVVGVNE+ Y H I+SNAS V + D
Sbjct: 121 TAPGKG-DIPTYVVGVNEEGYTHA-DTIISNASNEWGYSQRVVDLAD 165
|
| >d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Length = 169 | Back information, alignment and structure |
|---|
| >d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Length = 166 | Back information, alignment and structure |
|---|
| >d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Length = 169 | Back information, alignment and structure |
|---|
| >d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Length = 190 | Back information, alignment and structure |
|---|
| >d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Length = 171 | Back information, alignment and structure |
|---|
| >d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Length = 171 | Back information, alignment and structure |
|---|
| >d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Length = 168 | Back information, alignment and structure |
|---|
| >d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 166 | Back information, alignment and structure |
|---|
| >d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 172 | Back information, alignment and structure |
|---|
| >d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Length = 173 | Back information, alignment and structure |
|---|
| >d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 178 | Back information, alignment and structure |
|---|
| >d1obfo2 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Length = 162 | Back information, alignment and structure |
|---|
| >d1rm4a2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 163 | Back information, alignment and structure |
|---|
| >d1u8fo2 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Length = 164 | Back information, alignment and structure |
|---|
| >d2g82a2 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Length = 162 | Back information, alignment and structure |
|---|
| >d3cmco2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Length = 163 | Back information, alignment and structure |
|---|
| >d1k3ta2 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Length = 169 | Back information, alignment and structure |
|---|
| >d1cf2o2 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Length = 165 | Back information, alignment and structure |
|---|
| >d1b7go2 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 162 | Back information, alignment and structure |
|---|
| >d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 172 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 329 | |||
| d1rm4a1 | 172 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d3cmco1 | 171 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1dssg1 | 169 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1gado1 | 166 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1k3ta1 | 190 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d2g82a1 | 168 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1hdgo1 | 169 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1u8fo1 | 169 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d2b4ro1 | 166 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1obfo1 | 173 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1b7go1 | 178 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d2czca2 | 172 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1cf2o1 | 171 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d3cmco2 | 163 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 99.87 | |
| d1obfo2 | 162 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 99.86 | |
| d1k3ta2 | 169 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 99.86 | |
| d1rm4a2 | 163 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 99.86 | |
| d2g82a2 | 162 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 99.86 | |
| d1u8fo2 | 164 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 99.84 | |
| d2gz1a1 | 154 | Aspartate beta-semialdehyde dehydrogenase {Strepto | 99.65 | |
| d2hjsa1 | 144 | Usg-1 protein homolog PA3116 {Pseudomonas aerugino | 99.64 | |
| d1nvmb1 | 157 | Acetaldehyde dehydrogenase (acylating) {Pseudomona | 99.31 | |
| d1mb4a1 | 147 | Aspartate beta-semialdehyde dehydrogenase {Vibrio | 99.16 | |
| d2cvoa1 | 183 | Putative semialdehyde dehydrogenase {Rice (Oryza s | 99.11 | |
| d1cf2o2 | 165 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 99.03 | |
| d1t4ba1 | 146 | Aspartate beta-semialdehyde dehydrogenase {Escheri | 99.02 | |
| d1vkna1 | 176 | N-acetyl-gamma-glutamyl-phosphate reductase ArgC { | 99.01 | |
| d2g17a1 | 179 | N-acetyl-gamma-glutamyl-phosphate reductase ArgC { | 98.93 | |
| d1b7go2 | 162 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 98.87 | |
| d1mb4a2 | 222 | Aspartate beta-semialdehyde dehydrogenase {Vibrio | 97.92 | |
| d1t4ba2 | 221 | Aspartate beta-semialdehyde dehydrogenase {Escheri | 97.89 | |
| d2gz1a2 | 202 | Aspartate beta-semialdehyde dehydrogenase {Strepto | 97.71 | |
| d1f06a1 | 170 | Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb | 97.68 | |
| d1j5pa4 | 132 | Hypothetical protein TM1643 {Thermotoga maritima [ | 97.5 | |
| d2hjsa2 | 190 | Usg-1 protein homolog PA3116 {Pseudomonas aerugino | 97.43 | |
| d1ydwa1 | 184 | Probable oxidoreductase At4g09670 {Thale cress (Ar | 97.2 | |
| d1diha1 | 162 | Dihydrodipicolinate reductase {Escherichia coli [T | 97.02 | |
| d1ebfa1 | 168 | Homoserine dehydrogenase {Baker's yeast (Saccharom | 96.82 | |
| d1zh8a1 | 181 | Hypothetical protein TM0312 {Thermotoga maritima [ | 96.6 | |
| d1tlta1 | 164 | Virulence factor MviM {Escherichia coli [TaxId: 56 | 96.52 | |
| d1h6da1 | 221 | Glucose-fructose oxidoreductase, N-terminal domain | 96.18 | |
| d1yl7a1 | 135 | Dihydrodipicolinate reductase {Mycobacterium tuber | 96.11 | |
| d1xeaa1 | 167 | Putative oxidoreductase VCA1048 {Vibrio cholerae [ | 95.9 | |
| d2czca1 | 162 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 95.77 | |
| d2nvwa1 | 237 | Galactose/lactose metabolism regulatory protein GA | 95.36 | |
| d1vm6a3 | 128 | Dihydrodipicolinate reductase {Thermotoga maritima | 95.15 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 94.6 | |
| d1j4aa1 | 197 | D-lactate dehydrogenase {Lactobacillus helveticus | 94.21 | |
| d1lc0a1 | 172 | Biliverdin reductase {Rat (Rattus norvegicus) [Tax | 94.17 | |
| d1dxya1 | 199 | D-2-hydroxyisocaproate dehydrogenase {Lactobacillu | 93.85 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 93.33 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 93.22 | |
| d1mx3a1 | 193 | Transcription corepressor CtbP {Human (Homo sapien | 93.17 | |
| d2dt5a2 | 126 | Transcriptional repressor Rex, C-terminal domain { | 92.72 | |
| d1qp8a1 | 181 | Putative formate dehydrogenase {Archaeon Pyrobacul | 92.18 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 92.09 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 91.89 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 91.63 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 91.5 | |
| d1i36a2 | 152 | Conserved hypothetical protein MTH1747 {Archaeon M | 90.94 | |
| d1gdha1 | 191 | D-glycerate dehydrogenase {Hyphomicrobium methylov | 90.71 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 90.57 | |
| d1sc6a1 | 188 | Phosphoglycerate dehydrogenase {Escherichia coli [ | 90.49 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 90.32 | |
| d2csua1 | 129 | Acetate-CoA ligase alpha chain, AcdA, N-terminal d | 89.85 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 88.94 | |
| d1guza1 | 142 | Malate dehydrogenase {Chlorobium vibrioforme [TaxI | 88.57 | |
| d2naca1 | 188 | Formate dehydrogenase {Pseudomonas sp., strain 101 | 88.52 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 88.4 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 88.24 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 88.07 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 87.98 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 87.91 | |
| d1ygya1 | 184 | Phosphoglycerate dehydrogenase {Mycobacterium tube | 87.84 | |
| d2gv8a1 | 335 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 87.8 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 87.55 | |
| d1pgja2 | 178 | 6-phosphogluconate dehydrogenase {Trypanosoma bruc | 87.15 | |
| d1jaya_ | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae | 86.64 | |
| d1uxja1 | 142 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 86.6 | |
| d1y7ta1 | 154 | Malate dehydrogenase {Thermus thermophilus [TaxId: | 85.92 | |
| d1ojua1 | 142 | Malate dehydrogenase {Archaeon Archaeoglobus fulgi | 85.28 | |
| d1hwxa1 | 293 | Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: | 84.96 | |
| d1i0za1 | 160 | Lactate dehydrogenase {Human (Homo sapiens), heart | 84.91 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 84.65 | |
| d5mdha1 | 154 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 84.59 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 83.88 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 83.75 | |
| d1y81a1 | 116 | Hypothetical protein PF0725 {Pyrococcus furiosus [ | 83.14 | |
| d1hyea1 | 145 | MJ0490, lactate/malate dehydrogenase {Archaeon Met | 83.14 | |
| d1ks9a2 | 167 | Ketopantoate reductase PanE {Escherichia coli [Tax | 82.24 | |
| d2ahra2 | 152 | Pyrroline-5-carboxylate reductase ProC {Streptococ | 81.43 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 81.31 | |
| d1t2da1 | 150 | Lactate dehydrogenase {Malaria parasite (Plasmodiu | 81.15 | |
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 81.0 | |
| d1r0ka2 | 150 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z | 80.98 | |
| d2cvza2 | 156 | Hydroxyisobutyrate dehydrogenase {Thermus thermoph | 80.04 |
| >d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain domain: Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) species: Spinach (Spinacia oleracea) [TaxId: 3562]
Probab=100.00 E-value=5.5e-59 Score=411.50 Aligned_cols=169 Identities=70% Similarity=1.167 Sum_probs=159.4
Q ss_pred eeEEEEcCChhHHHHHHHHHhCCCCCceEEEEeCCCChhhhhhhccccccccccCceEEEecCCeEEECCeEEEEEecCC
Q 020217 87 LKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRD 166 (329)
Q Consensus 87 vkVaInGfGRIGR~vlR~l~~r~~~~l~vVaInd~~d~~~~ayLLkyDS~hG~F~g~V~v~~~~~L~inGk~I~V~~~~~ 166 (329)
+||||||||||||+++|+++++..+++++|+|||+.++++++|||+|||+||+|+++++.++++.+.+||+.|+++++++
T Consensus 1 ikIgINGfGRIGR~v~R~~~~~~~~~i~ivaINd~~~~~~~ayLlkyDSvhG~~~~~i~~~~~~~~~ing~~I~~~~~~~ 80 (172)
T d1rm4a1 1 LKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVKTAGDSAISVDGKVIKVVSDRN 80 (172)
T ss_dssp EEEEEECCSHHHHHHHHHHHHCSSCSEEEEEEECTTCHHHHHHHHHCCTTTCSCSSCEEECTTSEEEETTEEEEEECCSC
T ss_pred CEEEEECCCHHHHHHHHHHHhCCCCCEEEEEEcCCCCHHHHHHHHhcCcccccccceeEecCCcceEECCEEEEEecCCC
Confidence 58999999999999999999887677999999999999999999999999999999999865666789999999999999
Q ss_pred CCCCCCccCCCcEEEcCCCCCCChhhHHHHHHcCCCEEEEeCCCCCCCCCeEEeccCccccCCCCCceEEcCCchhhh--
Q 020217 167 PLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNC-- 244 (329)
Q Consensus 167 P~~idW~~~GiDiVvesTG~f~~~e~a~~Hl~aGakkVIISAPsk~~DiP~iV~GVN~~~~~~~~~~IISnASCTTn~-- 244 (329)
|+++||.++|+||||||||.|.+++.+..||++||||||||||+++ |+|||||||||+.|+++ ++|||||||||||
T Consensus 81 p~~i~W~~~gvDiViEcTG~f~~~~~~~~hl~~GakkViiSAP~k~-~~~tiV~GVN~~~~~~~-~~iIS~aSCTtn~~~ 158 (172)
T d1rm4a1 81 PVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKG-DIPTYVVGVNEEGYTHA-DTIISNASNEWGYSQ 158 (172)
T ss_dssp GGGSCHHHHTCCEEEECSSSCCBHHHHHHHHHTTCSCEEESSCCBS-SCCBCCTTTTGGGCCTT-CSEEECCCTTHHHHH
T ss_pred hHHCChhhcCCCEEEecCceEccHHHHHHHHhcCCceEEeeccccc-ceeeEEeecchhhcCCC-CCEEEcccchhccHh
Confidence 9999999999999999999999999999999999999999999986 78999999999999987 8999999999555
Q ss_pred -hhhHHHhhhhhcC
Q 020217 245 -LAPFVKVMDEELG 257 (329)
Q Consensus 245 -LaPvlKvL~d~fG 257 (329)
|+|++|+|||+|.
T Consensus 159 ~l~pv~~vi~~~f~ 172 (172)
T d1rm4a1 159 RVVDLADIVANKWQ 172 (172)
T ss_dssp HHHHHHHHHHHTCC
T ss_pred HhHHHHHHHHhhcC
Confidence 9999999999984
|
| >d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} | Back information, alignment and structure |
|---|
| >d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} | Back information, alignment and structure |
|---|
| >d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} | Back information, alignment and structure |
|---|
| >d3cmco2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1obfo2 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} | Back information, alignment and structure |
|---|
| >d1k3ta2 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1rm4a2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d2g82a2 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1u8fo2 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1cf2o2 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} | Back information, alignment and structure |
|---|
| >d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1b7go2 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1mb4a2 d.81.1.1 (A:133-354) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1t4ba2 d.81.1.1 (A:134-354) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gz1a2 d.81.1.1 (A:128-329) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d2hjsa2 d.81.1.1 (A:130-319) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} | Back information, alignment and structure |
|---|
| >d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2czca1 d.81.1.1 (A:140-301) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} | Back information, alignment and structure |
|---|
| >d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} | Back information, alignment and structure |
|---|
| >d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} | Back information, alignment and structure |
|---|
| >d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
| >d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} | Back information, alignment and structure |
|---|
| >d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|