Citrus Sinensis ID: 020245

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33
MASAKGTWIKLDQKGSGPGARSSHAITIVGQKVYAFGGEFTPRVPVDNNLHVFDLETLTWSVADVTGDVPPPRVGVTMAAVGHTIYMFGGRDGTHKELNELYSFDTRTNQWTLLSNGDAGPPHRSYHSTAADDRHVYIFGGCGVSGRLNDLWGFDVVDRKWIQYPSAGENCKGRGGPGLIVTQGKIWVVYGFAGVEVDDVHCFDPAHAQWAQVETSGEKPTARSVFSTVGIGKHIVVYGGEVDPSDLGHLGAGKFAGELYSLDTETLVWTRWDDGPGSDHHPGPRGWCAFAGGLRGGKHGLLVYGGNSPSNDRLDDIYFFTPCLDGIED
ccccccEEEEEcccccccccccccEEEEEccEEEEEcccccccccccccEEEEEcccccEEEEEcccccccccccEEEEEEccEEEEEccccccccccccEEEEEccccEEEEEEccccccccccccEEEEEccEEEEEccccccccccEEEEEEcccccEEEEcccccccccccccEEEEEccEEEEEEcccccccccEEEEEcccccEEEEEccccccccccEEEEEEEccEEEEEccccccccccccccccEEcEEEEEEcccccEEEcccccccccccccccccEEEEEEEccccEEEEEccccccccccccEEEEEcccccccc
ccccccEEEEEcccccccccccccEEEEEccEEEEEEcccccccEccccEEEEEccccEEEEEcccccccccccccEEEEEccEEEEEEcccccccccccEEEEEccccEEEEEcccccccccccccEEEEEccEEEEEEccccccccccEEEEEccccEEEEccccccccccccccEEEEEccEEEEEEcccccccccEEEEcccccEEEEEccccccccccccEEEEEEccEEEEEEcccccccccccccccccccEEEEEccccEEEEEcccccccccccccccccEEEEEEEEccEEEEEEcccccccccccEEEEccccccccc
masakgtwikldqkgsgpgarsshaITIVGQKVyafggeftprvpvdnnlhvfdletltwsvadvtgdvppprvgVTMAAVGHTIymfggrdgthKELNELYsfdtrtnqwtllsngdagpphrsyhstaaddrhvyifggcgvsgrlndlwgfdvvdrkwiqypsagenckgrggpglivtqGKIWVVYGFagvevddvhcfdpahaqwaqvetsgekptarsvfstvGIGKHIVVyggevdpsdlghlgagkfagelysldtETLVwtrwddgpgsdhhpgprgwcafagglrggkhgllvyggnspsndrlddiyfftpcldgied
masakgtwikldqkgsgpgarssHAITIVGQKVYAFGGEFTPRVPVDNNLHVFDLETLTWSVADVTGDVPPPRVGVTMAAVGHTIYMFGGRDGTHKELNELYSFDTRTNQWTLLSNGDAGPPHRSYHSTAADDRHVYIFGGCGVSGRLNDLWGFDVVDRKWIQYPsagenckgrggpgliVTQGKIWVVYGFAGVEVDDVHCFDPAHAQWAQvetsgekptARSVFSTVGIGKHIVVYGGEVDPSDLGHLGAGKFAGELYSLDTETLVWTRWDDGPGSDHHPGPRGWCAFAGGLRGGKHGLLVYGGnspsndrlddIYFFTPCLDGIED
MASAKGTWIKLDQKGSGPGARSSHAITIVGQKVYAFGGEFTPRVPVDNNLHVFDLETLTWSVADVTGDVPPPRVGVTMAAVGHTIYMFGGRDGTHKELNELYSFDTRTNQWTLLSNGDAGPPHRSYHSTAADDRHVYIFGGCGVSGRLNDLWGFDVVDRKWIQYPSAGENCKGRGGPGLIVTQGKIWVVYGFAGVEVDDVHCFDPAHAQWAQVETSGEKPTARSVFSTVGIGKHIVVYGGEVDPSDLGHLGAGKFAGELYSLDTETLVWTRWDDGPGSDHHPGPRGWCAFAGGLRGGKHGLLVYGGNSPSNDRLDDIYFFTPCLDGIED
***********************HAITIVGQKVYAFGGEFTPRVPVDNNLHVFDLETLTWSVADVTGDVPPPRVGVTMAAVGHTIYMFGGRDGTHKELNELYSFDTRTNQWTLLSN************TAADDRHVYIFGGCGVSGRLNDLWGFDVVDRKWIQYPSAGENCKGRGGPGLIVTQGKIWVVYGFAGVEVDDVHCFDPAHAQWAQVETS***PTARSVFSTVGIGKHIVVYGGEVDPSDLGHLGAGKFAGELYSLDTETLVWTRWDDGP****HPGPRGWCAFAGGLRGGKHGLLVYGGNSPSNDRLDDIYFFTPCLDG***
MASAKGTWIKLDQK*SGPGARSSHAITIVGQKVYAFGGEFTPRVPVDNNLHVFDLETLTWSVADVTGDVPPPRVGVTMAAVGHTIYMFGGRDGTHKELNELYSFDTRTNQWTLLSNGDAGPPHRSYHSTAADDRHVYIFGGCGVSGRLNDLWGFDVVDRKWIQYPSAGENCKGRGGPGLIVTQGKIWVVYGFAGVEVDDVHCFDPAHAQWAQVETSGEKPTARSVFSTVGIGKHIVVYGGEVDPSDLGHLGAGKFAGELYSLDTETLVWTR***************WCAFAGGLRGGKHGLLVYGGNSPSNDRLDDIYFFTPCLDG***
MASAKGTWIKLD**********SHAITIVGQKVYAFGGEFTPRVPVDNNLHVFDLETLTWSVADVTGDVPPPRVGVTMAAVGHTIYMFGGRDGTHKELNELYSFDTRTNQWTLLSNGDAGPPHRSYHSTAADDRHVYIFGGCGVSGRLNDLWGFDVVDRKWIQYPSAGENCKGRGGPGLIVTQGKIWVVYGFAGVEVDDVHCFDPAHAQW************RSVFSTVGIGKHIVVYGGEVDPSDLGHLGAGKFAGELYSLDTETLVWTRWDDGPGSDHHPGPRGWCAFAGGLRGGKHGLLVYGGNSPSNDRLDDIYFFTPCLDGIED
****KGTWIKLDQKGSGPGARSSHAITIVGQKVYAFGGEFTPRVPVDNNLHVFDLETLTWSVADVTGDVPPPRVGVTMAAVGHTIYMFGGRDGTHKELNELYSFDTRTNQWTLLSNGDAGPPHRSYHSTAADDRHVYIFGGCGVSGRLNDLWGFDVVDRKWIQYPSAGENCKGRGGPGLIVTQGKIWVVYGFAGVEVDDVHCFDPAHAQWAQVETSGEKPTARSVFSTVGIGKHIVVYGGEVDPSDLGHLGAGKFAGELYSLDTETLVWTRWDDGPGSDHHPGPRGWCAFAGGLRGGKHGLLVYGGNSPSNDRLDDIYFFTPCLD****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASAKGTWIKLDQKGSGPGARSSHAITIVGQKVYAFGGEFTPRVPVDNNLHVFDLETLTWSVADVTGDVPPPRVGVTMAAVGHTIYMFGGRDGTHKELNELYSFDTRTNQWTLLSNGDAGPPHRSYHSTAADDRHVYIFGGCGVSGRLNDLWGFDVVDRKWIQYPSAGENCKGRGGPGLIVTQGKIWVVYGFAGVEVDDVHCFDPAHAQWAQVETSGEKPTARSVFSTVGIGKHIVVYGGEVDPSDLGHLGAGKFAGELYSLDTETLVWTRWDDGPGSDHHPGPRGWCAFAGGLRGGKHGLLVYGGNSPSNDRLDDIYFFTPCLDGIED
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query329 2.2.26 [Sep-21-2011]
Q93XW5326 Nitrile-specifier protein no no 0.966 0.975 0.565 1e-106
Q9SDM9470 Nitrile-specifier protein no no 0.954 0.668 0.518 2e-94
O04316619 Nitrile-specifier protein no no 0.954 0.507 0.5 6e-93
O49326471 Nitrile-specifier protein no no 0.957 0.668 0.507 1e-91
O04318467 Nitrile-specifier protein no no 0.945 0.665 0.509 4e-89
Q8RY71341 Epithiospecifier protein no no 0.951 0.917 0.461 3e-78
P87061 1147 Tip elongation aberrant p yes no 0.765 0.219 0.281 1e-20
Q7Z6M1372 Rab9 effector protein wit yes no 0.468 0.413 0.337 5e-17
Q5EA50372 Rab9 effector protein wit yes no 0.702 0.620 0.302 5e-17
Q5ZJ37371 Rab9 effector protein wit no no 0.471 0.417 0.348 1e-16
>sp|Q93XW5|NSP5_ARATH Nitrile-specifier protein 5 OS=Arabidopsis thaliana GN=NSP5 PE=2 SV=1 Back     alignment and function desciption
 Score =  385 bits (989), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 181/320 (56%), Positives = 235/320 (73%), Gaps = 2/320 (0%)

Query: 1   MASAKGTWIKLDQKGSGPGARSSHAITIVGQKVYAFGGEFTPRVPVDNNLHVFDLETLTW 60
           M   +  W+K+ QKG+GPGARSSHA+T+VG KVY FGGE  P + +DN+L+VFDLET  W
Sbjct: 1   MCPVENKWLKVGQKGAGPGARSSHAMTVVGNKVYCFGGELKPTIHIDNDLYVFDLETQEW 60

Query: 61  SVADVTGDVPPPRVGVTMAAVGHTIYMFGGRDGTHKELNELYSFDTRTNQWTLLSNGDAG 120
           S+A  TG+ P P  GV+M  +G TIY++GGRD   +  N L+S+DT TN+W LL+  + G
Sbjct: 61  SIAPATGEAPFPCFGVSMVTIGSTIYVYGGRD-DKRRYNGLHSYDTETNEWKLLAPVEEG 119

Query: 121 PPHRSYHSTAADDRHVYIFGGCGVSGRLNDLWGFDVVDRKWIQYPSAGENCKGRGGPGLI 180
            P RSYHS A DDR VY+FGG    GR+N L  +DVVD+KW++YP+AGE CKGRG PGL+
Sbjct: 120 LPGRSYHSMAGDDRKVYVFGGVTAKGRVNTLHAYDVVDQKWVEYPAAGEACKGRGAPGLV 179

Query: 181 VTQGKIWVVYGFAGVEVDDVHCFDPAHAQWAQVETSGEKPTARSVFSTVGIGKHIVVYGG 240
           V +G+IWV++GF G E+ D+HCFD A  QW  VET+G+ P ARSVF  V  GK+IV+YGG
Sbjct: 180 VVEGRIWVLFGFDGNELGDIHCFDLASEQWKAVETTGDVPAARSVFPAVSYGKYIVIYGG 239

Query: 241 EVDPSDLGHLGAGKFAGELYSLDTETLVWTRWDDGPGSDHHPGPRGWCAFAGGLRGGKHG 300
           E +P +L H+GAGK +GE+Y LDTETLVW R   G   +  P  RGWCAF   ++ G+ G
Sbjct: 240 EEEPHELMHMGAGKMSGEVYQLDTETLVWERIVCG-NEEEKPSQRGWCAFTKAVKDGEEG 298

Query: 301 LLVYGGNSPSNDRLDDIYFF 320
           LLV+GGNSP+N+RLDD+ F+
Sbjct: 299 LLVHGGNSPTNERLDDLVFW 318
Promotes simple nitriles, but not epithionitrile or thiocyanate formation. Converts allylglucosinolate and benzylglucosinolate to their corresponding simple nitriles in the presence of myrosinase.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9SDM9|NSP1_ARATH Nitrile-specifier protein 1 OS=Arabidopsis thaliana GN=NSP1 PE=2 SV=2 Back     alignment and function description
>sp|O04316|NSP4_ARATH Nitrile-specifier protein 4 OS=Arabidopsis thaliana GN=NSP4 PE=2 SV=1 Back     alignment and function description
>sp|O49326|NSP2_ARATH Nitrile-specifier protein 2 OS=Arabidopsis thaliana GN=NSP2 PE=2 SV=1 Back     alignment and function description
>sp|O04318|NSP3_ARATH Nitrile-specifier protein 3 OS=Arabidopsis thaliana GN=NSP3 PE=2 SV=1 Back     alignment and function description
>sp|Q8RY71|ESP_ARATH Epithiospecifier protein OS=Arabidopsis thaliana GN=ESP PE=1 SV=2 Back     alignment and function description
>sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 Back     alignment and function description
>sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 Back     alignment and function description
>sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 Back     alignment and function description
>sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query329
224131878331 predicted protein [Populus trichocarpa] 0.978 0.972 0.788 1e-152
356525790328 PREDICTED: nitrile-specifier protein 5-l 0.975 0.978 0.757 1e-145
255646523328 unknown [Glycine max] 0.975 0.978 0.753 1e-145
357451775325 Nitrile-specifier protein [Medicago trun 0.975 0.987 0.760 1e-143
225447524327 PREDICTED: nitrile-specifier protein 5 [ 0.981 0.987 0.750 1e-142
388505252325 unknown [Medicago truncatula] 0.975 0.987 0.753 1e-141
388511483325 unknown [Lotus japonicus] 0.975 0.987 0.741 1e-141
18398038329 galactose oxidase/kelch repeat-containin 0.924 0.924 0.720 1e-138
449444468324 PREDICTED: nitrile-specifier protein 5-l 0.981 0.996 0.721 1e-137
297829326332 kelch repeat-containing protein [Arabido 0.911 0.903 0.713 1e-135
>gi|224131878|ref|XP_002321201.1| predicted protein [Populus trichocarpa] gi|222861974|gb|EEE99516.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  542 bits (1397), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 254/322 (78%), Positives = 286/322 (88%)

Query: 6   GTWIKLDQKGSGPGARSSHAITIVGQKVYAFGGEFTPRVPVDNNLHVFDLETLTWSVADV 65
           G W+KL+QKG+G GARSSHAIT+VG + YAFGGEF PRVPVDN LHVF+L+TLTWSVAD 
Sbjct: 8   GKWVKLNQKGTGLGARSSHAITLVGHEAYAFGGEFAPRVPVDNKLHVFNLQTLTWSVADG 67

Query: 66  TGDVPPPRVGVTMAAVGHTIYMFGGRDGTHKELNELYSFDTRTNQWTLLSNGDAGPPHRS 125
           TGD+PPPRVGVTMA VG TIY+FGGRD THKELNELYSFDT TNQWTLLSNGDAGPPHRS
Sbjct: 68  TGDIPPPRVGVTMATVGKTIYVFGGRDATHKELNELYSFDTSTNQWTLLSNGDAGPPHRS 127

Query: 126 YHSTAADDRHVYIFGGCGVSGRLNDLWGFDVVDRKWIQYPSAGENCKGRGGPGLIVTQGK 185
           YHSTA+DDRHVYIFGGCGV+GRLNDLW +DV+++KW++YP+ G+NCKGRGG GL V QGK
Sbjct: 128 YHSTASDDRHVYIFGGCGVAGRLNDLWEYDVIEKKWVKYPTPGDNCKGRGGTGLAVAQGK 187

Query: 186 IWVVYGFAGVEVDDVHCFDPAHAQWAQVETSGEKPTARSVFSTVGIGKHIVVYGGEVDPS 245
           IWVVYGF+GVE++DVHCFDP    W QV+TSGEKP+ARSVFSTVGIGK+I++ GGEVDPS
Sbjct: 188 IWVVYGFSGVEMNDVHCFDPIQGTWTQVDTSGEKPSARSVFSTVGIGKYIIISGGEVDPS 247

Query: 246 DLGHLGAGKFAGELYSLDTETLVWTRWDDGPGSDHHPGPRGWCAFAGGLRGGKHGLLVYG 305
           DLGHLGAGKFA E Y+LDT+TL W R +DG GSD HPGPRGWCAFAGG   G  GLLV G
Sbjct: 248 DLGHLGAGKFASEAYALDTDTLTWKRLNDGLGSDDHPGPRGWCAFAGGCLNGNQGLLVCG 307

Query: 306 GNSPSNDRLDDIYFFTPCLDGI 327
           GNSPSNDRLDDI+FFTPC+D I
Sbjct: 308 GNSPSNDRLDDIFFFTPCVDAI 329

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356525790|ref|XP_003531506.1| PREDICTED: nitrile-specifier protein 5-like [Glycine max] Back     alignment and taxonomy information
>gi|255646523|gb|ACU23739.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|357451775|ref|XP_003596164.1| Nitrile-specifier protein [Medicago truncatula] gi|355485212|gb|AES66415.1| Nitrile-specifier protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|225447524|ref|XP_002267128.1| PREDICTED: nitrile-specifier protein 5 [Vitis vinifera] Back     alignment and taxonomy information
>gi|388505252|gb|AFK40692.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|388511483|gb|AFK43803.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|18398038|ref|NP_566316.1| galactose oxidase/kelch repeat-containing protein [Arabidopsis thaliana] gi|6466955|gb|AAF13090.1|AC009176_17 unknown protein [Arabidopsis thaliana] gi|6648184|gb|AAF21182.1|AC013483_6 unknown protein [Arabidopsis thaliana] gi|11692832|gb|AAG40019.1|AF324668_1 MLP3.17 [Arabidopsis thaliana] gi|11993873|gb|AAG42920.1|AF329503_1 unknown protein [Arabidopsis thaliana] gi|14517448|gb|AAK62614.1| AT3g07720/F17A17_6 [Arabidopsis thaliana] gi|21280883|gb|AAM44920.1| unknown protein [Arabidopsis thaliana] gi|23507767|gb|AAN38687.1| At3g07720/F17A17_6 [Arabidopsis thaliana] gi|332641071|gb|AEE74592.1| galactose oxidase/kelch repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449444468|ref|XP_004139996.1| PREDICTED: nitrile-specifier protein 5-like isoform 1 [Cucumis sativus] gi|449444470|ref|XP_004139997.1| PREDICTED: nitrile-specifier protein 5-like isoform 2 [Cucumis sativus] gi|449444472|ref|XP_004139998.1| PREDICTED: nitrile-specifier protein 5-like isoform 3 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297829326|ref|XP_002882545.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297328385|gb|EFH58804.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query329
TAIR|locus:2077502329 AT3G07720 "AT3G07720" [Arabido 0.966 0.966 0.720 2.6e-134
TAIR|locus:2164733326 NSP5 "AT5G48180" [Arabidopsis 0.966 0.975 0.565 1.8e-103
TAIR|locus:2088304470 NSP1 "AT3G16400" [Arabidopsis 0.954 0.668 0.518 5e-92
TAIR|locus:2088329619 NSP4 "AT3G16410" [Arabidopsis 0.954 0.507 0.5 1.2e-90
TAIR|locus:2088289467 NSP3 "AT3G16390" [Arabidopsis 0.945 0.665 0.509 8.6e-88
TAIR|locus:2014400341 ESP "epithiospecifier protein" 0.738 0.712 0.435 1.2e-51
DICTYBASE|DDB_G0272386447 DDB_G0272386 "cyclin-like F-bo 0.768 0.565 0.295 7.4e-26
ASPGD|ASPL0000027105337 AN8430 [Emericella nidulans (t 0.772 0.753 0.290 6.1e-23
UNIPROTKB|Q5EA50372 RABEPK "Rab9 effector protein 0.702 0.620 0.314 2.6e-22
DICTYBASE|DDB_G0270750485 DDB_G0270750 "Kelch repeat-con 0.689 0.468 0.303 3e-22
TAIR|locus:2077502 AT3G07720 "AT3G07720" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1316 (468.3 bits), Expect = 2.6e-134, P = 2.6e-134
 Identities = 229/318 (72%), Positives = 265/318 (83%)

Query:     5 KGTWIKLDQKGSGPGARSSHAITIVGQKVYAFGGEFTPRVPVDNNLHVFDLETLTWSVAD 64
             +G W++L QKG+GPGARSSHAI +VG K+YAFGGEF PRVPVDN L+VFDLET TWS+ +
Sbjct:     7 EGKWVQLKQKGTGPGARSSHAIALVGNKMYAFGGEFQPRVPVDNQLYVFDLETQTWSIQE 66

Query:    65 VTGDVPPPRVGVTMAAVGHTIYMFGGRDGTHKELNELYSFDTRTNQWTLLSNGDAGPPHR 124
              +GD PPPRVGV MAAVG  IY FGGRD TH+ELNELY F+T TNQW LLS+G+ GP +R
Sbjct:    67 ASGDAPPPRVGVAMAAVGPIIYFFGGRDSTHQELNELYCFNTLTNQWKLLSSGETGPQNR 126

Query:   125 SYHSTAADDRHVYIFGGCGVSGRLNDLWGFDVVDRKWIQYPSAGENCKGRGGPGLIVTQG 184
             SYHS  AD ++VY+FGGCGV GRLNDLW ++VVD+KWI++PS GE C+GRGGPGL V QG
Sbjct:   127 SYHSITADSQNVYVFGGCGVDGRLNDLWAYNVVDQKWIKFPSPGEACRGRGGPGLEVVQG 186

Query:   185 KIWVVYGFAGVEVDDVHCFDPAHAQWAQVETSGEKPTARSVFSTVGIGKHIVVYGGEVDP 244
             KIWVVYGFAG E DDVHCFD A  +W +VET GEKP+ARSVFST  +GK I++ GGE+DP
Sbjct:   187 KIWVVYGFAGEEADDVHCFDIAKGEWKEVETKGEKPSARSVFSTAVVGKQILISGGEIDP 246

Query:   245 SDLGHLGAGKFAGELYSLDTETLVWTRWDDGPGSDHHPGPRGWCAFAGGLRGGKHGLLVY 304
             SDLGH+GAG F G+ Y LDTETL W +W+DG GS  HPGPRGWCAFA G R GK GLLVY
Sbjct:   247 SDLGHMGAGCFTGDAYGLDTETLEWRKWEDGVGSVEHPGPRGWCAFAAGSRDGKQGLLVY 306

Query:   305 GGNSPSNDRLDDIYFFTP 322
             GGNSPSNDRLDDI+FFTP
Sbjct:   307 GGNSPSNDRLDDIFFFTP 324
GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISM;IDA
GO:0005634 "nucleus" evidence=IDA
GO:0010043 "response to zinc ion" evidence=IEP
GO:0005829 "cytosol" evidence=IDA
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
TAIR|locus:2164733 NSP5 "AT5G48180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2088304 NSP1 "AT3G16400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2088329 NSP4 "AT3G16410" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2088289 NSP3 "AT3G16390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2014400 ESP "epithiospecifier protein" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0272386 DDB_G0272386 "cyclin-like F-box containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ASPGD|ASPL0000027105 AN8430 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|Q5EA50 RABEPK "Rab9 effector protein with kelch motifs" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0270750 DDB_G0270750 "Kelch repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.1.3.n1LOW CONFIDENCE prediction!
3rd Layer5.1.3LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
grail3.0012033501
hypothetical protein (331 aa)
(Populus trichocarpa)
Predicted Functional Partners:
grail3.0036011001
f-box family protein (352 aa)
  •     0.501
fgenesh4_pg.C_LG_III001854
f-box family protein (341 aa)
  •     0.500
gw1.VIII.2030.1
f-box family protein (338 aa)
  •     0.498

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query329
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 1e-122
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 1e-101
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 2e-12
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 1e-10
PRK14131376 PRK14131, PRK14131, N-acetylneuraminic acid mutaro 2e-07
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 4e-07
pfam0134446 pfam01344, Kelch_1, Kelch motif 5e-07
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 2e-06
pfam0134446 pfam01344, Kelch_1, Kelch motif 2e-06
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 4e-06
pfam1396450 pfam13964, Kelch_6, Kelch motif 6e-06
TIGR03547346 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family 2e-05
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 5e-05
pfam1396450 pfam13964, Kelch_6, Kelch motif 8e-05
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 2e-04
pfam1385442 pfam13854, Kelch_5, Kelch motif 6e-04
pfam1385442 pfam13854, Kelch_5, Kelch motif 8e-04
COG3055381 COG3055, COG3055, Uncharacterized protein conserve 0.001
pfam0134446 pfam01344, Kelch_1, Kelch motif 0.002
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 0.002
pfam1396450 pfam13964, Kelch_6, Kelch motif 0.002
pfam0764648 pfam07646, Kelch_2, Kelch motif 0.002
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information 
 Score =  358 bits (919), Expect = e-122
 Identities = 161/316 (50%), Positives = 217/316 (68%), Gaps = 2/316 (0%)

Query: 6   GTWIKLDQKGSGPGARSSHAITIVGQKVYAFGGEFTPRVPVDNNLHVFDLETLTWSVADV 65
           G WIK++QKG GPG R SH I  VG K+Y+FGGEFTP  P+D +L+VFDLET TWS++  
Sbjct: 151 GKWIKVEQKGEGPGLRCSHGIAQVGNKIYSFGGEFTPNQPIDKHLYVFDLETRTWSISPA 210

Query: 66  TGDVPPPR-VGVTMAAVGHTIYMFGGRDGTHKELNELYSFDTRTNQWTLLSNGDAGPPHR 124
           TGDVP    +GV M ++G T+Y+FGGRD + ++ N  YSFDT TN+W LL+  + GP  R
Sbjct: 211 TGDVPHLSCLGVRMVSIGSTLYVFGGRDAS-RQYNGFYSFDTTTNEWKLLTPVEEGPTPR 269

Query: 125 SYHSTAADDRHVYIFGGCGVSGRLNDLWGFDVVDRKWIQYPSAGENCKGRGGPGLIVTQG 184
           S+HS AAD+ +VY+FGG   + RL  L  +++VD+KW    + G++   RGG GL V QG
Sbjct: 270 SFHSMAADEENVYVFGGVSATARLKTLDSYNIVDKKWFHCSTPGDSFSIRGGAGLEVVQG 329

Query: 185 KIWVVYGFAGVEVDDVHCFDPAHAQWAQVETSGEKPTARSVFSTVGIGKHIVVYGGEVDP 244
           K+WVVYGF G EVDDVH +DP   +W QVET G +P+ RSVF++  +GKHIV++GGE+  
Sbjct: 330 KVWVVYGFNGCEVDDVHYYDPVQDKWTQVETFGVRPSERSVFASAAVGKHIVIFGGEIAM 389

Query: 245 SDLGHLGAGKFAGELYSLDTETLVWTRWDDGPGSDHHPGPRGWCAFAGGLRGGKHGLLVY 304
             L H+G G+     ++LDTETL W R D     +  P  RGW A   G   GK GL+++
Sbjct: 390 DPLAHVGPGQLTDGTFALDTETLQWERLDKFGEEEETPSSRGWTASTTGTIDGKKGLVMH 449

Query: 305 GGNSPSNDRLDDIYFF 320
           GG +P+NDR DD++F+
Sbjct: 450 GGKAPTNDRFDDLFFY 465

Length = 470
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|237617 PRK14131, PRK14131, N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|234253 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|222419 pfam13854, Kelch_5, Kelch motif Back     alignment and domain information
>gnl|CDD|222419 pfam13854, Kelch_5, Kelch motif Back     alignment and domain information
>gnl|CDD|225597 COG3055, COG3055, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|116261 pfam07646, Kelch_2, Kelch motif Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 329
PLN02193470 nitrile-specifier protein 100.0
PLN02153341 epithiospecifier protein 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PLN02193470 nitrile-specifier protein 100.0
PHA02713557 hypothetical protein; Provisional 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
PLN02153341 epithiospecifier protein 100.0
PHA02713557 hypothetical protein; Provisional 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 100.0
PHA03098534 kelch-like protein; Provisional 100.0
PHA03098534 kelch-like protein; Provisional 100.0
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 100.0
KOG1230 521 consensus Protein containing repeated kelch motifs 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 100.0
KOG1230 521 consensus Protein containing repeated kelch motifs 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.97
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.93
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.87
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 99.76
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 99.67
PF1396450 Kelch_6: Kelch motif 99.33
PF1396450 Kelch_6: Kelch motif 99.25
PF03089337 RAG2: Recombination activating protein 2; InterPro 99.11
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.08
PF1341549 Kelch_3: Galactose oxidase, central domain 99.07
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.05
PF1341549 Kelch_3: Galactose oxidase, central domain 99.03
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 99.03
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.98
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.98
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.92
PLN02772 398 guanylate kinase 98.91
PLN02772398 guanylate kinase 98.89
PF1385442 Kelch_5: Kelch motif 98.87
PF1385442 Kelch_5: Kelch motif 98.77
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.7
smart0061247 Kelch Kelch domain. 98.69
smart0061247 Kelch Kelch domain. 98.65
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.55
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.46
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.45
PF03089337 RAG2: Recombination activating protein 2; InterPro 98.35
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.25
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.01
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.71
PRK13684334 Ycf48-like protein; Provisional 97.59
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 97.58
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 97.58
PF12768281 Rax2: Cortical protein marker for cell polarity 97.31
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 97.25
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 97.24
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.23
PF12768281 Rax2: Cortical protein marker for cell polarity 97.21
PRK13684334 Ycf48-like protein; Provisional 97.09
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 97.05
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 96.98
KOG2055514 consensus WD40 repeat protein [General function pr 96.88
PLN00033398 photosystem II stability/assembly factor; Provisio 96.8
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 96.79
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.74
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 96.65
KOG2055 514 consensus WD40 repeat protein [General function pr 96.54
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.09
smart00284255 OLF Olfactomedin-like domains. 96.07
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 95.96
PLN00033398 photosystem II stability/assembly factor; Provisio 95.79
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 95.78
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 95.69
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 95.66
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 95.31
COG4946 668 Uncharacterized protein related to the periplasmic 95.3
KOG0310 487 consensus Conserved WD40 repeat-containing protein 95.17
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 95.11
PRK05137435 tolB translocation protein TolB; Provisional 94.7
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 94.63
PRK04792448 tolB translocation protein TolB; Provisional 94.62
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 94.56
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 94.36
PF12217367 End_beta_propel: Catalytic beta propeller domain o 93.93
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 93.83
COG4946 668 Uncharacterized protein related to the periplasmic 93.78
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 93.6
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 93.51
PRK04792448 tolB translocation protein TolB; Provisional 93.25
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 93.18
PRK00178430 tolB translocation protein TolB; Provisional 93.12
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 92.87
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 92.82
PRK05137435 tolB translocation protein TolB; Provisional 92.76
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 92.62
PTZ00421 493 coronin; Provisional 92.45
PRK04922433 tolB translocation protein TolB; Provisional 92.34
PRK00178430 tolB translocation protein TolB; Provisional 92.21
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 91.84
PRK04922433 tolB translocation protein TolB; Provisional 91.6
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 91.27
PTZ00421 493 coronin; Provisional 90.5
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 90.39
PF03178 321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 90.36
PRK03629429 tolB translocation protein TolB; Provisional 90.2
KOG2048 691 consensus WD40 repeat protein [General function pr 90.16
PRK11028330 6-phosphogluconolactonase; Provisional 89.95
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 89.84
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 89.76
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 89.19
KOG0649325 consensus WD40 repeat protein [General function pr 89.12
COG4447339 Uncharacterized protein related to plant photosyst 88.79
PRK04043419 tolB translocation protein TolB; Provisional 88.25
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 86.97
KOG0310487 consensus Conserved WD40 repeat-containing protein 86.43
PRK11028330 6-phosphogluconolactonase; Provisional 86.07
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 86.05
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 85.57
PRK03629429 tolB translocation protein TolB; Provisional 84.89
PLN00181793 protein SPA1-RELATED; Provisional 84.77
KOG3545249 consensus Olfactomedin and related extracellular m 83.93
PRK02889427 tolB translocation protein TolB; Provisional 82.63
PRK04043419 tolB translocation protein TolB; Provisional 81.41
smart00284255 OLF Olfactomedin-like domains. 81.15
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 80.43
>PLN02193 nitrile-specifier protein Back     alignment and domain information 
Probab=100.00  E-value=1.7e-52  Score=374.16  Aligned_cols=319  Identities=50%  Similarity=0.990  Sum_probs=270.4

Q ss_pred             cceeEEeccCCCCCCCCcceeEEEECCEEEEEcCccCCCCccCCceEEEeCCCCcEEEEeeCCCCCC-CCcceeEEEECC
Q 020245            5 KGTWIKLDQKGSGPGARSSHAITIVGQKVYAFGGEFTPRVPVDNNLHVFDLETLTWSVADVTGDVPP-PRVGVTMAAVGH   83 (329)
Q Consensus         5 ~~~W~~~~~~~~~p~~r~~~~~~~~~~~l~~~GG~~~~~~~~~~~~~~~d~~~~~W~~~~~~~~~p~-~r~~~~~~~~~~   83 (329)
                      .++|.++++.++.|.+|..|++++++++||++||.........+++++||+.+++|+.++.....|. .|..|+++++++
T Consensus       150 ~~~W~~~~~~~~~P~pR~~h~~~~~~~~iyv~GG~~~~~~~~~~~v~~yD~~~~~W~~~~~~g~~P~~~~~~~~~v~~~~  229 (470)
T PLN02193        150 LGKWIKVEQKGEGPGLRCSHGIAQVGNKIYSFGGEFTPNQPIDKHLYVFDLETRTWSISPATGDVPHLSCLGVRMVSIGS  229 (470)
T ss_pred             hceEEEcccCCCCCCCccccEEEEECCEEEEECCcCCCCCCeeCcEEEEECCCCEEEeCCCCCCCCCCcccceEEEEECC
Confidence            4799999987778999999999999999999999865444455789999999999998776654555 467889999999


Q ss_pred             EEEEEccccCCCCCCCceEEEECCCCcEEEcccCCCCCCCcccceeEeeCCeEEEEcccCCCcCcceeEEEEcCCCeEEE
Q 020245           84 TIYMFGGRDGTHKELNELYSFDTRTNQWTLLSNGDAGPPHRSYHSTAADDRHVYIFGGCGVSGRLNDLWGFDVVDRKWIQ  163 (329)
Q Consensus        84 ~iyv~GG~~~~~~~~~~~~~~d~~~~~W~~~~~~~~~p~~r~~~~~~~~~~~i~v~GG~~~~~~~~~~~~~~~~~~~W~~  163 (329)
                      +|||+||.. ....++++++||+.+++|+++.+++..|.+|..|+++..+++|||+||......++++++||+.+++|+.
T Consensus       230 ~lYvfGG~~-~~~~~ndv~~yD~~t~~W~~l~~~~~~P~~R~~h~~~~~~~~iYv~GG~~~~~~~~~~~~yd~~t~~W~~  308 (470)
T PLN02193        230 TLYVFGGRD-ASRQYNGFYSFDTTTNEWKLLTPVEEGPTPRSFHSMAADEENVYVFGGVSATARLKTLDSYNIVDKKWFH  308 (470)
T ss_pred             EEEEECCCC-CCCCCccEEEEECCCCEEEEcCcCCCCCCCccceEEEEECCEEEEECCCCCCCCcceEEEEECCCCEEEe
Confidence            999999988 4567899999999999999999887668899999999999999999998877778899999999999999


Q ss_pred             ecCCCCCCCCCCCcEEEEECCEEEEEeeeCCCCcccEEEEeCCCCceEEeeccCCCCCCcceeEEEEECCEEEEEcCccC
Q 020245          164 YPSAGENCKGRGGPGLIVTQGKIWVVYGFAGVEVDDVHCFDPAHAQWAQVETSGEKPTARSVFSTVGIGKHIVVYGGEVD  243 (329)
Q Consensus       164 ~~~~~~~~~~~~~~~~~~~~~~l~v~gG~~~~~~~~~~~~d~~~~~w~~~~~~~~~p~~r~~~~~~~~~~~i~i~GG~~~  243 (329)
                      ++.....+.+|..++++.+++++|++||.++...+++++||+.+++|+++...+..|.+|..|++++++++|||+||...
T Consensus       309 ~~~~~~~~~~R~~~~~~~~~gkiyviGG~~g~~~~dv~~yD~~t~~W~~~~~~g~~P~~R~~~~~~~~~~~iyv~GG~~~  388 (470)
T PLN02193        309 CSTPGDSFSIRGGAGLEVVQGKVWVVYGFNGCEVDDVHYYDPVQDKWTQVETFGVRPSERSVFASAAVGKHIVIFGGEIA  388 (470)
T ss_pred             CCCCCCCCCCCCCcEEEEECCcEEEEECCCCCccCceEEEECCCCEEEEeccCCCCCCCcceeEEEEECCEEEEECCccC
Confidence            98755556789999999999999999998766678999999999999999877677899999999999999999999876


Q ss_pred             CCCCCcCCCCeeeceeEEEEcCCceeEeecCCCCCCCCCCCCCcceecccccCCcceEEEEcCCCCCCCcccceEEEecc
Q 020245          244 PSDLGHLGAGKFAGELYSLDTETLVWTRWDDGPGSDHHPGPRGWCAFAGGLRGGKHGLLVYGGNSPSNDRLDDIYFFTPC  323 (329)
Q Consensus       244 ~~~~~~~~~~~~~~~~~~~d~~~~~W~~~~~~~~~~~~p~~r~~~~~~~~~~~~~~~i~i~GG~~~~~~~~~~v~~~~~~  323 (329)
                      .....+...+...+++++||+.+++|+.+...+.....|.+|.++++.++.+.+++.|++|||.+..+..++|+|+|++.
T Consensus       389 ~~~~~~~~~~~~~ndv~~~D~~t~~W~~~~~~~~~~~~P~~R~~~~~~~~~~~~~~~~~~fGG~~~~~~~~~D~~~~~~~  468 (470)
T PLN02193        389 MDPLAHVGPGQLTDGTFALDTETLQWERLDKFGEEEETPSSRGWTASTTGTIDGKKGLVMHGGKAPTNDRFDDLFFYGID  468 (470)
T ss_pred             CccccccCccceeccEEEEEcCcCEEEEcccCCCCCCCCCCCccccceeeEEcCCceEEEEcCCCCccccccceEEEecC
Confidence            44333444456778999999999999999863333356888987433344455546699999998878999999999876


Q ss_pred             c
Q 020245          324 L  324 (329)
Q Consensus       324 ~  324 (329)
                      +
T Consensus       469 ~  469 (470)
T PLN02193        469 S  469 (470)
T ss_pred             C
Confidence            5

>PLN02153 epithiospecifier protein Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4447 Uncharacterized protein related to plant photosystem II stability/assembly factor [General function prediction only] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG3545 consensus Olfactomedin and related extracellular matrix glycoproteins [Extracellular structures] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query329
1u6d_X308 Crystal Structure Of The Kelch Domain Of Human Keap 1e-08
3vng_A309 Crystal Structure Of Keap1 In Complex With Syntheti 1e-08
1x2j_A316 Structural Basis For The Defects Of Human Lung Canc 2e-08
2dyh_A318 Crystal Structure Of The Keap1 Protein In Complexed 2e-08
1zgk_A308 1.35 Angstrom Structure Of The Kelch Domain Of Keap 5e-08
3ii7_A306 Crystal Structure Of The Kelch Domain Of Human Klhl 2e-05
2vpj_A301 Crystal Structure Of The Kelch Domain Of Human Klhl 4e-05
2woz_A318 The Novel Beta-Propeller Of The Btb-Kelch Protein K 2e-04
>pdb|1U6D|X Chain X, Crystal Structure Of The Kelch Domain Of Human Keap1 Length = 308 Back     alignment and structure 
Iteration: 1

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 84/194 (43%), Gaps = 13/194 (6%)
Query: 21  RSSHAITIVGQKVYAFGGEFTPRVPVDNNLHVFDLETLTWSVADVTGDVPPPRVGVTMAA 80
           R+   + ++   +YA GG         N++  ++ E   W    +   +   R+GV +A 
Sbjct: 112 RNRIGVGVIDGHIYAVGGSHG--CIHHNSVERYEPERDEW---HLVAPMLTRRIGVGVAV 166
Query: 81  VGHTIYMFGGRDGTHKELNELYSFDTRTNQWTLLSNGDAGPPHRSYHSTAADDRHVYIFG 140
           +   +Y  GG DGT++ LN    +    N+W +++   A    RS          +Y  G
Sbjct: 167 LNRLLYAVGGFDGTNR-LNSAECYYPERNEWRMIT---AMNTIRSGAGVCVLHNCIYAAG 222
Query: 141 GCGVSGRLNDLWGFDVVDRKWIQYPSAGENCKGRGGPGLIVTQGKIWVVYGFAG-VEVDD 199
           G     +LN +  +DV    W            R   G+ V QG+I+V+ G+ G   +D 
Sbjct: 223 GYDGQDQLNSVERYDVETETWTFVAPMKHR---RSALGITVHQGRIYVLGGYDGHTFLDS 279
Query: 200 VHCFDPAHAQWAQV 213
           V C+DP    W++V
Sbjct: 280 VECYDPDTDTWSEV 293
>pdb|3VNG|A Chain A, Crystal Structure Of Keap1 In Complex With Synthetic Small Molecular Based On A Co-crystallization Length = 309 Back     alignment and structure
>pdb|1X2J|A Chain A, Structural Basis For The Defects Of Human Lung Cancer Somatic Mutations In The Repression Activity Of Keap1 On Nrf2 Length = 316 Back     alignment and structure
>pdb|2DYH|A Chain A, Crystal Structure Of The Keap1 Protein In Complexed With The N-Terminal Region Of The Nrf2 Transcription Factor Length = 318 Back     alignment and structure
>pdb|1ZGK|A Chain A, 1.35 Angstrom Structure Of The Kelch Domain Of Keap1 Length = 308 Back     alignment and structure
>pdb|3II7|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl7 Length = 306 Back     alignment and structure
>pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301 Back     alignment and structure
>pdb|2WOZ|A Chain A, The Novel Beta-Propeller Of The Btb-Kelch Protein Krp1 Provides The Binding Site For Lasp-1 That Is Necessary For Pseudopodia Extension Length = 318 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query329
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 4e-39
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 7e-31
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 3e-28
2zwa_A 695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 1e-18
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 7e-17
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 1e-08
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 3e-35
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 4e-25
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 7e-30
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 3e-27
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 1e-23
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 2e-19
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 8e-29
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 5e-25
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 1e-13
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 1e-28
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 7e-25
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 1e-17
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 2e-15
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 3e-28
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 8e-27
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 5e-13
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 7e-13
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 5e-27
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 3e-26
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 4e-25
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 1e-20
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 3e-26
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-24
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-19
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-18
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 4e-05
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
 Score =  145 bits (367), Expect = 4e-39
 Identities = 52/311 (16%), Positives = 99/311 (31%), Gaps = 38/311 (12%)

Query: 15  GSGPGARSSHAITIVGQKVYAFGGEFTPRVPVDNNLHVFDLETLTWSVADV---TGDVPP 71
              P  R    + + G  V+  GG    RV   N +    +      + ++   + +VP 
Sbjct: 382 CECPINRKFGDVDVAGNDVFYMGGSNPYRV---NEILQLSIHYDKIDMKNIEVSSSEVPV 438

Query: 72  PRVGVTMAAVGH--TIYMFGGRDGTHKELNELYSFDTRTNQWTLLSNGDAGPPHRSYHS- 128
            R+  T   +     + + GGR   H+ L++ + FD +T +W+++ +       R  HS 
Sbjct: 439 ARMCHTFTTISRNNQLLLIGGRKAPHQGLSDNWIFDMKTREWSMIKS---LSHTRFRHSA 495

Query: 129 TAADDRHVYIFGGCGVSGRLNDLWGFDVVDRKWIQYPSAGENCKGRGGPGLIVT----QG 184
            +  D +V I GG         +  ++V +  +       E  +       +      + 
Sbjct: 496 CSLPDGNVLILGGVTEG---PAMLLYNVTEEIFKDVTPKDEFFQNSLVSAGLEFDPVSKQ 552

Query: 185 KIWVVYGFAGVEV--DDVHCF----DPAHAQWAQVETSGEKPTARSVFSTVGIGKH-IVV 237
            I +  GF       D    F    + A      ++        R       I    +++
Sbjct: 553 GIILGGGFMDQTTVSDKAIIFKYDAENATEPITVIKKLQHPLFQRYGSQIKYITPRKLLI 612

Query: 238 YGGEVDPSDLGHLGAGKFAGELYSLDTETLVWTR--WDDGPGSDHHPGPRGWCAFAGGLR 295
            GG                  + SLD  +   T          DH     G+   +    
Sbjct: 613 VGGTSPSGLFDR------TNSIISLDPLSETLTSIPISRRIWEDHSLMLAGFSLVS--TS 664

Query: 296 GGKHGLLVYGG 306
            G   + + GG
Sbjct: 665 MGT--IHIIGG 673
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query329
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 100.0
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.6
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.53
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.37
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.35
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.05
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 98.04
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.04
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.98
3v9f_A 781 Two-component system sensor histidine kinase/RESP 97.97
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.96
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.94
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.93
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.91
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 97.86
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 97.86
4a2l_A 795 BT_4663, two-component system sensor histidine kin 97.85
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.83
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.81
3jrp_A379 Fusion protein of protein transport protein SEC13 97.78
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.78
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.74
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.74
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.71
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.68
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.66
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.61
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.55
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.52
3v9f_A781 Two-component system sensor histidine kinase/RESP 97.52
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.52
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.5
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.49
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 97.46
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 97.45
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 97.43
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.42
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.41
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.39
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 97.39
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 97.35
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.31
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 97.3
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 97.3
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 97.29
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.29
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 97.26
4a2l_A795 BT_4663, two-component system sensor histidine kin 97.24
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 97.22
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.21
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 97.19
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.18
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 97.15
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.14
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 97.1
3jro_A 753 Fusion protein of protein transport protein SEC13 97.06
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 97.05
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 97.03
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 97.02
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.02
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 96.98
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 96.97
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 96.94
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.94
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 96.93
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 96.9
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 96.87
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 96.87
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 96.86
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 96.83
4g56_B357 MGC81050 protein; protein arginine methyltransfera 96.8
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 96.8
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.79
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 96.78
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 96.77
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 96.75
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 96.75
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 96.74
3jrp_A 379 Fusion protein of protein transport protein SEC13 96.72
3ott_A 758 Two-component system sensor histidine kinase; beta 96.65
4g56_B357 MGC81050 protein; protein arginine methyltransfera 96.63
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 96.62
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.62
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 96.61
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 96.61
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 96.61
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 96.55
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 96.44
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 96.43
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 96.41
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 96.36
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 96.32
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 96.27
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 96.22
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 96.2
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 96.2
2fp8_A322 Strictosidine synthase; six bladed beta propeller 96.2
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 96.15
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 96.14
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 96.14
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 96.13
4e54_B435 DNA damage-binding protein 2; beta barrel, double 96.12
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 96.12
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.1
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 96.09
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 96.09
3jro_A 753 Fusion protein of protein transport protein SEC13 96.07
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 96.06
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 96.04
4e54_B435 DNA damage-binding protein 2; beta barrel, double 95.99
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 95.95
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 95.94
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 95.93
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 95.91
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 95.86
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 95.84
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 95.79
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 95.74
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 95.73
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 95.71
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 95.63
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 95.58
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 95.57
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 95.54
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 95.53
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 95.52
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 95.52
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 95.46
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 95.43
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 95.41
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 95.38
1itv_A195 MMP9; adaptive molecular recognition, beta propell 95.37
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 95.32
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 95.31
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 95.3
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 95.25
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 95.18
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 95.18
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 95.17
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 95.15
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 95.09
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 95.02
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 95.02
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 95.01
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 95.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 94.96
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 94.92
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 94.89
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 94.89
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 94.87
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 94.86
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 94.84
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 94.75
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 94.74
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 94.74
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 94.72
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 94.72
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 94.67
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 94.66
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 94.64
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 94.63
1itv_A195 MMP9; adaptive molecular recognition, beta propell 94.62
1gen_A218 Gelatinase A; hydrolase, hemopexin domain, metallo 94.6
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 94.58
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 94.55
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 94.53
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 94.51
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 94.46
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 94.37
2ymu_A577 WD-40 repeat protein; unknown function, two domain 94.32
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 94.3
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 94.29
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 94.28
3ba0_A365 Macrophage metalloelastase; FULL-length MMP-12, he 94.26
2xyi_A430 Probable histone-binding protein CAF1; transcripti 94.25
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 94.12
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 94.06
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 94.02
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 93.97
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 93.93
3ott_A 758 Two-component system sensor histidine kinase; beta 93.85
1su3_A450 Interstitial collagenase; prodomain, hemopexin dom 93.67
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 93.61
1su3_A450 Interstitial collagenase; prodomain, hemopexin dom 93.55
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 93.4
2xyi_A430 Probable histone-binding protein CAF1; transcripti 93.28
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 93.28
2pm7_B297 Protein transport protein SEC13, protein transport 93.2
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 93.11
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 92.81
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 92.8
1hxn_A219 Hemopexin, HPX; heme, binding protein; 1.80A {Oryc 92.79
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 92.77
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 92.73
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 92.69
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 92.66
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 92.59
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 92.51
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 92.35
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 92.2
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 92.06
2fp8_A322 Strictosidine synthase; six bladed beta propeller 92.02
3c7x_A196 Matrix metalloproteinase-14; membrane protein inte 91.93
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 91.84
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 91.73
2p4o_A306 Hypothetical protein; putative lactonase, structur 91.7
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 91.63
2ymu_A577 WD-40 repeat protein; unknown function, two domain 91.62
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 91.51
3ju4_A 670 Endo-N-acetylneuraminidase; endonf, polysia, high- 91.39
1gen_A218 Gelatinase A; hydrolase, hemopexin domain, metallo 90.96
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 90.77
3c7x_A196 Matrix metalloproteinase-14; membrane protein inte 90.34
3ba0_A365 Macrophage metalloelastase; FULL-length MMP-12, he 90.18
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 90.12
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 90.01
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 89.85
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 89.84
3oyo_A225 Hemopexin fold protein CP4; seeds, plant protein; 89.81
3p5b_L400 Low density lipoprotein receptor variant; B-propel 89.73
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 89.05
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 88.88
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 88.73
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 88.17
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 87.94
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 87.91
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 87.6
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 87.58
1ck7_A631 Protein (gelatinase A); hydrolase (metalloprotease 87.47
1k32_A 1045 Tricorn protease; protein degradation, substrate g 87.43
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 87.38
1hxn_A219 Hemopexin, HPX; heme, binding protein; 1.80A {Oryc 87.11
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 86.74
3oyo_A225 Hemopexin fold protein CP4; seeds, plant protein; 86.73
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 86.1
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 85.86
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 85.8
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 85.78
3lp9_A227 LS-24; SEED albumin, plant protein; HET: SPM; 2.20 85.23
2pm7_B297 Protein transport protein SEC13, protein transport 84.9
1ck7_A631 Protein (gelatinase A); hydrolase (metalloprotease 84.23
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 83.09
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 82.65
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 82.26
3v65_B386 Low-density lipoprotein receptor-related protein; 82.17
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 81.84
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 80.89
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 80.54
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
Probab=100.00  E-value=3.9e-50  Score=343.08  Aligned_cols=279  Identities=23%  Similarity=0.351  Sum_probs=240.0

Q ss_pred             CCCCCCcceeEEEECCEEEEEcCccCCCCccCCceEEEeCCCCcEEEEeeCCCCCCCCcceeEEEECCEEEEEcccc---
Q 020245           16 SGPGARSSHAITIVGQKVYAFGGEFTPRVPVDNNLHVFDLETLTWSVADVTGDVPPPRVGVTMAAVGHTIYMFGGRD---   92 (329)
Q Consensus        16 ~~p~~r~~~~~~~~~~~l~~~GG~~~~~~~~~~~~~~~d~~~~~W~~~~~~~~~p~~r~~~~~~~~~~~iyv~GG~~---   92 (329)
                      ..|.+|..++++.++++||++||..   ....+++++||+.+++|+.++.   +|.+|.+|++++++++||++||..   
T Consensus        10 ~~~~~~~~~~~~~~~~~i~v~GG~~---~~~~~~~~~~d~~~~~W~~~~~---~p~~r~~~~~~~~~~~lyv~GG~~~~~   83 (308)
T 1zgk_A           10 SSGLVPRGSHAPKVGRLIYTAGGYF---RQSLSYLEAYNPSNGTWLRLAD---LQVPRSGLAGCVVGGLLYAVGGRNNSP   83 (308)
T ss_dssp             -----------CCCCCCEEEECCBS---SSBCCCEEEEETTTTEEEECCC---CSSCCBSCEEEEETTEEEEECCEEEET
T ss_pred             cCCeeeCCccccCCCCEEEEEeCcC---CCCcceEEEEcCCCCeEeECCC---CCcccccceEEEECCEEEEECCCcCCC
Confidence            4577899999999999999999982   3345899999999999999865   778999999999999999999983   


Q ss_pred             CCCCCCCceEEEECCCCcEEEcccCCCCCCCcccceeEeeCCeEEEEcccCCCcCcceeEEEEcCCCeEEEecCCCCCCC
Q 020245           93 GTHKELNELYSFDTRTNQWTLLSNGDAGPPHRSYHSTAADDRHVYIFGGCGVSGRLNDLWGFDVVDRKWIQYPSAGENCK  172 (329)
Q Consensus        93 ~~~~~~~~~~~~d~~~~~W~~~~~~~~~p~~r~~~~~~~~~~~i~v~GG~~~~~~~~~~~~~~~~~~~W~~~~~~~~~~~  172 (329)
                      ......+++++||+.+++|++++++   |.+|..|+++.++++||++||......++++++||+.+++|+.++++   |.
T Consensus        84 ~~~~~~~~~~~~d~~~~~W~~~~~~---p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~yd~~~~~W~~~~~~---p~  157 (308)
T 1zgk_A           84 DGNTDSSALDCYNPMTNQWSPCAPM---SVPRNRIGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPM---LT  157 (308)
T ss_dssp             TEEEECCCEEEEETTTTEEEECCCC---SSCCBTCEEEEETTEEEEECCEETTEECCCEEEEETTTTEEEECCCC---SS
T ss_pred             CCCeecceEEEECCCCCeEeECCCC---CcCccccEEEEECCEEEEEcCCCCCcccccEEEECCCCCeEeECCCC---Cc
Confidence            2456778999999999999999887   78999999999999999999988777789999999999999999987   68


Q ss_pred             CCCCcEEEEECCEEEEEeeeCCC-CcccEEEEeCCCCceEEeeccCCCCCCcceeEEEEECCEEEEEcCccCCCCCCcCC
Q 020245          173 GRGGPGLIVTQGKIWVVYGFAGV-EVDDVHCFDPAHAQWAQVETSGEKPTARSVFSTVGIGKHIVVYGGEVDPSDLGHLG  251 (329)
Q Consensus       173 ~~~~~~~~~~~~~l~v~gG~~~~-~~~~~~~~d~~~~~w~~~~~~~~~p~~r~~~~~~~~~~~i~i~GG~~~~~~~~~~~  251 (329)
                      +|..|+++.++++||++||..+. ..+++++||+.+++|+.+.   .+|.+|..|+++.++++|||+||....       
T Consensus       158 ~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~yd~~~~~W~~~~---~~p~~r~~~~~~~~~~~iyv~GG~~~~-------  227 (308)
T 1zgk_A          158 RRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMIT---AMNTIRSGAGVCVLHNCIYAAGGYDGQ-------  227 (308)
T ss_dssp             CCBSCEEEEETTEEEEECCBCSSCBCCCEEEEETTTTEEEECC---CCSSCCBSCEEEEETTEEEEECCBCSS-------
T ss_pred             cccceEEEEECCEEEEEeCCCCCCcCceEEEEeCCCCeEeeCC---CCCCccccceEEEECCEEEEEeCCCCC-------
Confidence            89999999999999999998766 5789999999999999997   677999999999999999999998643       


Q ss_pred             CCeeeceeEEEEcCCceeEeecCCCCCCCCCCCCCcceecccccCCcceEEEEcCCCCCCCcccceEEEecccCCccC
Q 020245          252 AGKFAGELYSLDTETLVWTRWDDGPGSDHHPGPRGWCAFAGGLRGGKHGLLVYGGNSPSNDRLDDIYFFTPCLDGIED  329 (329)
Q Consensus       252 ~~~~~~~~~~~d~~~~~W~~~~~~~~~~~~p~~r~~~~~~~~~~~~~~~i~i~GG~~~~~~~~~~v~~~~~~~~~~~~  329 (329)
                        ...+++++||+++++|+.++.      +|.+|..  +++++++++  |||+||.+. ...++++++||+++++|++
T Consensus       228 --~~~~~v~~yd~~~~~W~~~~~------~p~~r~~--~~~~~~~~~--i~v~GG~~~-~~~~~~v~~yd~~~~~W~~  292 (308)
T 1zgk_A          228 --DQLNSVERYDVETETWTFVAP------MKHRRSA--LGITVHQGR--IYVLGGYDG-HTFLDSVECYDPDTDTWSE  292 (308)
T ss_dssp             --SBCCCEEEEETTTTEEEECCC------CSSCCBS--CEEEEETTE--EEEECCBCS-SCBCCEEEEEETTTTEEEE
T ss_pred             --CccceEEEEeCCCCcEEECCC------CCCCccc--eEEEEECCE--EEEEcCcCC-CcccceEEEEcCCCCEEee
Confidence              236789999999999999997      8899998  888889865  999999875 3678899999999999973
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>1gen_A Gelatinase A; hydrolase, hemopexin domain, metalloprotease, hydrolase (metalloprotease); 2.15A {Homo sapiens} SCOP: b.66.1.1 PDB: 1rtg_A Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1hxn_A Hemopexin, HPX; heme, binding protein; 1.80A {Oryctolagus cuniculus} SCOP: b.66.1.1 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3c7x_A Matrix metalloproteinase-14; membrane protein interaction, Pro-MMP-2, TIMP-2, metastasis, calcium, cleavage on PAIR of basic residues, hydrolase; 1.70A {Homo sapiens} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3ju4_A Endo-N-acetylneuraminidase; endonf, polysia, high-resolution, glycosidase, hydrolase; HET: SLB; 0.98A {Enterobacteria phage K1F} PDB: 3gvl_A* 3gvj_A* 3gvk_A* 1v0e_A 1v0f_A* Back     alignment and structure
>1gen_A Gelatinase A; hydrolase, hemopexin domain, metalloprotease, hydrolase (metalloprotease); 2.15A {Homo sapiens} SCOP: b.66.1.1 PDB: 1rtg_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3c7x_A Matrix metalloproteinase-14; membrane protein interaction, Pro-MMP-2, TIMP-2, metastasis, calcium, cleavage on PAIR of basic residues, hydrolase; 1.70A {Homo sapiens} Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3oyo_A Hemopexin fold protein CP4; seeds, plant protein; 2.10A {Vigna unguiculata} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1ck7_A Protein (gelatinase A); hydrolase (metalloprotease), FULL-length, metalloproteinase; 2.80A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1gxd_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1hxn_A Hemopexin, HPX; heme, binding protein; 1.80A {Oryctolagus cuniculus} SCOP: b.66.1.1 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3oyo_A Hemopexin fold protein CP4; seeds, plant protein; 2.10A {Vigna unguiculata} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3lp9_A LS-24; SEED albumin, plant protein; HET: SPM; 2.20A {Lathyrus sativus} PDB: 3s0l_A 3v6n_A 4hsd_A 3s18_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1ck7_A Protein (gelatinase A); hydrolase (metalloprotease), FULL-length, metalloproteinase; 2.80A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1gxd_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 329
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 4e-09
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 1e-07
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 1e-04
d1k3ia3 387 b.69.1.1 (A:151-537) Galactose oxidase, central do 6e-08
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 9e-08
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-04
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 54.5 bits (129), Expect = 4e-09
 Identities = 53/297 (17%), Positives = 88/297 (29%), Gaps = 31/297 (10%)

Query: 29  VGQKVYAFGGEFTPRVPVDNNLHVFDLETLTWSVADVTGDVPPPRVGVTMAAVGHTIYMF 88
           VG+ +Y  GG F   +   + L  ++    TW       D+  PR G+    VG  +Y  
Sbjct: 3   VGRLIYTAGGYFRQSL---SYLEAYNPSNGTWLRL---ADLQVPRSGLAGCVVGGLLYAV 56

Query: 89  GGRDGTHKELNELYSFDTRTNQWTLLSNGDAGPPHRSYHSTAADDRHVYIFGGCGVSGRL 148
           GGR+ +     +  + D         S        R+       D H+Y  GG       
Sbjct: 57  GGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHH 116

Query: 149 NDLWGFDVVDRKWIQYPSAGENCKGRGGPGLIVTQGKIWVVYGFAGVEVDDVHCFDPAHA 208
           N +  ++    +W           G G   L      +    G     ++   C+ P   
Sbjct: 117 NSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGT--NRLNSAECYYPERN 174

Query: 209 QWAQVETSGEKPTARSVFSTVGIGKHIVVYGGEVDPSDLGHLGAGKFAGELYSLDTETLV 268
           +W  +       T RS      +   I   GG      L                   + 
Sbjct: 175 EWRMITA---MNTIRSGAGVCVLHNCIYAAGGYDGQDQLNS-----------------VE 214

Query: 269 WTRWDDGPGSDHHPGPRGWCAFAGGLRGGKHGLLVYGGNSPSNDRLDDIYFFTPCLD 325
               +    +   P      A    +  G+  + V GG    +  LD +  + P  D
Sbjct: 215 RYDVETETWTFVAPMKHRRSALGITVHQGR--IYVLGGYD-GHTFLDSVECYDPDTD 268
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query329
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 100.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.95
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.75
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.44
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 97.15
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 96.81
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 96.76
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 96.74
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.69
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 96.68
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 96.62
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 96.59
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 96.59
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 96.52
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 96.47
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 96.37
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 96.21
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 96.19
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 96.18
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 96.17
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 96.15
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 96.05
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 95.96
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 95.91
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 95.54
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 95.33
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 95.24
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 94.98
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 94.84
d1tbga_340 beta1-subunit of the signal-transducing G protein 94.66
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 94.63
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 94.47
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 94.25
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 94.23
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 94.17
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 93.99
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 93.86
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 93.86
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 93.86
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 93.53
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 93.37
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 92.92
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 92.19
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 91.45
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 91.42
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 90.96
d1tbga_340 beta1-subunit of the signal-transducing G protein 90.87
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 90.82
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 90.07
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 89.92
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 89.64
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 89.31
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 89.14
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 88.57
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 87.92
d1hxna_210 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 87.38
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 86.61
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 85.43
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 85.21
d1flga_ 582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 84.36
d1hxna_210 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 83.27
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 82.79
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 81.26
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 80.51
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.3e-42  Score=291.57  Aligned_cols=266  Identities=23%  Similarity=0.379  Sum_probs=234.8

Q ss_pred             ECCEEEEEcCccCCCCccCCceEEEeCCCCcEEEEeeCCCCCCCCcceeEEEECCEEEEEccccC---CCCCCCceEEEE
Q 020245           29 VGQKVYAFGGEFTPRVPVDNNLHVFDLETLTWSVADVTGDVPPPRVGVTMAAVGHTIYMFGGRDG---THKELNELYSFD  105 (329)
Q Consensus        29 ~~~~l~~~GG~~~~~~~~~~~~~~~d~~~~~W~~~~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~---~~~~~~~~~~~d  105 (329)
                      +++.|||+||...   ...+++++||+.+++|++++.   +|.+|.+|++++++++|||+||...   .....+++++||
T Consensus         3 ~g~~iyv~GG~~~---~~~~~~~~yd~~t~~W~~~~~---~p~~R~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~yd   76 (288)
T d1zgka1           3 VGRLIYTAGGYFR---QSLSYLEAYNPSNGTWLRLAD---LQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYN   76 (288)
T ss_dssp             CCCCEEEECCBSS---SBCCCEEEEETTTTEEEECCC---CSSCCBSCEEEEETTEEEEECCEEEETTEEEECCCEEEEE
T ss_pred             cCCEEEEECCcCC---CCCceEEEEECCCCeEEECCC---CCCccceeEEEEECCEEEEEeCcccCCCCccccchhhhcc
Confidence            3678999999853   235899999999999999875   7889999999999999999999753   234578999999


Q ss_pred             CCCCcEEEcccCCCCCCCcccceeEeeCCeEEEEcccCCCcCcceeEEEEcCCCeEEEecCCCCCCCCCCCcEEEEECCE
Q 020245          106 TRTNQWTLLSNGDAGPPHRSYHSTAADDRHVYIFGGCGVSGRLNDLWGFDVVDRKWIQYPSAGENCKGRGGPGLIVTQGK  185 (329)
Q Consensus       106 ~~~~~W~~~~~~~~~p~~r~~~~~~~~~~~i~v~GG~~~~~~~~~~~~~~~~~~~W~~~~~~~~~~~~~~~~~~~~~~~~  185 (329)
                      +.+++|++++++   |.+|..|+++.+++++|++||......++.++.|++.+++|......   +..|..++++..+++
T Consensus        77 ~~~~~w~~~~~~---p~~r~~~~~~~~~~~i~~~gg~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~r~~~~~~~~~~~  150 (288)
T d1zgka1          77 PMTNQWSPCAPM---SVPRNRIGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPM---LTRRIGVGVAVLNRL  150 (288)
T ss_dssp             TTTTEEEECCCC---SSCCBTCEEEEETTEEEEECCEETTEECCCEEEEETTTTEEEECCCC---SSCCBSCEEEEETTE
T ss_pred             cccccccccccc---cceecceeccccceeeEEecceecccccceeeeeccccCcccccccc---ccccccceeeeeeec
Confidence            999999999987   78999999999999999999998888889999999999999998887   578999999999999


Q ss_pred             EEEEeeeCCC-CcccEEEEeCCCCceEEeeccCCCCCCcceeEEEEECCEEEEEcCccCCCCCCcCCCCeeeceeEEEEc
Q 020245          186 IWVVYGFAGV-EVDDVHCFDPAHAQWAQVETSGEKPTARSVFSTVGIGKHIVVYGGEVDPSDLGHLGAGKFAGELYSLDT  264 (329)
Q Consensus       186 l~v~gG~~~~-~~~~~~~~d~~~~~w~~~~~~~~~p~~r~~~~~~~~~~~i~i~GG~~~~~~~~~~~~~~~~~~~~~~d~  264 (329)
                      ++++||.... ....++.||+.+++|....   ..+..+..++++..++.|+++||....         ....++++||+
T Consensus       151 ~~~~GG~~~~~~~~~~~~~d~~~~~~~~~~---~~~~~~~~~~~~~~~~~i~i~GG~~~~---------~~~~~~~~~~~  218 (288)
T d1zgka1         151 LYAVGGFDGTNRLNSAECYYPERNEWRMIT---AMNTIRSGAGVCVLHNCIYAAGGYDGQ---------DQLNSVERYDV  218 (288)
T ss_dssp             EEEECCBCSSCBCCCEEEEETTTTEEEECC---CCSSCCBSCEEEEETTEEEEECCBCSS---------SBCCCEEEEET
T ss_pred             ceEecCcccccccceEEEeecccccccccc---ccccccccccccceeeeEEEecCcccc---------ccccceeeeee
Confidence            9999998765 6788999999999999887   556888889999999999999997543         33678999999


Q ss_pred             CCceeEeecCCCCCCCCCCCCCcceecccccCCcceEEEEcCCCCCCCcccceEEEecccCCccC
Q 020245          265 ETLVWTRWDDGPGSDHHPGPRGWCAFAGGLRGGKHGLLVYGGNSPSNDRLDDIYFFTPCLDGIED  329 (329)
Q Consensus       265 ~~~~W~~~~~~~~~~~~p~~r~~~~~~~~~~~~~~~i~i~GG~~~~~~~~~~v~~~~~~~~~~~~  329 (329)
                      .+++|+.++.      .|.+|..  +++++++++  |||+||.+.. ..++++|+||+++++|++
T Consensus       219 ~~~~~~~~~~------~p~~r~~--~~~~~~~~~--l~v~GG~~~~-~~~~~v~~yd~~~~~W~~  272 (288)
T d1zgka1         219 ETETWTFVAP------MKHRRSA--LGITVHQGR--IYVLGGYDGH-TFLDSVECYDPDTDTWSE  272 (288)
T ss_dssp             TTTEEEECCC------CSSCCBS--CEEEEETTE--EEEECCBCSS-CBCCEEEEEETTTTEEEE
T ss_pred             cceeeecccC------ccCcccc--eEEEEECCE--EEEEecCCCC-eecceEEEEECCCCEEEE
Confidence            9999999987      7899998  889999866  9999998754 788899999999999973
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hxna_ b.66.1.1 (A:) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hxna_ b.66.1.1 (A:) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure