Citrus Sinensis ID: 020270

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33
MEKEGEQLCEAARNGDIDKVKALIGSGADVSYFDSDGLTPLMHAAKLGHANLVKTLLEAGAPWNALSSSNLSAGDFAMDSGHQEVFEVLLNAGIQAELILGTIARAGNKNSNSNGDYLEDRVSFSEGKLVDSDSKAIMMAWEKPLMEAHAKAICSGGGHILNIGFGMGLVDTAIQQYSPVTHTILEAHPEVYERMLRTGWGEKNNVKIIFGRWQDNLSQLESYDGIFFDTYGEYYEDLREFHQHLPKLLKPGGIYSYFNGLCGGNAFFHVVYCHLVSLELENLGFSMQLIPLPVKNCLGEEVWEGVKHKYWQLDTYYLPVCQFLQDSE
cccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccccccccccEEEEEEEEEccccccccccHHHcccHHHHHHHHHHHHHHcccHHHHccccccccccccccccHHHHHHHHccHHHHHHHHHcccccccccEEEcccHHHHHcccccccEEEEccccccHHHHHHHHHHHHHHHcccccEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEEEccccccccccccccccccccccccccccEEEccccc
ccccHHHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccHHHHcHHHHHcccccccccHHHHHHHHHHcHHHEEEHHcccccccccccHHHHHHHHHHccccEEEEEccccccccHHHccccHHHHHHHHccHHHHHHHHHcccccccccEEcccHHHHHHHccccccEEEEccccccHHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHHHHccccEEEEEEcccccccHHHHccccEEEEEcccEEccEEEEccccc
MEKEGEQLCEAARNGDIDKVKALIgsgadvsyfdsdgltpLMHAAKLGHANLVKTLLEAgapwnalsssnlsagdfamdsGHQEVFEVLLNAGIQAELILGTIAragnknsnsngdyledrvsfsegklvdsdsKAIMMAWEKPLMEAHAKAICsggghilnigfGMGLVDTAIQQYSPVTHTILEAHPEVYERMLRtgwgeknnVKIIFGRWQdnlsqlesydgiffdTYGEYYEDLREFHQHLpkllkpggiysyfnglcggnAFFHVVYCHLVSLELenlgfsmqliplpvknclgeevWEGVKHKYWQLDTYYLPVCQFLQDSE
MEKEGEQLCEAARNGDIDKVKALIGSGADVSYFDSDGLTPLMHAAKLGHANLVKTLLEAGAPWNALSSSNLSAGDFAMDSGHQEVFEVLLNAGIQAELILGTIARAGNKNSNSNGDYLEDRVSFSEGKLVDSDSKAIMMAWEKPLMEAHAKAICSGGGHILNIGFGMGLVDTAIQQYSPVTHTILEAHPEVYERMLRTGWGEKNNVKIIFGRWQDNLSQLESYDGIFFDTYGEYYEDLREFHQHLPKLLKPGGIYSYFNGLCGGNAFFHVVYCHLVSLELENLGFSMQLIPLPVKNCLGEEVWEGVKHKYWQLDTYYLPVCQFLQDSE
MEKEGEQLCEAARNGDIDKVKALIGSGADVSYFDSDGLTPLMHAAKLGHANLVKTLLEAGAPWNALSSSNLSAGDFAMDSGHQEVFEVLLNAGIQAELILGTIARAGNKNSNSNGDYLEDRVSFSEGKLVDSDSKAIMMAWEKPLMEAHAKAICSGGGHILNIGFGMGLVDTAIQQYSPVTHTILEAHPEVYERMLRTGWGEKNNVKIIFGRWQDNLSQLESYDGIFFDTYGEYYEDLREFHQHLPKLLKPGGIYSYFNGLCGGNAFFHVVYCHLVSLELENLGFSMQLIPLPVKNCLGEEVWEGVKHKYWQLDTYYLPVCQFLQDSE
***************DIDKVKALIGSGADVSYFDSDGLTPLMHAAKLGHANLVKTLLEAGAPWNALSSSNLSAGDFAMDSGHQEVFEVLLNAGIQAELILGTIARA****************************KAIMMAWEKPLMEAHAKAICSGGGHILNIGFGMGLVDTAIQQYSPVTHTILEAHPEVYERMLRTGWGEKNNVKIIFGRWQDNLSQLESYDGIFFDTYGEYYEDLREFHQHLPKLLKPGGIYSYFNGLCGGNAFFHVVYCHLVSLELENLGFSMQLIPLPVKNCLGEEVWEGVKHKYWQLDTYYLPVCQFL****
MEKEGEQLCEAARNGDIDKVKALIGSGADVSYFDSDGLTPLMHAAKLGHANLVKTLLEAGAPWNALSSSNLSAGDFAMDSGHQEVFEVLLNAGIQAELILGTIARAGNKNSNSNGDYLEDRVSFSEGKLVDSDSKAIMMAWEKPLMEAHAKAICSGGGHILNIGFGMGLVDTAIQQYSPVTHTILEAHPEVYERMLRTGWGEKNNVKIIFGRWQDNLSQLESYDGIFFDTYGEYYEDLREFHQHLPKLLKPGGIYSYFNGLCGGNAFFHVVYCHLVSLELENLGFSMQLIPLPVKNCLGEEVWEGVKHKYWQLDTYYLPVCQFL****
MEKEGEQLCEAARNGDIDKVKALIGSGADVSYFDSDGLTPLMHAAKLGHANLVKTLLEAGAPWNALSSSNLSAGDFAMDSGHQEVFEVLLNAGIQAELILGTIARAGNKNSNSNGDYLEDRVSFSEGKLVDSDSKAIMMAWEKPLMEAHAKAICSGGGHILNIGFGMGLVDTAIQQYSPVTHTILEAHPEVYERMLRTGWGEKNNVKIIFGRWQDNLSQLESYDGIFFDTYGEYYEDLREFHQHLPKLLKPGGIYSYFNGLCGGNAFFHVVYCHLVSLELENLGFSMQLIPLPVKNCLGEEVWEGVKHKYWQLDTYYLPVCQFLQDSE
***EGEQLCEAARNGDIDKVKALIGSGADVSYFDSDGLTPLMHAAKLGHANLVKTLLEAGAPWNALSSSNLSAGDFAMDSGHQEVFEVLLNAGIQAELILGTIARAGNKNSNSNGDYLEDRVSFSEGKLVDSDSKAIMMAWEKPLMEAHAKAICSGGGHILNIGFGMGLVDTAIQQYSPVTHTILEAHPEVYERMLRTGWGEKNNVKIIFGRWQDNLSQLESYDGIFFDTYGEYYEDLREFHQHLPKLLKPGGIYSYFNGLCGGNAFFHVVYCHLVSLELENLGFSMQLIPLPVKNCLGEEVWEGVKHKYWQLDTYYLPVCQFLQ***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKEGEQLCEAARNGDIDKVKALIGSGADVSYFDSDGLTPLMHAAKLGHANLVKTLLEAGAPWNALSSSNLSAGDFAMDSGHQEVFEVLLNAGIQAELILGTIARAGNKNSNSNGDYLEDRVSFSEGKLVDSDSKAIMMAWEKPLMEAHAKAICSGGGHILNIGFGMGLVDTAIQQYSPVTHTILEAHPEVYERMLRTGWGEKNNVKIIFGRWQDNLSQLESYDGIFFDTYGEYYEDLREFHQHLPKLLKPGGIYSYFNGLCGGNAFFHVVYCHLVSLELENLGFSMQLIPLPVKNCLGEEVWEGVKHKYWQLDTYYLPVCQFLQDSE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query328 2.2.26 [Sep-21-2011]
Q10170357 Arginine N-methyltransfer yes no 0.972 0.893 0.312 2e-47
Q4X1R1424 Arginine N-methyltransfer yes no 0.832 0.643 0.332 3e-45
P0CQ68363 Arginine N-methyltransfer yes no 0.929 0.840 0.321 1e-43
P0CQ69363 Arginine N-methyltransfer N/A no 0.929 0.840 0.321 1e-43
Q6CBX2475 Arginine N-methyltransfer yes no 0.649 0.448 0.368 7e-43
Q5B058426 Arginine N-methyltransfer yes no 0.823 0.633 0.320 9e-43
Q2TZM9413 Arginine N-methyltransfer yes no 0.640 0.508 0.389 1e-41
Q759W1413 Arginine N-methyltransfer yes no 0.820 0.651 0.306 1e-39
Q6BNS9434 Arginine N-methyltransfer yes no 0.652 0.493 0.372 2e-38
Q03305412 Arginine N-methyltransfer yes no 0.826 0.657 0.299 4e-38
>sp|Q10170|RMT2_SCHPO Arginine N-methyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rmt2 PE=3 SV=2 Back     alignment and function desciption
 Score =  190 bits (482), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 107/342 (31%), Positives = 186/342 (54%), Gaps = 23/342 (6%)

Query: 3   KEGEQLCEAARNGDIDKVKALIGSGADVSYFDSDGLTPLMH--------AAKLGHANLVK 54
           +E   L EA++  D+ K++ L+  GA  S  D +     +H          ++    + K
Sbjct: 16  QESLSLLEASKQLDLKKIQNLVDQGAVTSAIDIESGKNALHFIASYAEKETEVQAIEVTK 75

Query: 55  TLLEAGAPWNALSSSNLSAGDFAMDSGHQEVFEVLLNAGIQAELILGTIARAGNKNS--N 112
            +L  G  WN +  +N + G  A       ++E +++AG+++EL+L  + R    N   +
Sbjct: 76  WILSNGGVWNGIDRANETPGCIARRRNLLRLYETIVDAGVRSELLLSLLERKELTNEQLD 135

Query: 113 SNGDYLEDRVSFSE-----GKLVDSDSKAIMMAWEKPLMEAHAKAIC-SGGGHILNIGFG 166
           +N  YL+  +S+++       L+DSD+ A+MM+WE+ +M   A+ I  + G  +LN+GFG
Sbjct: 136 TNEKYLQSALSYTQPTEDSSSLLDSDANAVMMSWERKIMHRSAEIIAPTKGRRVLNVGFG 195

Query: 167 MGLVDTAIQQYSPVTHTILEAHPEVYERMLRTGWGEKNNVKIIFGRWQDNLSQLES---Y 223
           +G++DT +Q+  P  H I+E HP+V + M + GW ++ NV +    W++ ++ + S   +
Sbjct: 196 LGIIDTFLQEKEPSLHVIIEPHPDVLKHMRKNGWMDRENVIVYETTWENAINDIASKYVF 255

Query: 224 DGIFFDTYGEYYEDLREFHQHLPKLLKP--GGIYSYFNGLCGGNAFFHVVYCHLVSLELE 281
           DGI++D + E YEDLR F   +  LL P     +S+FNGL   N  F+ VY  LV ++L 
Sbjct: 256 DGIYYDAFAESYEDLRNFFDSVVGLLDPETDSKFSFFNGLGADNQTFYDVYKKLVPIDLV 315

Query: 282 NLGFSMQLIPLPVKNCLGEEVWEGVKHKYWQLDTYYLPVCQF 323
           + G       +PV +   +E W+G K +YW +  Y+LP+  F
Sbjct: 316 SFGLQCTYESMPVSS--KDEEWKGAKRRYWDVSKYFLPIVTF 355
Delta-N-monomethylarginine transferase. May monomethylate ribosomal protein L12.
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q4X1R1|RMT2_ASPFU Arginine N-methyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rmt2 PE=3 SV=1 Back     alignment and function description
>sp|P0CQ68|RMT2_CRYNJ Arginine N-methyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RMT2 PE=3 SV=1 Back     alignment and function description
>sp|P0CQ69|RMT2_CRYNB Arginine N-methyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RMT2 PE=3 SV=1 Back     alignment and function description
>sp|Q6CBX2|RMT2_YARLI Arginine N-methyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RMT2 PE=3 SV=1 Back     alignment and function description
>sp|Q5B058|RMT2_EMENI Arginine N-methyltransferase 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rmt2 PE=3 SV=1 Back     alignment and function description
>sp|Q2TZM9|RMT2_ASPOR Arginine N-methyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rmt2 PE=3 SV=1 Back     alignment and function description
>sp|Q759W1|RMT2_ASHGO Arginine N-methyltransferase 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RMT2 PE=3 SV=1 Back     alignment and function description
>sp|Q6BNS9|RMT2_DEBHA Arginine N-methyltransferase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RMT2 PE=3 SV=1 Back     alignment and function description
>sp|Q03305|RMT2_YEAST Arginine N-methyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RMT2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query328
225458790327 PREDICTED: arginine N-methyltransferase 0.993 0.996 0.852 1e-166
255538110328 hspc200, putative [Ricinus communis] gi| 1.0 1.0 0.820 1e-163
224136926326 predicted protein [Populus trichocarpa] 0.987 0.993 0.820 1e-159
358345484326 Arginine N-methyltransferase [Medicago t 0.984 0.990 0.820 1e-159
449450263327 PREDICTED: arginine N-methyltransferase 0.990 0.993 0.8 1e-157
289540911326 unknown [Trifolium repens] 0.984 0.990 0.798 1e-156
359491981313 PREDICTED: arginine N-methyltransferase 0.951 0.996 0.815 1e-156
356514465328 PREDICTED: arginine N-methyltransferase 1.0 1.0 0.783 1e-155
356510535328 PREDICTED: arginine N-methyltransferase 1.0 1.0 0.780 1e-154
79332518326 ankyrin repeat family protein [Arabidops 0.978 0.984 0.767 1e-150
>gi|225458790|ref|XP_002285179.1| PREDICTED: arginine N-methyltransferase 2 isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  590 bits (1521), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 278/326 (85%), Positives = 300/326 (92%)

Query: 3   KEGEQLCEAARNGDIDKVKALIGSGADVSYFDSDGLTPLMHAAKLGHANLVKTLLEAGAP 62
           +EGE +CEAAR GD  K++ALI SGADVS+FD +GL+PLMHAA+LGHA+ VK LLEAGAP
Sbjct: 2   EEGEMVCEAARKGDTAKLRALIDSGADVSFFDREGLSPLMHAARLGHADAVKILLEAGAP 61

Query: 63  WNALSSSNLSAGDFAMDSGHQEVFEVLLNAGIQAELILGTIARAGNKNSNSNGDYLEDRV 122
           WNALS SNLSAGDFAMDSGHQE FEVLLNAGIQAELILGTI R  NKN +S+ DYL DR+
Sbjct: 62  WNALSPSNLSAGDFAMDSGHQEAFEVLLNAGIQAELILGTITRKANKNGDSDEDYLGDRI 121

Query: 123 SFSEGKLVDSDSKAIMMAWEKPLMEAHAKAICSGGGHILNIGFGMGLVDTAIQQYSPVTH 182
           +FSE KL+DS+SKAIMMAWEKPLMEAHAKA+CSGGGHILNIGFGMGLVDTAIQQY P TH
Sbjct: 122 TFSEDKLMDSNSKAIMMAWEKPLMEAHAKAVCSGGGHILNIGFGMGLVDTAIQQYKPATH 181

Query: 183 TILEAHPEVYERMLRTGWGEKNNVKIIFGRWQDNLSQLESYDGIFFDTYGEYYEDLREFH 242
           TI+EAHPEVY RML TGWGEK+NVKIIFGRWQD L QLESYDGIFFDTYGEYYEDLREFH
Sbjct: 182 TIIEAHPEVYNRMLHTGWGEKDNVKIIFGRWQDVLPQLESYDGIFFDTYGEYYEDLREFH 241

Query: 243 QHLPKLLKPGGIYSYFNGLCGGNAFFHVVYCHLVSLELENLGFSMQLIPLPVKNCLGEEV 302
           QHLP LLKPGGIYS+FNGLCGGNAFFHVVYCHLVSLELENLG+S QLIPLPVK+CLGEEV
Sbjct: 242 QHLPTLLKPGGIYSFFNGLCGGNAFFHVVYCHLVSLELENLGYSTQLIPLPVKDCLGEEV 301

Query: 303 WEGVKHKYWQLDTYYLPVCQFLQDSE 328
           WEGVKHKYW+LDTYYLPVCQ LQDSE
Sbjct: 302 WEGVKHKYWKLDTYYLPVCQSLQDSE 327

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255538110|ref|XP_002510120.1| hspc200, putative [Ricinus communis] gi|223550821|gb|EEF52307.1| hspc200, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224136926|ref|XP_002326979.1| predicted protein [Populus trichocarpa] gi|222835294|gb|EEE73729.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|358345484|ref|XP_003636807.1| Arginine N-methyltransferase [Medicago truncatula] gi|358348847|ref|XP_003638453.1| Arginine N-methyltransferase [Medicago truncatula] gi|355502742|gb|AES83945.1| Arginine N-methyltransferase [Medicago truncatula] gi|355504388|gb|AES85591.1| Arginine N-methyltransferase [Medicago truncatula] Back     alignment and taxonomy information
>gi|449450263|ref|XP_004142883.1| PREDICTED: arginine N-methyltransferase 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|289540911|gb|ADD09585.1| unknown [Trifolium repens] Back     alignment and taxonomy information
>gi|359491981|ref|XP_003634349.1| PREDICTED: arginine N-methyltransferase 2 isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356514465|ref|XP_003525926.1| PREDICTED: arginine N-methyltransferase 2 [Glycine max] Back     alignment and taxonomy information
>gi|356510535|ref|XP_003523993.1| PREDICTED: arginine N-methyltransferase 2-like [Glycine max] Back     alignment and taxonomy information
>gi|79332518|ref|NP_001032154.1| ankyrin repeat family protein [Arabidopsis thaliana] gi|2827702|emb|CAA16675.1| predicted protein [Arabidopsis thaliana] gi|9759570|dbj|BAB11133.1| unnamed protein product [Arabidopsis thaliana] gi|44917551|gb|AAS49100.1| At5g65860 [Arabidopsis thaliana] gi|51971941|dbj|BAD44635.1| putative protein [Arabidopsis thaliana] gi|332010733|gb|AED98116.1| ankyrin repeat family protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query328
TAIR|locus:2152074346 AT5G65860 [Arabidopsis thalian 0.978 0.927 0.767 1.1e-140
POMBASE|SPAC26A3.17c357 SPAC26A3.17c "N-methyltransfer 0.972 0.893 0.318 1.4e-48
ASPGD|ASPL0000004287426 AN6072 [Emericella nidulans (t 0.646 0.497 0.381 1.8e-46
SGD|S000002873412 RMT2 "Arginine N5 methyltransf 0.920 0.733 0.292 1.7e-34
UNIPROTKB|G4MQP0434 MGG_09290 "Arginine N-methyltr 0.682 0.516 0.321 1.3e-25
UNIPROTKB|Q14353236 GAMT "Guanidinoacetate N-methy 0.368 0.512 0.375 1.4e-15
RGD|2659236 Gamt "guanidinoacetate N-methy 0.368 0.512 0.360 1.8e-15
UNIPROTKB|Q2TBQ3236 GAMT "Guanidinoacetate N-methy 0.375 0.521 0.350 4e-15
UNIPROTKB|I3LIA4236 GAMT "Uncharacterized protein" 0.375 0.521 0.335 5.2e-15
ZFIN|ZDB-GENE-051030-97234 gamt "guanidinoacetate N-methy 0.378 0.529 0.323 1.1e-14
TAIR|locus:2152074 AT5G65860 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1376 (489.4 bits), Expect = 1.1e-140, P = 1.1e-140
 Identities = 248/323 (76%), Positives = 289/323 (89%)

Query:     3 KEGEQLCEAARNGDIDKVKALIGSGADVSYFDSDGLTPLMHAAKLGHANLVKTLLEAGAP 62
             +E +QLC AA++GD+ KV+ LI SGADV++FD+DGLTPLMHAAK+G+A +V  LLE+GAP
Sbjct:    22 EEADQLCLAAKSGDLKKVQTLIYSGADVTHFDNDGLTPLMHAAKIGNAEIVTALLESGAP 81

Query:    63 WNALSSSNLSAGDFAMDSGHQEVFEVLLNAGIQAELILGTIARAGNKNSNSNGDYLEDRV 122
             WNALS SNLSAGDFAM++GHQE F++LL  GIQ+ELILGTIAR   KN  SN +YL+DRV
Sbjct:    82 WNALSPSNLSAGDFAMEAGHQETFDLLLKTGIQSELILGTIARNQTKNEYSNQEYLQDRV 141

Query:   123 SFSEGKLVDSDSKAIMMAWEKPLMEAHAKAICSGGGHILNIGFGMGLVDTAIQQYSPVTH 182
             SFSE KL+DS+SK +MMAWEKPLMEAHAKAIC  GGHILN+GFGMGLVDTAIQ+Y+PV H
Sbjct:   142 SFSEDKLMDSESKGVMMAWEKPLMEAHAKAICLNGGHILNVGFGMGLVDTAIQRYNPVKH 201

Query:   183 TILEAHPEVYERMLRTGWGEKNNVKIIFGRWQDNLSQLE--SYDGIFFDTYGEYYEDLRE 240
             TI+EAHPEVY+RM+ +GWGEK NVKI+FGRWQD L +L+  S+DGIFFDTYGEYYEDLRE
Sbjct:   202 TIIEAHPEVYKRMIESGWGEKENVKIVFGRWQDVLDKLDDNSFDGIFFDTYGEYYEDLRE 261

Query:   241 FHQHLPKLLKPGGIYSYFNGLCGGNAFFHVVYCHLVSLELENLGFSMQLIPLPVKNCLGE 300
             FHQHLP+LLKP G+YSYFNG CG NAFFHVVYC+LV+LE+ENLGFS QLIPLPVK+CLG+
Sbjct:   262 FHQHLPRLLKPDGVYSYFNGFCGSNAFFHVVYCNLVTLEIENLGFSTQLIPLPVKDCLGD 321

Query:   301 EVWEGVKHKYWQLDTYYLPVCQF 323
             EVWEGVK KYWQLDTYYLPVCQF
Sbjct:   322 EVWEGVKQKYWQLDTYYLPVCQF 344
GO:0005737 "cytoplasm" evidence=ISM
GO:0008152 "metabolic process" evidence=IEA
GO:0008168 "methyltransferase activity" evidence=IEA
GO:0009165 "nucleotide biosynthetic process" evidence=RCA
POMBASE|SPAC26A3.17c SPAC26A3.17c "N-methyltransferase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ASPGD|ASPL0000004287 AN6072 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
SGD|S000002873 RMT2 "Arginine N5 methyltransferase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|G4MQP0 MGG_09290 "Arginine N-methyltransferase 2" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|Q14353 GAMT "Guanidinoacetate N-methyltransferase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|2659 Gamt "guanidinoacetate N-methyltransferase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q2TBQ3 GAMT "Guanidinoacetate N-methyltransferase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3LIA4 GAMT "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-051030-97 gamt "guanidinoacetate N-methyltransferase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P0CQ68RMT2_CRYNJ2, ., 1, ., 1, ., -0.32110.92980.8402yesno
Q10170RMT2_SCHPO2, ., 1, ., 1, ., -0.31280.97250.8935yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.10.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00014935001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (327 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00032354001
SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (252 aa)
   •  • 0.642
GSVIVG00028481001
SubName- Full=Chromosome chr7 scaffold_44, whole genome shotgun sequence; (316 aa)
   •    0.550
GSVIVG00021672001
SubName- Full=Chromosome chr8 scaffold_23, whole genome shotgun sequence; (315 aa)
   •    0.548
GSVIVG00038895001
SubName- Full=Chromosome chr8 scaffold_99, whole genome shotgun sequence; (280 aa)
   •  • 0.538
GSVIVG00019376001
SubName- Full=Chromosome chr7 scaffold_20, whole genome shotgun sequence; (1041 aa)
   •    0.529
GSVIVG00038090001
SubName- Full=Chromosome chr14 scaffold_9, whole genome shotgun sequence; (182 aa)
   •    0.526
GSVIVG00033408001
SubName- Full=Chromosome chr19 scaffold_66, whole genome shotgun sequence; (430 aa)
   •  • 0.526
GSVIVG00021307001
SubName- Full=Chromosome chr8 scaffold_23, whole genome shotgun sequence; (586 aa)
   •    0.521
GSVIVG00034559001
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (840 aa)
   •    0.504
GSVIVG00026600001
SubName- Full=Chromosome chr12 scaffold_38, whole genome shotgun sequence; (229 aa)
   •    0.500

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query328
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-18
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-16
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 6e-14
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-10
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-09
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 4e-09
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 6e-09
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-08
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 5e-08
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 5e-07
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-06
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 2e-06
pfam12847104 pfam12847, Methyltransf_18, Methyltransferase doma 1e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-05
cd02440107 cd02440, AdoMet_MTases, S-adenosylmethionine-depen 4e-05
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-04
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 3e-04
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 3e-04
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 5e-04
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 8e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 0.001
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 0.001
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 0.002
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 0.002
smart0024830 smart00248, ANK, ankyrin repeats 0.002
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 0.003
PHA02795437 PHA02795, PHA02795, ankyrin-like protein; Provisio 0.003
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information 
 Score = 79.7 bits (197), Expect = 2e-18
 Identities = 38/86 (44%), Positives = 51/86 (59%)

Query: 8  LCEAARNGDIDKVKALIGSGADVSYFDSDGLTPLMHAAKLGHANLVKTLLEAGAPWNALS 67
          L  AA NG ++ VK L+ +GADV+  D+DG TPL  AAK GH  +VK LLE GA  NA  
Sbjct: 11 LHLAASNGHLEVVKLLLENGADVNAKDNDGRTPLHLAAKNGHLEIVKLLLEKGADVNARD 70

Query: 68 SSNLSAGDFAMDSGHQEVFEVLLNAG 93
              +    A  +G+ +V ++LL  G
Sbjct: 71 KDGNTPLHLAARNGNLDVVKLLLKHG 96

The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|221804 pfam12847, Methyltransf_18, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165157 PHA02795, PHA02795, ankyrin-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 328
KOG1709271 consensus Guanidinoacetate methyltransferase and r 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.97
PHA02791284 ankyrin-like protein; Provisional 99.96
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.96
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.94
PHA02791284 ankyrin-like protein; Provisional 99.94
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.94
PHA02875413 ankyrin repeat protein; Provisional 99.93
PHA03100480 ankyrin repeat protein; Provisional 99.93
PHA02875413 ankyrin repeat protein; Provisional 99.93
PHA02878477 ankyrin repeat protein; Provisional 99.93
PHA02946446 ankyin-like protein; Provisional 99.92
PHA02874434 ankyrin repeat protein; Provisional 99.92
PHA02798489 ankyrin-like protein; Provisional 99.92
PHA03100480 ankyrin repeat protein; Provisional 99.91
PHA02874434 ankyrin repeat protein; Provisional 99.91
PHA03095471 ankyrin-like protein; Provisional 99.91
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.9
PHA02989494 ankyrin repeat protein; Provisional 99.9
PHA02716764 CPXV016; CPX019; EVM010; Provisional 99.9
PHA02946446 ankyin-like protein; Provisional 99.9
PHA02859209 ankyrin repeat protein; Provisional 99.89
PHA03095471 ankyrin-like protein; Provisional 99.89
KOG0508 615 consensus Ankyrin repeat protein [General function 99.89
KOG0510 929 consensus Ankyrin repeat protein [General function 99.88
PHA02876682 ankyrin repeat protein; Provisional 99.88
PHA02876 682 ankyrin repeat protein; Provisional 99.88
PHA02878477 ankyrin repeat protein; Provisional 99.88
PHA02859209 ankyrin repeat protein; Provisional 99.87
PHA02917 661 ankyrin-like protein; Provisional 99.87
PHA02989494 ankyrin repeat protein; Provisional 99.87
KOG0510 929 consensus Ankyrin repeat protein [General function 99.87
PLN03192823 Voltage-dependent potassium channel; Provisional 99.87
PHA02798489 ankyrin-like protein; Provisional 99.86
KOG0508 615 consensus Ankyrin repeat protein [General function 99.86
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.85
PHA02795437 ankyrin-like protein; Provisional 99.84
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.84
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.84
PHA02741169 hypothetical protein; Provisional 99.83
PHA02730 672 ankyrin-like protein; Provisional 99.82
PHA02743166 Viral ankyrin protein; Provisional 99.82
PHA02795437 ankyrin-like protein; Provisional 99.81
PHA02884300 ankyrin repeat protein; Provisional 99.81
KOG0514452 consensus Ankyrin repeat protein [General function 99.8
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.8
PHA02743166 Viral ankyrin protein; Provisional 99.8
PHA02917 661 ankyrin-like protein; Provisional 99.78
PHA02736154 Viral ankyrin protein; Provisional 99.78
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.77
PLN03192823 Voltage-dependent potassium channel; Provisional 99.76
PHA02730 672 ankyrin-like protein; Provisional 99.76
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.76
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.75
PHA02736154 Viral ankyrin protein; Provisional 99.75
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.75
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.74
PHA02741169 hypothetical protein; Provisional 99.74
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.73
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.71
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.71
PHA02792631 ankyrin-like protein; Provisional 99.69
PHA02884300 ankyrin repeat protein; Provisional 99.69
KOG0514452 consensus Ankyrin repeat protein [General function 99.68
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.68
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.67
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.66
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.66
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.65
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.62
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.61
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.6
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.6
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.59
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.59
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.57
PHA02792631 ankyrin-like protein; Provisional 99.56
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.56
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.55
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.54
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.51
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.47
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.46
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.42
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.41
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.4
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.3
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.24
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.23
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 99.22
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 99.18
PF1360630 Ank_3: Ankyrin repeat 99.08
KOG0705749 consensus GTPase-activating protein Centaurin gamm 99.07
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 99.0
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.95
PF05430124 Methyltransf_30: S-adenosyl-L-methionine-dependent 98.89
PF1360630 Ank_3: Ankyrin repeat 98.89
COG2521287 Predicted archaeal methyltransferase [General func 98.89
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.87
KOG0522 560 consensus Ankyrin repeat protein [General function 98.86
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.83
PRK01747 662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 98.76
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.75
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.73
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.66
KOG2384223 consensus Major histocompatibility complex protein 98.61
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 98.52
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 98.52
KOG0511 516 consensus Ankyrin repeat protein [General function 98.48
PLN02233261 ubiquinone biosynthesis methyltransferase 98.38
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.37
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 98.36
KOG0511 516 consensus Ankyrin repeat protein [General function 98.36
TIGR00452314 methyltransferase, putative. Known examples to dat 98.35
PLN02490340 MPBQ/MSBQ methyltransferase 98.33
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 98.33
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 98.3
PLN02244340 tocopherol O-methyltransferase 98.3
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 98.29
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.28
PRK01581374 speE spermidine synthase; Validated 98.28
KOG0522 560 consensus Ankyrin repeat protein [General function 98.26
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.23
PLN02336475 phosphoethanolamine N-methyltransferase 98.22
COG4121252 Uncharacterized conserved protein [Function unknow 98.17
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.17
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 98.17
KOG0520975 consensus Uncharacterized conserved protein, conta 98.17
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 98.12
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 98.08
COG4122219 Predicted O-methyltransferase [General function pr 98.08
PRK04266226 fibrillarin; Provisional 98.08
PRK03612521 spermidine synthase; Provisional 98.07
PRK00811283 spermidine synthase; Provisional 98.04
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.0
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 97.97
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 97.97
PRK08317241 hypothetical protein; Provisional 97.96
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 97.96
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 97.96
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 97.95
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 97.95
PRK04457262 spermidine synthase; Provisional 97.95
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 97.93
PRK10258251 biotin biosynthesis protein BioC; Provisional 97.92
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 97.91
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 97.9
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 97.88
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 97.86
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 97.86
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 97.83
PLN02589247 caffeoyl-CoA O-methyltransferase 97.82
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 97.8
PLN02476278 O-methyltransferase 97.78
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 97.78
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 97.77
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 97.77
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 97.75
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 97.73
TIGR00740239 methyltransferase, putative. A simple BLAST search 97.72
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 97.71
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 97.69
KOG2505591 consensus Ankyrin repeat protein [General function 97.68
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 97.68
KOG2384223 consensus Major histocompatibility complex protein 97.68
PRK14967223 putative methyltransferase; Provisional 97.67
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 97.66
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 97.63
PLN03075296 nicotianamine synthase; Provisional 97.63
PLN02366308 spermidine synthase 97.61
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 97.59
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 97.58
COG0421282 SpeE Spermidine synthase [Amino acid transport and 97.57
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 97.57
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 97.56
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 97.53
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 97.53
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 97.52
PRK06922677 hypothetical protein; Provisional 97.51
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 97.51
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 97.48
PLN02336 475 phosphoethanolamine N-methyltransferase 97.47
KOG4300252 consensus Predicted methyltransferase [General fun 97.47
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 97.47
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 97.45
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 97.44
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 97.44
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.44
PRK14968188 putative methyltransferase; Provisional 97.43
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 97.41
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 97.41
PRK12335287 tellurite resistance protein TehB; Provisional 97.41
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 97.39
KOG0520975 consensus Uncharacterized conserved protein, conta 97.36
PRK05785226 hypothetical protein; Provisional 97.36
PTZ00146293 fibrillarin; Provisional 97.36
PLN02823336 spermine synthase 97.32
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 97.32
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 97.32
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 97.31
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 97.31
PRK11207197 tellurite resistance protein TehB; Provisional 97.3
KOG1270282 consensus Methyltransferases [Coenzyme transport a 97.29
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 97.26
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 97.25
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 97.25
PHA03411279 putative methyltransferase; Provisional 97.23
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 97.21
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 97.18
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.17
KOG1663237 consensus O-methyltransferase [Secondary metabolit 97.15
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 97.06
COG4976287 Predicted methyltransferase (contains TPR repeat) 97.03
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 96.88
PRK00536262 speE spermidine synthase; Provisional 96.86
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 96.86
PRK07402196 precorrin-6B methylase; Provisional 96.83
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 96.82
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 96.81
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 96.79
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 96.77
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 96.76
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 96.76
COG4123248 Predicted O-methyltransferase [General function pr 96.73
PRK10901427 16S rRNA methyltransferase B; Provisional 96.71
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 96.7
COG4106257 Tam Trans-aconitate methyltransferase [General fun 96.67
KOG2505591 consensus Ankyrin repeat protein [General function 96.67
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 96.66
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 96.64
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 96.6
PLN02232160 ubiquinone biosynthesis methyltransferase 96.56
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 96.56
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 96.54
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 96.54
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 96.53
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 96.51
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 96.48
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 96.48
PRK06202232 hypothetical protein; Provisional 96.45
TIGR03438301 probable methyltransferase. This model represents 96.42
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 96.38
KOG3010261 consensus Methyltransferase [General function pred 96.35
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 96.34
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 96.32
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 96.23
COG4262508 Predicted spermidine synthase with an N-terminal m 96.23
PRK14902444 16S rRNA methyltransferase B; Provisional 96.22
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 96.2
PLN02585315 magnesium protoporphyrin IX methyltransferase 96.18
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 96.13
COG2890280 HemK Methylase of polypeptide chain release factor 96.0
PRK14901434 16S rRNA methyltransferase B; Provisional 95.99
PRK14903431 16S rRNA methyltransferase B; Provisional 95.95
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 95.92
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 95.87
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 95.77
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 95.76
TIGR00536284 hemK_fam HemK family putative methylases. The gene 95.51
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 95.5
TIGR00438188 rrmJ cell division protein FtsJ. 95.48
PRK14904445 16S rRNA methyltransferase B; Provisional 95.45
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 95.3
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 95.16
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 95.16
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 94.91
PRK13255218 thiopurine S-methyltransferase; Reviewed 94.89
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 94.73
PF05185448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 94.65
smart00650169 rADc Ribosomal RNA adenine dimethylases. 94.6
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 94.55
COG2520341 Predicted methyltransferase [General function pred 94.53
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 94.52
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 94.49
COG1092393 Predicted SAM-dependent methyltransferases [Genera 94.31
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 94.3
KOG2361264 consensus Predicted methyltransferase [General fun 93.83
KOG3045325 consensus Predicted RNA methylase involved in rRNA 93.61
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 93.4
PF07942270 N2227: N2227-like protein; InterPro: IPR012901 Thi 93.26
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 93.23
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 93.21
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 92.76
KOG1661237 consensus Protein-L-isoaspartate(D-aspartate) O-me 92.67
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 92.06
TIGR00308 374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 92.02
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 91.29
PHA03412241 putative methyltransferase; Provisional 91.18
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 91.17
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 91.14
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 90.79
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 90.69
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 90.6
PLN02672 1082 methionine S-methyltransferase 90.55
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 90.22
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 90.19
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 90.17
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 89.66
COG2263198 Predicted RNA methylase [Translation, ribosomal st 89.63
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 89.32
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 88.83
PRK13256226 thiopurine S-methyltransferase; Reviewed 88.49
KOG1500 517 consensus Protein arginine N-methyltransferase CAR 88.06
PRK04338 382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 87.99
COG0742187 N6-adenine-specific methylase [DNA replication, re 87.88
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 87.87
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 86.76
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 86.57
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 86.25
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 85.78
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 85.71
PRK13699227 putative methylase; Provisional 85.52
KOG1269364 consensus SAM-dependent methyltransferases [Lipid 85.35
KOG2798369 consensus Putative trehalase [Carbohydrate transpo 85.05
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 84.85
KOG2198375 consensus tRNA cytosine-5-methylases and related e 82.73
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 82.04
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 81.97
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 81.69
KOG2915314 consensus tRNA(1-methyladenosine) methyltransferas 81.63
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 81.02
>KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=1.4e-60  Score=381.32  Aligned_cols=268  Identities=48%  Similarity=0.893  Sum_probs=254.8

Q ss_pred             HHHcCCCCCccCCCCCCHHHHHHHcCCHHHHHHHHHcCCChhhhhhHHHhhccCCCCCcchhhhhcccccCCccccccch
Q 020270           56 LLEAGAPWNALSSSNLSAGDFAMDSGHQEVFEVLLNAGIQAELILGTIARAGNKNSNSNGDYLEDRVSFSEGKLVDSDSK  135 (328)
Q Consensus        56 Ll~~ga~~n~~d~~g~tpL~~A~~~g~~~~v~~Ll~~g~~~~~~~~~l~~a~~~~~~~~~~~L~~~~~~~~~~l~~~~~~  135 (328)
                      |++.||.||..|..+.||..+|...|+.+.++.|++.|+..+.....+..-+..+......++...+++..+.+++.+++
T Consensus         1 lle~ga~wn~id~~n~t~gd~a~ern~~rly~~lv~~gv~Selll~~l~rn~s~n~~~~a~~~qd~ls~~~D~ll~~~~k   80 (271)
T KOG1709|consen    1 LLEYGAGWNFIDYENKTVGDLALERNQSRLYRRLVEAGVPSELLLFALGRNESPNADGNAPYLQDYLSTAEDTLLDSLGK   80 (271)
T ss_pred             CcccCCCccccChhhCCchHHHHHccHHHHHHHHHHcCCchhhhhhccccccCccccccchHHHHHHhhhhhHHHhhccc
Confidence            57899999999999999999999999999999999999999987776666566666677888888888887889999999


Q ss_pred             hhhhhccchHHHHHHHHhhcCCCceeeecccCCcchhHHhccCCceEEeeccCHHHHHHHHHcCCCCCCCeeEEecccch
Q 020270          136 AIMMAWEKPLMEAHAKAICSGGGHILNIGFGMGLVDTAIQQYSPVTHTILEAHPEVYERMLRTGWGEKNNVKIIFGRWQD  215 (328)
Q Consensus       136 ~~~~~~~tpL~~a~~~~~~~~~~~iLe~g~~~g~~~~~~~~~~~~~~~a~e~~~~~~~~L~~~g~~~~~~~~~~~g~w~~  215 (328)
                      ++||.||||+|.|++++++..+.+||++|||+|+.++.++...|..|.++|+||++++.|+..||..+.++.+..|+|++
T Consensus        81 ~VMm~WEtpiMha~A~ai~tkggrvLnVGFGMgIidT~iQe~~p~~H~IiE~hp~V~krmr~~gw~ek~nViil~g~WeD  160 (271)
T KOG1709|consen   81 GVMMRWETPIMHALAEAISTKGGRVLNVGFGMGIIDTFIQEAPPDEHWIIEAHPDVLKRMRDWGWREKENVIILEGRWED  160 (271)
T ss_pred             hhhhhhhhHHHHHHHHHHhhCCceEEEeccchHHHHHHHhhcCCcceEEEecCHHHHHHHHhcccccccceEEEecchHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hccCC--CCCCEEEEecCccchhhHHHHHHHHhhccCCCcEEEEeccccCCcchhHHhhhHHHHHHHHhcCCeEEEEEee
Q 020270          216 NLSQL--ESYDGIFFDTYGEYYEDLREFHQHLPKLLKPGGIYSYFNGLCGGNAFFHVVYCHLVSLELENLGFSMQLIPLP  293 (328)
Q Consensus       216 ~~~~~--~~fD~i~~d~f~e~~~~l~~~~~~~~~lL~~gG~~~~~~~~g~~~~~~~~~y~~~~~~~l~~~G~~~~~~~~~  293 (328)
                      .++.+  ..||+||||||+|+|+++++|+++++++|||+|+||||||+|+++..||+||+.++.+.+...|+.++++..+
T Consensus       161 vl~~L~d~~FDGI~yDTy~e~yEdl~~~hqh~~rLLkP~gv~SyfNg~~~~~~~~~~vy~~lV~iev~~~g~~~~l~~~~  240 (271)
T KOG1709|consen  161 VLNTLPDKHFDGIYYDTYSELYEDLRHFHQHVVRLLKPEGVFSYFNGLGADNLMFYDVYKILVMIEVATYGVPCTLEPGP  240 (271)
T ss_pred             hhccccccCcceeEeechhhHHHHHHHHHHHHhhhcCCCceEEEecCcccchhhhhhhhheeEEEEeecCCCceeeeccc
Confidence            99887  5799999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCccccccccccccccCcccccceee
Q 020270          294 VKNCLGEEVWEGVKHKYWQLDTYYLPVCQF  323 (328)
Q Consensus       294 ~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~  323 (328)
                      +.++.++++|+|++||||+++.|++|+|+|
T Consensus       241 v~~~l~de~w~~vk~~Y~~~~~yy~P~vtf  270 (271)
T KOG1709|consen  241 VDEQLGDELWNGVKRRYWNLPQYYLPRVTF  270 (271)
T ss_pred             cccccchhhhcchhhhhhcCCceecceeec
Confidence            988889999999999999999999999997

>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PF05430 Methyltransf_30: S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR008471 This entry contains several uncharacterised bacterial proteins with no known function Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>COG4121 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>KOG2798 consensus Putative trehalase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>KOG2198 consensus tRNA cytosine-5-methylases and related enzymes of the NOL1/NOP2/sun superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query328
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 4e-16
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 6e-16
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 5e-15
3orh_A236 Human Guanidinoacetate N-Methyltransferase With Sah 9e-15
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 1e-14
2xeh_A157 Structural Determinants For Improved Thermal Stabil 5e-14
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 5e-14
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 6e-14
2xee_A157 Structural Determinants For Improved Thermal Stabil 6e-14
1xcj_A235 Guanidinoacetate Methyltransferase Containing S- Ad 2e-13
2xen_A91 Structural Determinants For Improved Thermal Stabil 2e-13
1khh_A198 Crystal Structure Of Guanidinoacetate Methyltransfe 3e-13
1p1b_A199 Guanidinoacetate Methyltransferase Length = 199 3e-13
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 4e-13
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 1e-12
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-12
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 2e-12
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 2e-12
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 3e-12
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 4e-12
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 4e-12
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 5e-12
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 6e-12
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 6e-12
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 7e-12
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 1e-11
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 1e-11
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-11
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 3e-11
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 4e-11
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 6e-11
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 7e-11
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 9e-11
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 1e-10
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 5e-10
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 5e-10
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 7e-10
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 7e-10
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 2e-09
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-09
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 4e-09
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 2e-07
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 2e-06
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 2e-06
3so8_A162 Crystal Structure Of Ankra Length = 162 2e-06
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 7e-06
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 2e-05
1myo_A118 Solution Structure Of Myotrophin, Nmr, 44 Structure 4e-05
3aaa_C123 Crystal Structure Of Actin Capping Protein In Compl 5e-05
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 7e-05
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 9e-05
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 1e-04
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 1e-04
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 1e-04
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 2e-04
4hbd_A276 Crystal Structure Of Kank2 Ankyrin Repeats Length = 4e-04
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 5e-04
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 5e-04
1uoh_A226 Human Gankyrin Length = 226 5e-04
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 5e-04
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 6e-04
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 7e-04
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 9e-04
1ycs_B239 P53-53bp2 Complex Length = 239 9e-04
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure 
Iteration: 1

 Score = 82.0 bits (201), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 62/93 (66%)
Query: 1  MEKEGEQLCEAARNGDIDKVKALIGSGADVSYFDSDGLTPLMHAAKLGHANLVKTLLEAG 60
          M + G++L EAA NG+ D+VK LI +GADV+  DSDG TPL HAA+ GH  +VK L+  G
Sbjct: 1  MSELGKRLIEAAENGNKDRVKDLIENGADVNASDSDGRTPLHHAAENGHKEVVKLLISKG 60
Query: 61 APWNALSSSNLSAGDFAMDSGHQEVFEVLLNAG 93
          A  NA  S   +    A ++GH+EV ++L++ G
Sbjct: 61 ADVNAKDSDGRTPLHHAAENGHKEVVKLLISKG 93
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|3ORH|A Chain A, Human Guanidinoacetate N-Methyltransferase With Sah Length = 236 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|1XCJ|A Chain A, Guanidinoacetate Methyltransferase Containing S- Adenosylhomocysteine And Guanidinoacetate Length = 235 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|1KHH|A Chain A, Crystal Structure Of Guanidinoacetate Methyltransferase From Rat Liver: A Template Structure Of Protein Arginine Methyltransferase Length = 198 Back     alignment and structure
>pdb|1P1B|A Chain A, Guanidinoacetate Methyltransferase Length = 199 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 Back     alignment and structure
>pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query328
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 6e-68
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-18
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-16
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-16
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-12
3v31_A167 Ankyrin repeat family A protein 2; structural geno 7e-07
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-18
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-14
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 5e-08
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-17
3v30_A172 DNA-binding protein rfxank; structural genomics co 7e-17
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-16
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-13
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-05
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-16
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 6e-13
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 6e-08
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-16
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-15
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-10
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 7e-09
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-16
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-16
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-14
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-13
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-13
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-11
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-08
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-16
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 6e-13
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 7e-09
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-04
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-16
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-15
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-12
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-07
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-16
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-14
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-14
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-13
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-11
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-11
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-07
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-16
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-16
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-15
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-15
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-15
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-15
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-15
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-15
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-14
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-14
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-11
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-10
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 5e-16
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 7e-15
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-13
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-09
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-16
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-14
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-11
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-15
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-14
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 8e-14
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 9e-11
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-15
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-12
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-08
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 8e-07
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-15
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-14
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-14
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-12
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-08
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-15
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-15
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-15
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-14
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-13
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-13
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-04
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-15
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-13
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-12
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-11
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-10
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-09
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-08
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-05
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 7e-15
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-13
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-12
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 8e-15
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-14
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-13
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-13
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-11
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-11
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-07
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-14
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-13
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-13
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-08
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 9e-08
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-06
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-14
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-13
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-12
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-12
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 7e-11
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-08
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-14
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-14
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-13
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-10
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-07
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-14
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 7e-14
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-13
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-12
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-14
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-14
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-14
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-10
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-09
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-09
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-07
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-05
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-14
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-14
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-13
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-11
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-11
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-09
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-06
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-14
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-14
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 9e-14
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-08
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 7e-07
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-14
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-14
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-12
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-12
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-11
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-14
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-13
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-13
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-08
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-04
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-14
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-13
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-12
1awc_B153 Protein (GA binding protein beta 1); complex (tran 7e-06
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-14
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 8e-14
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-12
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-12
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-11
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-07
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 8e-14
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-13
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-12
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-11
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-11
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-09
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 8e-04
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 9e-14
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-12
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 9e-08
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-05
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-13
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-12
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-12
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 8e-11
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-09
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-13
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-13
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-11
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-10
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-07
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-06
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-13
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-13
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 6e-13
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-12
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 6e-12
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-10
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-09
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-13
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-13
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-12
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-12
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-12
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-04
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-13
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-12
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 8e-12
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 9e-08
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-07
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 9e-13
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 4e-04
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-12
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-08
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 8e-08
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 7e-04
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-12
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-12
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-10
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-09
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-08
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-06
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-12
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-11
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-10
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-09
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 9e-09
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 7e-05
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-04
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-12
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 5e-06
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-12
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-12
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-11
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-11
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-08
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-06
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-11
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-11
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 4e-11
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 4e-05
2etb_A256 Transient receptor potential cation channel subfam 4e-11
2etb_A256 Transient receptor potential cation channel subfam 2e-08
2etb_A256 Transient receptor potential cation channel subfam 7e-08
2etb_A256 Transient receptor potential cation channel subfam 9e-07
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 5e-11
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-10
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-10
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-09
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-04
2rfa_A232 Transient receptor potential cation channel subfa 3e-10
2rfa_A232 Transient receptor potential cation channel subfa 4e-10
2rfa_A232 Transient receptor potential cation channel subfa 5e-10
2rfa_A232 Transient receptor potential cation channel subfa 6e-09
2rfa_A232 Transient receptor potential cation channel subfa 8e-06
2pnn_A273 Transient receptor potential cation channel subfa 3e-09
2pnn_A273 Transient receptor potential cation channel subfa 7e-09
2pnn_A273 Transient receptor potential cation channel subfa 3e-08
2pnn_A273 Transient receptor potential cation channel subfa 2e-07
2pnn_A273 Transient receptor potential cation channel subfa 1e-06
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-08
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-04
1sw6_A327 Regulatory protein SWI6; transcription regulation, 9e-08
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-07
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-06
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-05
3jxi_A260 Vanilloid receptor-related osmotically activated p 7e-07
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-05
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-05
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-05
3gjy_A317 Spermidine synthase; APC62791, structural genomics 2e-06
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 9e-05
2avd_A229 Catechol-O-methyltransferase; structural genomics, 4e-04
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 4e-04
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 8e-04
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} SCOP: c.66.1.16 PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Length = 236 Back     alignment and structure
 Score =  211 bits (538), Expect = 6e-68
 Identities = 54/231 (23%), Positives = 87/231 (37%), Gaps = 21/231 (9%)

Query: 106 AGNKNSNSNGDYLEDRVSFSEG-KLVDSDSKAIMMAWEKPLMEAHAKAICSGGGHILNIG 164
                 N +  +     ++      +    K +M  WE P M A A A  S GG +L +G
Sbjct: 9   IFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSKGGRVLEVG 68

Query: 165 FGMGLVDTAIQQYSPVTHTILEAHPEVYERMLRTGWGEKNNVKIIFGRWQDNLSQL--ES 222
           FGM +  + +Q+     H I+E +  V++R+      + + V  + G W+D    L    
Sbjct: 69  FGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPDGH 128

Query: 223 YDGIFFDTYGEYYEDLRE-----FHQHLPKLLKPGGIYSYFNGLCGGNAFFHVVYCHLVS 277
           +DGI +DTY    E            H  +LLKPGG+ +Y N L          Y  +  
Sbjct: 129 FDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCN-LTSWGELMKSKYSDITI 187

Query: 278 L-------ELENLGFSMQLIPLPVKNCLGEEVWEGVKHKYWQLDTYYLPVC 321
           +        L   GF  + I   V       +      +Y+       P+ 
Sbjct: 188 MFEETQVPALLEAGFRRENIRTEVM-----ALVPPADCRYYAFPQMITPLV 233
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Length = 317 Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Length = 210 Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Length = 229 Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Length = 242 Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} Length = 204 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query328
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.97
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.96
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.96
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.96
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.96
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.96
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.96
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.96
2rfa_A232 Transient receptor potential cation channel subfa 99.95
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.95
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.95
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.95
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.95
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.95
3hra_A201 Ankyrin repeat family protein; structural protein; 99.95
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.95
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.95
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.95
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.95
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.95
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.94
2etb_A256 Transient receptor potential cation channel subfam 99.94
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.94
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.94
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.94
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.94
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.94
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.94
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.94
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.94
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.94
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.94
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.94
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.94
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.94
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.93
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.93
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.93
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.93
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.93
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.93
2pnn_A273 Transient receptor potential cation channel subfa 99.93
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.93
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.93
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.93
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.93
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.93
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.93
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.93
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.93
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.92
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 99.92
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.92
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.92
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.92
3hra_A201 Ankyrin repeat family protein; structural protein; 99.92
2rfa_A232 Transient receptor potential cation channel subfa 99.92
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.92
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.92
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.92
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.91
2etb_A256 Transient receptor potential cation channel subfam 99.91
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.91
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.91
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.91
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.91
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.91
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.91
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.91
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.91
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.9
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.9
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.9
2pnn_A273 Transient receptor potential cation channel subfa 99.9
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.9
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.9
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.9
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.9
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.9
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.89
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.89
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.89
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.89
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.89
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.89
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.89
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.88
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.88
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.88
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.88
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.87
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.86
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.86
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.86
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.86
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.86
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.85
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.85
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.84
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.84
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.83
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.83
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.83
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.82
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.81
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.79
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.79
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.78
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.77
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.77
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.77
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.77
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.69
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.66
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 99.45
3vyw_A308 MNMC2; tRNA wobble uridine, modification enzyme, g 99.3
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 99.13
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 98.54
3hnr_A220 Probable methyltransferase BT9727_4108; structural 98.53
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.53
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 98.51
3ege_A261 Putative methyltransferase from antibiotic biosyn 98.51
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 98.47
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 98.43
1xxl_A239 YCGJ protein; structural genomics, protein structu 98.43
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 98.42
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 98.42
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 98.42
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 98.41
1vl5_A260 Unknown conserved protein BH2331; putative methylt 98.41
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 98.41
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 98.41
1vlm_A219 SAM-dependent methyltransferase; possible histamin 98.41
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 98.4
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 98.39
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 98.39
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 98.39
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.38
2p7i_A250 Hypothetical protein; putative methyltransferase, 98.37
3f4k_A257 Putative methyltransferase; structural genomics, P 98.36
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 98.34
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 98.34
3dh0_A219 SAM dependent methyltransferase; cystal structure, 98.34
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 98.3
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 98.29
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 98.29
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 98.29
3gu3_A284 Methyltransferase; alpha-beta protein, structural 98.28
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 98.27
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 98.27
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 98.25
3lcc_A235 Putative methyl chloride transferase; halide methy 98.24
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 98.24
2kw5_A202 SLR1183 protein; structural genomics, northeast st 98.23
3dtn_A234 Putative methyltransferase MM_2633; structural gen 98.22
3ocj_A305 Putative exported protein; structural genomics, PS 98.22
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 98.21
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 98.21
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 98.2
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 98.19
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 98.19
3i9f_A170 Putative type 11 methyltransferase; structural gen 98.15
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 98.15
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 98.14
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 98.13
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 98.13
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 98.1
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 98.09
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 98.09
3m33_A226 Uncharacterized protein; structural genomics, PSI- 98.09
2i62_A265 Nicotinamide N-methyltransferase; structural genom 98.08
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 98.08
4hg2_A257 Methyltransferase type 11; structural genomics, PS 98.08
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 98.06
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 98.05
3cc8_A230 Putative methyltransferase; structural genomics, j 98.05
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 98.05
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 98.04
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 98.03
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 98.02
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 98.01
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 98.01
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 98.01
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 98.0
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 97.99
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 97.99
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 97.98
3duw_A223 OMT, O-methyltransferase, putative; alternating of 97.97
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 97.97
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 97.96
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 97.96
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 97.93
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 97.92
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 97.92
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 97.92
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 97.91
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 97.91
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 97.89
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 97.89
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 97.89
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 97.88
2pt6_A321 Spermidine synthase; transferase, structural genom 97.88
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 97.87
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 97.87
2frn_A278 Hypothetical protein PH0793; structural genomics, 97.87
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 97.86
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 97.86
3gjy_A317 Spermidine synthase; APC62791, structural genomics 97.85
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 97.85
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 97.84
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 97.84
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 97.84
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 97.82
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 97.82
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 97.81
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 97.81
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 97.8
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 97.79
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 97.78
2i7c_A283 Spermidine synthase; transferase, structural genom 97.76
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 97.76
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 97.75
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 97.75
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 97.74
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 97.74
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 97.74
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 97.74
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 97.74
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 97.74
3lpm_A259 Putative methyltransferase; structural genomics, p 97.73
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 97.72
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 97.71
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 97.7
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 97.69
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 97.67
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 97.67
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 97.66
1xj5_A334 Spermidine synthase 1; structural genomics, protei 97.66
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 97.62
3dp7_A363 SAM-dependent methyltransferase; structural genomi 97.62
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 97.61
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 97.61
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 97.6
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 97.6
3m70_A286 Tellurite resistance protein TEHB homolog; structu 97.6
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 97.59
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 97.58
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 97.58
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 97.58
2avd_A229 Catechol-O-methyltransferase; structural genomics, 97.58
2o07_A304 Spermidine synthase; structural genomics, structur 97.57
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 97.57
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 97.54
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 97.54
2qm3_A373 Predicted methyltransferase; putative methyltransf 97.53
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 97.53
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 97.52
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 97.52
1wzn_A252 SAM-dependent methyltransferase; structural genomi 97.48
2cmg_A262 Spermidine synthase; transferase, putrescine amino 97.47
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 97.47
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 97.45
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 97.45
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 97.44
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 97.44
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 97.43
2b3t_A276 Protein methyltransferase HEMK; translation termin 97.42
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 97.42
2esr_A177 Methyltransferase; structural genomics, hypothetic 97.42
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 97.42
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 97.4
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 97.39
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 97.39
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 97.38
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 97.37
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 97.36
1yb2_A275 Hypothetical protein TA0852; structural genomics, 97.36
2r3s_A335 Uncharacterized protein; methyltransferase domain, 97.35
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 97.33
1jsx_A207 Glucose-inhibited division protein B; methyltransf 97.3
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 97.3
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 97.29
3k6r_A278 Putative transferase PH0793; structural genomics, 97.29
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 97.28
2fpo_A202 Methylase YHHF; structural genomics, putative meth 97.28
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 97.28
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 97.26
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 97.26
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 97.25
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 97.25
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 97.25
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 97.24
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 97.23
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 97.22
1ws6_A171 Methyltransferase; structural genomics, riken stru 97.21
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 97.2
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 97.19
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 97.19
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 97.18
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 97.17
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 97.17
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 97.14
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 97.14
2fyt_A340 Protein arginine N-methyltransferase 3; structural 97.12
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 97.12
3sso_A419 Methyltransferase; macrolide, natural product, ros 97.12
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 97.1
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 97.05
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 97.05
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 97.05
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 97.05
2b78_A385 Hypothetical protein SMU.776; structure genomics, 96.98
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 96.94
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 96.93
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 96.93
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 96.92
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 96.92
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 96.87
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 96.86
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 96.86
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 96.85
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 96.82
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 96.79
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 96.78
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 96.75
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 96.75
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 96.75
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 96.7
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 96.7
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 96.69
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 96.64
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 96.63
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 96.61
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 96.59
1ne2_A200 Hypothetical protein TA1320; structural genomics, 96.59
2h00_A254 Methyltransferase 10 domain containing protein; st 96.57
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 96.57
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 96.57
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 96.51
2b25_A336 Hypothetical protein; structural genomics, methyl 96.49
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 96.47
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 96.42
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 96.41
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 96.41
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 96.23
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 96.23
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 96.13
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 96.13
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 96.11
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 96.07
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 96.0
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 95.95
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 95.85
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 95.82
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 95.79
3cvo_A202 Methyltransferase-like protein of unknown functio; 95.62
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 95.29
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 95.29
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 94.75
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 94.73
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 94.44
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 94.37
2wk1_A282 NOVP; transferase, O-methyltransferase, novobiocin 94.35
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 94.15
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 94.01
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 93.66
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 93.61
4gqb_A 637 Protein arginine N-methyltransferase 5; TIM barrel 93.58
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 93.5
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 93.35
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 93.27
3giw_A277 Protein of unknown function DUF574; rossmann-fold 93.11
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 92.74
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 92.46
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 92.08
3ua3_A 745 Protein arginine N-methyltransferase 5; TIM-barrel 92.06
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 91.89
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 90.81
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 88.56
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 87.91
2zig_A 297 TTHA0409, putative modification methylase; methylt 86.51
3ll7_A 410 Putative methyltransferase; methytransferase, stru 86.43
2km1_A136 Protein DRE2; yeast, antiapoptotic, protein bindin 85.31
1m6y_A301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 84.35
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 84.24
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 83.9
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 81.72
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 81.28
4fzv_A359 Putative methyltransferase NSUN4; mterf fold, meth 80.94
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=99.97  E-value=1.3e-30  Score=212.34  Aligned_cols=120  Identities=38%  Similarity=0.516  Sum_probs=106.1

Q ss_pred             CcchhHHHHHHHHcCCHHHHHHHHhCCCCCcccCCCCCcHHHHHHHhCcHHHHHHHHHcCCCCCccCCCCCCHHHHHHHc
Q 020270            1 MEKEGEQLCEAARNGDIDKVKALIGSGADVSYFDSDGLTPLMHAAKLGHANLVKTLLEAGAPWNALSSSNLSAGDFAMDS   80 (328)
Q Consensus         1 ~~~~~t~L~~Aa~~g~~~~v~~LL~~gad~n~~d~~G~TpLh~Aa~~g~~~~v~~Ll~~ga~~n~~d~~g~tpL~~A~~~   80 (328)
                      |++-.++|+.||+.|+.++|+.||++|+|+|.+|..|.||||+|+..++.+++++|+++|++++.+|..|+||||+|+..
T Consensus         1 ~sdlg~~L~~Aa~~G~~~~v~~Ll~~Gadvn~~d~~g~t~l~~a~~~~~~~~~~~ll~~gad~~~~d~~g~TpLh~A~~~   80 (169)
T 4gpm_A            1 MSELGKRLIEAAENGNKDRVKDLIENGADVNASDSDGRTPLHHAAENGHKEVVKLLISKGADVNAKDSDGRTPLHHAAEN   80 (169)
T ss_dssp             -CHHHHHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHT
T ss_pred             CCHHHHHHHHHHHcCCHHHHHHHHHCCCCCCCcCCCCCCHHHHHHHcCCHHHHHHHHhcccchhhhccCCCCHHHHHHHc
Confidence            56677899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCHHHHHHHHHcCCChhhhhh----HHHhhccCCCCCcchhhhh
Q 020270           81 GHQEVFEVLLNAGIQAELILG----TIARAGNKNSNSNGDYLED  120 (328)
Q Consensus        81 g~~~~v~~Ll~~g~~~~~~~~----~l~~a~~~~~~~~~~~L~~  120 (328)
                      |+.+++++|+++|++++..+.    ||+.|+..++.+++++|++
T Consensus        81 g~~~~v~~Ll~~gadvn~~d~~G~TpLh~A~~~g~~~~v~~Ll~  124 (169)
T 4gpm_A           81 GHKEVVKLLISKGADVNAKDSDGRTPLHHAAENGHKEVVKLLIS  124 (169)
T ss_dssp             TCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHH
T ss_pred             CCHHHHHHHHHCcCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHH
Confidence            999999999999999876544    5555555555555555554
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3vyw_A MNMC2; tRNA wobble uridine, modification enzyme, genetic CODE, 5- methylaminomethyl-2-thiouridine, methyltransferase; HET: SAM; 2.49A {Aquifex aeolicus} PDB: 2e58_A* Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>2km1_A Protein DRE2; yeast, antiapoptotic, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 328
d1zx0a1229 c.66.1.16 (A:8-236) Guanidinoacetate methyltransfe 1e-31
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-16
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-10
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-09
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-09
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-09
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-06
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-06
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-05
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 8e-04
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-11
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-07
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-06
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 8e-06
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-10
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-09
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-09
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-06
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-04
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 7e-04
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 5e-10
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 9e-10
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-04
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 7e-04
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 7e-10
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-09
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-05
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-09
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-08
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 6e-04
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 9e-09
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 3e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-08
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-07
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 0.004
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-08
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-07
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-06
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-05
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-04
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 9e-08
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-06
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-07
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.004
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-06
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 5e-06
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 5e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 0.001
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 0.003
d2b2ca1312 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhab 1e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 5e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 3e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.002
d1nkva_245 c.66.1.21 (A:) Hypothetical Protein YjhP {Escheric 8e-04
d1jqea_280 c.66.1.19 (A:) Histamine methyltransferase {Human 0.001
d1mjfa_276 c.66.1.17 (A:) Putative spermidine synthetase PF01 0.001
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 0.001
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 0.003
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 229 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Guanidinoacetate methyltransferase
domain: Guanidinoacetate methyltransferase
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  116 bits (290), Expect = 1e-31
 Identities = 48/207 (23%), Positives = 77/207 (37%), Gaps = 18/207 (8%)

Query: 128 KLVDSDSKAIMMAWEKPLMEAHAKAICSGGGHILNIGFGMGLVDTAIQQYSPVTHTILEA 187
             +    K +M  WE P M A A A  S GG +L +GFGM +  + +Q+     H I+E 
Sbjct: 25  THLRILGKPVMERWETPYMHALAAAASSKGGRVLEVGFGMAIAASKVQEAPIDEHWIIEC 84

Query: 188 HPEVYERMLRTGWGEKNNVKIIFGR--WQDNLSQLESYDGIFFDTYGEYY-----EDLRE 240
           +  V++R+      + + V  + G             +DGI +DTY              
Sbjct: 85  NDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNF 144

Query: 241 FHQHLPKLLKPGGIYSYFNGLCGGNAF------FHVVYCHLVSLELENLGFSMQLIPLPV 294
              H  +LLKPGG+ +Y N    G           +++       L   GF  + I   V
Sbjct: 145 IKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEV 204

Query: 295 KNCLGEEVWEGVKHKYWQLDTYYLPVC 321
                  +      +Y+       P+ 
Sbjct: 205 -----MALVPPADCRYYAFPQMITPLV 226
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Length = 312 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Length = 245 Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 280 Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 276 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query328
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.95
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.93
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.92
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.92
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.92
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.92
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.91
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.91
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.91
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.91
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.9
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.89
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.89
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.88
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.88
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.85
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.85
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.83
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.82
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.81
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.81
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.8
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.79
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 99.79
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.79
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.78
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.78
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.77
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.77
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.76
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.76
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.75
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.74
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 98.71
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 98.49
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 98.49
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 98.47
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 98.45
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 98.31
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 98.3
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 98.27
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 98.23
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 98.21
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 98.21
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 98.19
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 98.18
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 98.14
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 98.1
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 98.08
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 98.07
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 98.07
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 98.04
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 97.99
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 97.97
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 97.95
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 97.95
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 97.95
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 97.91
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 97.89
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 97.89
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 97.89
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 97.81
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 97.81
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 97.81
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 97.8
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 97.7
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 97.66
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 97.63
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 97.63
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 97.63
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 97.63
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 97.59
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 97.59
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 97.56
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 97.56
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 97.55
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 97.53
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 97.41
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 97.3
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 97.3
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 97.26
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 97.26
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 97.23
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 97.22
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 97.12
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 97.09
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 97.03
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 97.0
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 96.97
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 96.9
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 96.76
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 96.76
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 96.69
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 96.67
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 96.61
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 96.58
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 96.52
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 96.37
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 96.33
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 96.23
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 95.79
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 95.65
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 95.43
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 95.14
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 95.08
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 94.63
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 94.44
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 93.46
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 92.01
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 89.68
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 88.87
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 88.85
d2h00a1250 Methyltransferase 10 domain containing protein MET 85.14
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 82.9
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 81.59
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 80.54
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Transcription factor inhibitor I-kappa-B-beta, IKBB
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.95  E-value=1.3e-29  Score=217.37  Aligned_cols=191  Identities=20%  Similarity=0.078  Sum_probs=145.3

Q ss_pred             cchhHHHHHHHHcCCHHHHHHHHhCCCC---CcccCCCCCcHHHHHHHhCcHHHHHHHHHcCCCCCccCCCCCCHHHHHH
Q 020270            2 EKEGEQLCEAARNGDIDKVKALIGSGAD---VSYFDSDGLTPLMHAAKLGHANLVKTLLEAGAPWNALSSSNLSAGDFAM   78 (328)
Q Consensus         2 ~~~~t~L~~Aa~~g~~~~v~~LL~~gad---~n~~d~~G~TpLh~Aa~~g~~~~v~~Ll~~ga~~n~~d~~g~tpL~~A~   78 (328)
                      ++|.||||.||..|+.++|++||++|++   ++.+|..|.||||+|+..|+.+++++|+++|++++..|..|.||||+|+
T Consensus         7 ~~G~t~Lh~A~~~~~~~~v~~Ll~~~a~~~~i~~~~~~g~TpL~~A~~~g~~~iv~~Ll~~ga~i~~~d~~g~tpL~~A~   86 (255)
T d1oy3d_           7 EDGDTALHLAVIHQHEPFLDFLLGFSAGHEYLDLQNDLGQTALHLAAILGEASTVEKLYAAGAGVLVAERGGHTALHLAC   86 (255)
T ss_dssp             TTCCCHHHHHHHTTCHHHHHHHHHHHTTSGGGGCCCTTSCCHHHHHHHHTCHHHHHHHHHTTCCSSCCCTTSCCHHHHHT
T ss_pred             cCCCCHHHHHHHcCCHHHHHHHHHcCCCcccccCcCCCCCCccchHHhhcccccccccccccccccccccccchhhhhhh
Confidence            5789999999999999999999999988   5677889999999999999999999999999999999999999999999


Q ss_pred             HcCCHHHHHHHHHcCCChhhh-----------------------------------------------hh----HHHhhc
Q 020270           79 DSGHQEVFEVLLNAGIQAELI-----------------------------------------------LG----TIARAG  107 (328)
Q Consensus        79 ~~g~~~~v~~Ll~~g~~~~~~-----------------------------------------------~~----~l~~a~  107 (328)
                      ..++.+++++|++.+......                                               +.    |||.|+
T Consensus        87 ~~~~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~in~~d~~g~TpLh~A~  166 (255)
T d1oy3d_          87 RVRAHTCACVLLQPRPSHPRDASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPRDEDWRLQLEAENYDGHTPLHVAV  166 (255)
T ss_dssp             TTTCHHHHHHHSSSCCSSCCCC-----------------------------------CCCGGGGTTCCCTTSCCHHHHHH
T ss_pred             ccCchHHHHHHHhhccchhcccchhhhhHHhhhcccchHHHHHHHhhcchhHHHHHHhhhcCcccccccccCcccccccc
Confidence            999999999998755331110                                               00    566677


Q ss_pred             cCCCCCcchhhhhcccccCCccccccchhhhhhccchHHHHHHHHhhcCCCceeeecccCCcchhHHhccCCceEEeecc
Q 020270          108 NKNSNSNGDYLEDRVSFSEGKLVDSDSKAIMMAWEKPLMEAHAKAICSGGGHILNIGFGMGLVDTAIQQYSPVTHTILEA  187 (328)
Q Consensus       108 ~~~~~~~~~~L~~~~~~~~~~l~~~~~~~~~~~~~tpL~~a~~~~~~~~~~~iLe~g~~~g~~~~~~~~~~~~~~~a~e~  187 (328)
                      ..++.+++++|++......        ......|.||||.|+..+..+..+.+++.|++....+.  .+.+|+++++..+
T Consensus       167 ~~~~~~~v~~Ll~~~~~~~--------~~~~~~g~TpL~~A~~~~~~~~v~~Ll~~gadin~~d~--~g~t~L~~A~~~~  236 (255)
T d1oy3d_         167 IHKDAEMVRLLRDAGADLN--------KPEPTCGRTPLHLAVEAQAASVLELLLKAGADPTARMY--GGRTPLGSALLRP  236 (255)
T ss_dssp             HTTCHHHHHHHHHHTCCTT--------CCCTTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCT--TSCCHHHHHHTSS
T ss_pred             cccccccccchhccccccc--------ccccccccccccccccccHHHHHHHHHHCCCCCCCCCC--CCCCHHHHHHHCC
Confidence            7777777777766443210        11223456888888777665555556666665544432  4556665555558


Q ss_pred             CHHHHHHHHHcCCCC
Q 020270          188 HPEVYERMLRTGWGE  202 (328)
Q Consensus       188 ~~~~~~~L~~~g~~~  202 (328)
                      ++++++.|+++|++.
T Consensus       237 ~~~i~~~Ll~~Ga~~  251 (255)
T d1oy3d_         237 NPILARLLRAHGAPE  251 (255)
T ss_dssp             CHHHHHHHHHTTCCC
T ss_pred             CHHHHHHHHHcCCCC
Confidence            888888888888764
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure