Citrus Sinensis ID: 020398

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320------
MACQLTLSLICIFSLLLTAAQSKTLKRDVKALNEIKASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNLLDLTRLDLHNNKLTGPIPPQIGRLKRLRILNLRWNKLQDVIPAEIGELKRLTHLSLSFNNFKGEIPKEIANLPELRYLYLQENRLTGRIPPELGILPNFRHLDVGNNHLVGTIRELIRFEGSFPVLRNLYLNNNYLTGGVPAQLANLTNLEILYLSHNKMSGTIPLALAHIPKLTYLYLDHNQFSGRIPDAFYKHPFLKEMYIEGNAFRPGVNPIGIHKVLELTDTEFLV
cHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccccccccccccccccEEEEccccccccccEEEEEccccccEEEccccccccccccEEEcccccccccccHHHHccccccEEccccccccccccHHHHcccccccccccccEEcccccccccccccccEEEccccEEEEcccccccccccccEEEccccccccccccccccccccccccEEEcccccccccccHHHHcccccccEEccccccEEcccccccccccccEEcccccccEEcccccccccccccEEEcccccccccccccccccccccccccccc
ccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccccccccccccccccccccccccHccccccEEEEEccccccccccHHHcccccccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEcccccccccccHHHccccccccccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccccccccHHHcccccccEEEccc
MACQLTLSLICIFSLLLTAAQSKTLKRDVKALNEIKASLGWRVVYAWvgddpcgdgdlppwsgvtcstqgdyRVVTELEVYAVSIVGPFPIAVTNLLdltrldlhnnkltgpippqigrlKRLRILNLRWNKLQDVIPAEIGELKRLTHLSLSfnnfkgeipkeianlpELRYLYLQENrltgrippelgilpnfrhldvgnnhLVGTIRELIRFegsfpvlrnlylnnnyltggvpaqlanltnLEILYLSHnkmsgtiplalahipkLTYLyldhnqfsgripdafykhpflkemyiegnafrpgvnpigihkvleltdteflv
MACQLTLSLICIFSLLLTAAQSKTLKRDVKALNEIKASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNLLDLTRLDLHNNkltgpippqigrlkRLRILNLRWNKLQDVIPAEIGELKRLTHLSLSFNNFKGEIPKEIANLPELRYLYLQENRLTGRIPPELGILPNFRHLDVGNNHLVGTIRELIRFEGSFPVLRNLYLNNNYLTGGVPAQLANLTNLEILYLSHNKMSGTIPLALAHIPKLTYLYLDHNQFSGRIPDAFYKHPFLKEMYIEGNAFRPGVNPIGIHKvleltdteflv
MACQLTLSLICIFSLLLTAAQSKTLKRDVKALNEIKASLGWRVVYAWVgddpcgdgdlppWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNLLDLTRLDLHNNKLTGPIPPQIGRLKRLRILNLRWNKLQDVIPAEIGELKRLTHLSLSFNNFKGEIPKEIANLPELRYLYLQENRLTGRIPPELGILPNFRHLDVGNNHLVGTIRELIRFEGSFPVlrnlylnnnylTGGVPAQLANLTNLEILYLSHNKMSGTIPLALAHIPKLTYLYLDHNQFSGRIPDAFYKHPFLKEMYIEGNAFRPGVNPIGIHKVLELTDTEFLV
**CQLTLSLICIFSLLLTAAQSKTLKRDVKALNEIKASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNLLDLTRLDLHNNKLTGPIPPQIGRLKRLRILNLRWNKLQDVIPAEIGELKRLTHLSLSFNNFKGEIPKEIANLPELRYLYLQENRLTGRIPPELGILPNFRHLDVGNNHLVGTIRELIRFEGSFPVLRNLYLNNNYLTGGVPAQLANLTNLEILYLSHNKMSGTIPLALAHIPKLTYLYLDHNQFSGRIPDAFYKHPFLKEMYIEGNAFRPGVNPIGIHKVLELTDT****
*ACQLTLSLICIFSLLLTAAQSKTLKRDVKALNEIKASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNLLDLTRLDLHNNKLTGPIPPQIGRLKRLRILNLRWNKLQDVIPAEIGELKRLTHLSLSFNNFKGEIPKEIANLPELRYLYLQENRLTGRIPPELGILPNFRHLDVGNNHLVGTIRELIRFEGSFPVLRNLYLNNNYLTGGVPAQLANLTNLEILYLSHNKMSGTIPLALAHIPKLTYLYLDHNQFSGRIPDAFYKHPFLKEMYIEGNAFRPGVNPIGIHKVLELTDTEFLV
MACQLTLSLICIFSLLLTAAQSKTLKRDVKALNEIKASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNLLDLTRLDLHNNKLTGPIPPQIGRLKRLRILNLRWNKLQDVIPAEIGELKRLTHLSLSFNNFKGEIPKEIANLPELRYLYLQENRLTGRIPPELGILPNFRHLDVGNNHLVGTIRELIRFEGSFPVLRNLYLNNNYLTGGVPAQLANLTNLEILYLSHNKMSGTIPLALAHIPKLTYLYLDHNQFSGRIPDAFYKHPFLKEMYIEGNAFRPGVNPIGIHKVLELTDTEFLV
*ACQLTLSLICIFSLLLTAAQSKTLKRDVKALNEIKASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNLLDLTRLDLHNNKLTGPIPPQIGRLKRLRILNLRWNKLQDVIPAEIGELKRLTHLSLSFNNFKGEIPKEIANLPELRYLYLQENRLTGRIPPELGILPNFRHLDVGNNHLVGTIRELIRFEGSFPVLRNLYLNNNYLTGGVPAQLANLTNLEILYLSHNKMSGTIPLALAHIPKLTYLYLDHNQFSGRIPDAFYKHPFLKEMYIEGNAFRPGVNPIGIHKVLELTDTEFL*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MACQLTLSLICIFSLLLTAAQSKTLKRDVKALNEIKASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNLLDLTRLDLHNNKLTGPIPPQIGRLKRLRILNLRWNKLQDVIPAEIGELKRLTHLSLSFNNFKGEIPKEIANLPELRYLYLQENRLTGRIPPELGILPNFRHLDVGNNHLVGTIRELIRFEGSFPVLRNLYLNNNYLTGGVPAQLANLTNLEILYLSHNKMSGTIPLALAHIPKLTYLYLDHNQFSGRIPDAFYKHPFLKEMYIEGNAFRPGVNPIGIHKVLELTDTEFLV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query326 2.2.26 [Sep-21-2011]
Q9LP24 1120 Probable leucine-rich rep no no 0.754 0.219 0.354 8e-36
Q9C9H7 847 Receptor-like protein 12 no no 0.895 0.344 0.332 2e-34
Q00874372 DNA-damage-repair/tolerat no no 0.659 0.577 0.385 1e-33
Q9LT96 946 Probable leucine-rich rep no no 0.760 0.262 0.347 2e-33
C0LGQ5 1249 LRR receptor-like serine/ no no 0.788 0.205 0.338 3e-33
Q9SHI2 1101 Leucine-rich repeat recep no no 0.935 0.277 0.306 5e-33
Q9FL28 1173 LRR receptor-like serine/ no no 0.693 0.192 0.338 6e-33
Q8VZG8 1045 Probable LRR receptor-lik no no 0.739 0.230 0.375 7e-33
Q9FII5 1041 Leucine-rich repeat recep no no 0.705 0.220 0.341 8e-33
Q9LYN8 1192 Leucine-rich repeat recep no no 0.610 0.166 0.406 2e-32
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function desciption
 Score =  151 bits (381), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 101/285 (35%), Positives = 138/285 (48%), Gaps = 39/285 (13%)

Query: 34  EIKASLGWRVVY-------AWVGDDPCGDG-DLPPWSGVTCSTQGDYRVVTELEVYAVSI 85
           E  A L W+  +       +WV D           W GV+C+++G    + EL +    I
Sbjct: 33  EANALLKWKSTFTNSSKLSSWVHDANTNTSFSCTSWYGVSCNSRGS---IEELNLTNTGI 89

Query: 86  VGPF-------------------------PIAVTNLLDLTRLDLHNNKLTGPIPPQIGRL 120
            G F                         P    NL  L   DL  N LTG I P +G L
Sbjct: 90  EGTFQDFPFISLSNLAYVDLSMNLLSGTIPPQFGNLSKLIYFDLSTNHLTGEISPSLGNL 149

Query: 121 KRLRILNLRWNKLQDVIPAEIGELKRLTHLSLSFNNFKGEIPKEIANLPELRYLYLQENR 180
           K L +L L  N L  VIP+E+G ++ +T L+LS N   G IP  + NL  L  LYL EN 
Sbjct: 150 KNLTVLYLHQNYLTSVIPSELGNMESMTDLALSQNKLTGSIPSSLGNLKNLMVLYLYENY 209

Query: 181 LTGRIPPELGILPNFRHLDVGNNHLVGTIRELIRFEGSFPVLRNLYLNNNYLTGGVPAQL 240
           LTG IPPELG + +   L +  N L G+I   +   G+   L  LYL  NYLTG +P ++
Sbjct: 210 LTGVIPPELGNMESMTDLALSQNKLTGSIPSTL---GNLKNLMVLYLYENYLTGVIPPEI 266

Query: 241 ANLTNLEILYLSHNKMSGTIPLALAHIPKLTYLYLDHNQFSGRIP 285
            N+ ++  L LS NK++G+IP +L ++  LT L L  N  +G IP
Sbjct: 267 GNMESMTNLALSQNKLTGSIPSSLGNLKNLTLLSLFQNYLTGGIP 311

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|Q00874|DR100_ARATH DNA-damage-repair/toleration protein DRT100 OS=Arabidopsis thaliana GN=DRT100 PE=2 SV=2 Back     alignment and function description
>sp|Q9LT96|Y5977_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g49770 OS=Arabidopsis thaliana GN=At5g49770 PE=2 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|Q9FII5|TDR_ARATH Leucine-rich repeat receptor-like protein kinase TDR OS=Arabidopsis thaliana GN=TDR PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query326
79543203326 leucine-rich repeat-containing protein [ 1.0 1.0 0.861 1e-164
297793683326 protein binding protein [Arabidopsis lyr 1.0 1.0 0.861 1e-164
334188544339 leucine-rich repeat-containing protein [ 1.0 0.961 0.828 1e-162
225423495329 PREDICTED: probable leucine-rich repeat 0.929 0.920 0.907 1e-160
14626935328 leucine-rich repeat resistance protein-l 0.990 0.984 0.888 1e-160
357487463329 Leucine-rich repeat receptor protein kin 0.984 0.975 0.850 1e-158
224101431327 predicted protein [Populus trichocarpa] 0.990 0.987 0.832 1e-157
356499873329 PREDICTED: leucine-rich repeat receptor- 0.941 0.933 0.879 1e-157
388511925329 unknown [Lotus japonicus] 0.987 0.978 0.845 1e-156
167594027327 LRR-like disease resistance protein [Bra 1.0 0.996 0.843 1e-156
>gi|79543203|ref|NP_200932.2| leucine-rich repeat-containing protein [Arabidopsis thaliana] gi|9757845|dbj|BAB08479.1| leucine-rich repeat disease resistance protein-like [Arabidopsis thaliana] gi|22135942|gb|AAM91553.1| Cf-5 disease resistance protein-like [Arabidopsis thaliana] gi|23197592|gb|AAN15323.1| Cf-5 disease resistance protein-like [Arabidopsis thaliana] gi|332010057|gb|AED97440.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
 Score =  585 bits (1507), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 281/326 (86%), Positives = 301/326 (92%)

Query: 1   MACQLTLSLICIFSLLLTAAQSKTLKRDVKALNEIKASLGWRVVYAWVGDDPCGDGDLPP 60
           MA +  L LIC+FSLL+  A SKTLKRDVKALNEIKASLGWRVVY+WVGDDPCGDGDLPP
Sbjct: 1   MASRCELLLICVFSLLIAFAHSKTLKRDVKALNEIKASLGWRVVYSWVGDDPCGDGDLPP 60

Query: 61  WSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNLLDLTRLDLHNNKLTGPIPPQIGRL 120
           WSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNLLDLTRLDLHNNKLTGPIPPQIGRL
Sbjct: 61  WSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNLLDLTRLDLHNNKLTGPIPPQIGRL 120

Query: 121 KRLRILNLRWNKLQDVIPAEIGELKRLTHLSLSFNNFKGEIPKEIANLPELRYLYLQENR 180
           KRL++LNLRWNKLQDVIP EIGELKRLTHL LSFN+FKGEIPKE+A LPELRYLYLQENR
Sbjct: 121 KRLKVLNLRWNKLQDVIPPEIGELKRLTHLYLSFNSFKGEIPKELAALPELRYLYLQENR 180

Query: 181 LTGRIPPELGILPNFRHLDVGNNHLVGTIRELIRFEGSFPVLRNLYLNNNYLTGGVPAQL 240
           L GRIP ELG L N RHLDVGNNHLVGTIRELIRF+GSFP LRNLYLNNNYL+GG+PAQL
Sbjct: 181 LIGRIPAELGTLQNLRHLDVGNNHLVGTIRELIRFDGSFPALRNLYLNNNYLSGGIPAQL 240

Query: 241 ANLTNLEILYLSHNKMSGTIPLALAHIPKLTYLYLDHNQFSGRIPDAFYKHPFLKEMYIE 300
           +NLTNLEI+YLS+NK  G IP A+AHIPKLTYLYLDHNQF+GRIPDAFYKHPFLKEMYIE
Sbjct: 241 SNLTNLEIVYLSYNKFIGNIPFAIAHIPKLTYLYLDHNQFTGRIPDAFYKHPFLKEMYIE 300

Query: 301 GNAFRPGVNPIGIHKVLELTDTEFLV 326
           GN F+ GVNPIG HKVLE++D +F V
Sbjct: 301 GNMFKSGVNPIGTHKVLEVSDADFAV 326

Source: Arabidopsis thaliana

Species: Arabidopsis thaliana

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297793683|ref|XP_002864726.1| protein binding protein [Arabidopsis lyrata subsp. lyrata] gi|297310561|gb|EFH40985.1| protein binding protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|334188544|ref|NP_001190586.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] gi|332010058|gb|AED97441.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|225423495|ref|XP_002269214.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710 [Vitis vinifera] gi|297738074|emb|CBI27275.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|14626935|gb|AAK70805.1| leucine-rich repeat resistance protein-like protein [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|357487463|ref|XP_003614019.1| Leucine-rich repeat receptor protein kinase EXS [Medicago truncatula] gi|355515354|gb|AES96977.1| Leucine-rich repeat receptor protein kinase EXS [Medicago truncatula] Back     alignment and taxonomy information
>gi|224101431|ref|XP_002312277.1| predicted protein [Populus trichocarpa] gi|222852097|gb|EEE89644.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356499873|ref|XP_003518760.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|388511925|gb|AFK44024.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|167594027|gb|ABZ85667.1| LRR-like disease resistance protein [Brassica rapa subsp. pekinensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query326
TAIR|locus:2014854330 AT1G13910 [Arabidopsis thalian 0.987 0.975 0.658 2.4e-108
TAIR|locus:2074633 943 RLP35 "AT3G11080" [Arabidopsis 0.788 0.272 0.340 4.4e-32
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.782 0.227 0.335 6.1e-32
TAIR|locus:2091260372 DRT100 "DNA-DAMAGE REPAIR/TOLE 0.659 0.577 0.362 2.3e-30
TAIR|locus:2138268 1045 AT4G08850 [Arabidopsis thalian 0.739 0.230 0.354 4.5e-30
TAIR|locus:2825384 847 RLP12 "AT1G71400" [Arabidopsis 0.687 0.264 0.361 1e-29
TAIR|locus:2043540 960 AT2G25790 [Arabidopsis thalian 0.708 0.240 0.340 2.2e-29
UNIPROTKB|Q40640 1025 Xa21 "Receptor kinase-like pro 0.950 0.302 0.317 2.4e-29
TAIR|locus:4515102753 598 AT1G73066 [Arabidopsis thalian 0.788 0.429 0.328 3.6e-29
TAIR|locus:2161158 1041 PXY "PHLOEM INTERCALATED WITH 0.726 0.227 0.326 4.1e-29
TAIR|locus:2014854 AT1G13910 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1071 (382.1 bits), Expect = 2.4e-108, P = 2.4e-108
 Identities = 214/325 (65%), Positives = 249/325 (76%)

Query:     5 LTLSLIC-IFSLLL--TAAQSKTLKRDVKALNEIKASLGWRVVYAWVXXXXXXXXXXXXW 61
             L+L LI  I++LLL    + +KTLKRD+KALNEIK  +GWR+VY+WV            W
Sbjct:     6 LSLYLILRIYALLLLFNVSFAKTLKRDMKALNEIKKLVGWRLVYSWVGDDPCGDGVLPPW 65

Query:    62 SGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNLLDLTRLDLHNNKLTGPIPPQIGRLK 121
             SGVTCS  GDYRVV +LEVY++SIVG FP A+T LLDLT LD+HNNKLTGPIPP+IGRLK
Sbjct:    66 SGVTCSKVGDYRVVVKLEVYSMSIVGNFPKAITKLLDLTVLDMHNNKLTGPIPPEIGRLK 125

Query:   122 RLRILNLRWNKLQDVIPAEIGELKRLTHLSLSFNNFKGEIPKEIANLPELRYLYLQENRL 181
             RL  LNLRWNKLQ  +P EIG LK LT+L LSFNNFKGEIPKE+ANL EL+YL++QEN  
Sbjct:   126 RLITLNLRWNKLQQALPPEIGGLKSLTYLYLSFNNFKGEIPKELANLHELQYLHIQENHF 185

Query:   182 TGRIPPELGILPNFRHLDVGNNHLVGTIRELIRFEGSFPVXXXXXXXXXXXTGGVPAQLA 241
             TGRIP ELG L   RHLD GNN+LVG+I +L R EG FP            TGG+P +LA
Sbjct:   186 TGRIPAELGTLQKLRHLDAGNNNLVGSISDLFRIEGCFPALRNLFLNNNYLTGGLPNKLA 245

Query:   242 NLTNLEILYLSHNKMSGTIPLALAHIPKLTYLYLDHNQFSGRIPDAFYKHPFLKEMYIEG 301
             NLTNLEILYLS NKM+G IP ALA IP+LT L+LDHN F+G IP+AFYKHP LK+MYIEG
Sbjct:   246 NLTNLEILYLSFNKMTGAIPAALASIPRLTNLHLDHNLFNGSIPEAFYKHPNLKDMYIEG 305

Query:   302 NAFRPGVNPIGIHKVLELTDTEFLV 326
             NAF+  V  IG HKVLEL+DT+FLV
Sbjct:   306 NAFKSDVKAIGAHKVLELSDTDFLV 330
GO:0005886 "plasma membrane" evidence=ISM
GO:0007165 "signal transduction" evidence=IC;RCA
GO:0002237 "response to molecule of bacterial origin" evidence=RCA
GO:0010103 "stomatal complex morphogenesis" evidence=RCA
GO:0048443 "stamen development" evidence=RCA
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091260 DRT100 "DNA-DAMAGE REPAIR/TOLERATION 100" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2138268 AT4G08850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043540 AT2G25790 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40640 Xa21 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:4515102753 AT1G73066 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161158 PXY "PHLOEM INTERCALATED WITH XYLEM" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query326
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-42
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-39
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-36
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-34
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-34
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-33
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-30
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-29
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-28
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-24
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-18
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-11
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-08
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-04
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 3e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.002
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.002
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  155 bits (394), Expect = 3e-42
 Identities = 83/202 (41%), Positives = 114/202 (56%), Gaps = 3/202 (1%)

Query: 85  IVGPFPIAVTNLLDLTRLDLHNNKLTGPIPPQIGRLKRLRILNLRWNKLQDVIPAEIGEL 144
           +VG  P ++TNL  L  L L +N+L G IP ++G++K L+ + L +N L   IP EIG L
Sbjct: 176 LVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGL 235

Query: 145 KRLTHLSLSFNNFKGEIPKEIANLPELRYLYLQENRLTGRIPPELGILPNFRHLDVGNNH 204
             L HL L +NN  G IP  + NL  L+YL+L +N+L+G IPP +  L     LD+ +N 
Sbjct: 236 TSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNS 295

Query: 205 LVGTIRELIRFEGSFPVLRNLYLNNNYLTGGVPAQLANLTNLEILYLSHNKMSGTIPLAL 264
           L G I EL+        L  L+L +N  TG +P  L +L  L++L L  NK SG IP  L
Sbjct: 296 LSGEIPELV---IQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNL 352

Query: 265 AHIPKLTYLYLDHNQFSGRIPD 286
                LT L L  N  +G IP+
Sbjct: 353 GKHNNLTVLDLSTNNLTGEIPE 374

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 326
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.97
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.92
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.92
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.86
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.86
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.85
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.8
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.78
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.77
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.77
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.75
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.75
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.75
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.75
PLN03150623 hypothetical protein; Provisional 99.74
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.72
KOG0617264 consensus Ras suppressor protein (contains leucine 99.72
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.72
KOG0617264 consensus Ras suppressor protein (contains leucine 99.71
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.71
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.69
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.69
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.39
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.37
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.34
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.32
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.3
PLN03150623 hypothetical protein; Provisional 99.26
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.24
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.21
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.18
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.18
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.13
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.12
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.96
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.96
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.94
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.92
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.86
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.78
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.74
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.71
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.71
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.66
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.66
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.58
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.5
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.46
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.44
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.35
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.24
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.1
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.03
PRK15386 426 type III secretion protein GogB; Provisional 97.98
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.93
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.85
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 97.78
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.78
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.75
PRK15386 426 type III secretion protein GogB; Provisional 97.6
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.52
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.36
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.35
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.34
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.23
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.73
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.71
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.52
KOG4308 478 consensus LRR-containing protein [Function unknown 96.4
KOG4308 478 consensus LRR-containing protein [Function unknown 96.33
KOG4341483 consensus F-box protein containing LRR [General fu 95.71
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.53
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.35
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.24
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.63
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.66
KOG4341483 consensus F-box protein containing LRR [General fu 90.35
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.83
smart0037026 LRR Leucine-rich repeats, outliers. 88.93
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.93
KOG0473 326 consensus Leucine-rich repeat protein [Function un 88.57
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 88.26
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 80.48
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=5.7e-36  Score=302.17  Aligned_cols=269  Identities=33%  Similarity=0.574  Sum_probs=167.8

Q ss_pred             CHHHHHHHHHHHHhcCC--CCCCCCCCC-CCCCCCCCCCceeeEcCCCCCcceEEEEEecCCcccccCcccccCCCCCCE
Q 020398           25 LKRDVKALNEIKASLGW--RVVYAWVGD-DPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNLLDLTR  101 (326)
Q Consensus        25 ~~~~~~al~~~~~~~~~--~~~~~w~~~-~~C~~~~~~~w~~v~c~~~~~~~~l~~L~l~~~~l~~~~~~~~~~l~~L~~  101 (326)
                      ...|++||++||.++..  ....+|... ++|      .|.||+|+..   .+++.|+++++.+.+.++..+..+++|++
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~~~~~w~~~~~~c------~w~gv~c~~~---~~v~~L~L~~~~i~~~~~~~~~~l~~L~~   97 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLKYLSNWNSSADVC------LWQGITCNNS---SRVVSIDLSGKNISGKISSAIFRLPYIQT   97 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcccCCCCCCCCCCC------cCcceecCCC---CcEEEEEecCCCccccCChHHhCCCCCCE
Confidence            55889999999999852  345789644 455      7999999753   36999999999999998989999999999


Q ss_pred             EEccCCcccCCCCcccc-CCCCCcEEEeecccCCccCchhhcCCCCCCEEECccCcCCCCchhhcCCCCCCceeeccccc
Q 020398          102 LDLHNNKLTGPIPPQIG-RLKRLRILNLRWNKLQDVIPAEIGELKRLTHLSLSFNNFKGEIPKEIANLPELRYLYLQENR  180 (326)
Q Consensus       102 L~L~~n~l~~~~~~~l~-~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~  180 (326)
                      |++++|.+.+.+|..+. .+++|++|++++|.+++.+|.  +.+++|++|++++|.+.+.+|..+..+++|++|++++|.
T Consensus        98 L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~  175 (968)
T PLN00113         98 INLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNV  175 (968)
T ss_pred             EECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCc
Confidence            99999999888876644 777777777777777665543  234555555555555555555555555555555555555


Q ss_pred             CCCCCCccCCCCCCCcEEEeecCcCcccchhhhhccCCCCcccEEEeecCcCCCCCchhhhCCCCCceeeeecCcCCccc
Q 020398          181 LTGRIPPELGILPNFRHLDVGNNHLVGTIRELIRFEGSFPVLRNLYLNNNYLTGGVPAQLANLTNLEILYLSHNKMSGTI  260 (326)
Q Consensus       181 l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~l~~~~~L~~L~l~~n~l~~~~  260 (326)
                      +.+.+|..+.++++|++|++++|.+.+..+..+   ..+++|+.|++++|.+++.+|..++.+++|++|++++|.+.+.+
T Consensus       176 l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l---~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~  252 (968)
T PLN00113        176 LVGKIPNSLTNLTSLEFLTLASNQLVGQIPREL---GQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPI  252 (968)
T ss_pred             ccccCChhhhhCcCCCeeeccCCCCcCcCChHH---cCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceecccc
Confidence            555555555555555555555555554444443   34445555555555555444444455555555555555444444


Q ss_pred             hhhccCCCCCCEEecccccCCCcCcccccCCCCCcEEEeeCCcCCCC
Q 020398          261 PLALAHIPKLTYLYLDHNQFSGRIPDAFYKHPFLKEMYIEGNAFRPG  307 (326)
Q Consensus       261 p~~l~~l~~L~~L~l~~n~l~~~~~~~l~~~~~L~~L~ls~N~l~~~  307 (326)
                      |..+..+++|++|++++|.+.+.+|..+..+++|+.|++++|.+++.
T Consensus       253 p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~  299 (968)
T PLN00113        253 PSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGE  299 (968)
T ss_pred             ChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccC
Confidence            44444444444444444444444444444444444444444444433

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query326
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 5e-22
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 6e-22
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 7e-17
1ogq_A 313 The Crystal Structure Of Pgip (Polygalacturonase In 4e-09
1ogq_A 313 The Crystal Structure Of Pgip (Polygalacturonase In 7e-06
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 9e-08
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 9e-08
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 1e-07
1h6u_A308 Internalin H: Crystal Structure Of Fused N-Terminal 2e-06
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 1e-04
2omu_A 462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 2e-04
2omz_A 466 Crystal Structure Of Inla Y369a/hec1 Complex Length 1e-04
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 2e-04
2omv_A 461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 2e-04
2omt_A 462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 2e-04
3j0a_A 844 Homology Model Of Human Toll-Like Receptor 5 Fitted 2e-04
2omx_A 462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 2e-04
2omy_A 461 Crystal Structure Of Inla S192n/hec1 Complex Length 2e-04
4fmz_A347 Crystal Structure Of An Internalin (Inlf) From List 2e-04
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 3e-04
1o6s_A 466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 3e-04
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 5e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure 
Iteration: 1

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 81/289 (28%), Positives = 120/289 (41%), Gaps = 55/289 (19%)
Query: 70  GDYRVVTELEVYAVSIVGPFPIAVTNLLDLTRLDLHNNKLTGPIPPQIGRLKRLRILNLR 129
           GD   +  L++    + G F  A++   +L  L++ +N+  GPIPP    LK L+ L+L 
Sbjct: 220 GDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLKSLQYLSLA 277
Query: 130 WNKLQDVIPAEI-GELKRLTHLSLS------------------------FNNFKGEIPKE 164
            NK    IP  + G    LT L LS                         NNF GE+P +
Sbjct: 278 ENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMD 337
Query: 165 -IANLPELRYLYLQENRLTGRIPPELGILP-NFRHLDVGNNHLVG------------TIR 210
            +  +  L+ L L  N  +G +P  L  L  +   LD+ +N+  G            T++
Sbjct: 338 TLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQ 397
Query: 211 ELIRFEGSFPVXXXXXXXXXXXTGGVPAQLANLTNLEILYLSHNKMSGTIPLALAHIPKL 270
           EL      F             TG +P  L+N + L  L+LS N +SGTIP +L  + KL
Sbjct: 398 ELYLQNNGF-------------TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKL 444
Query: 271 TYLYLDHNQFSGRIPDAFYKHPFLKEMYIEGNAFRPGVNPIGIHKVLEL 319
             L L  N   G IP        L+ + ++ N    G  P G+     L
Sbjct: 445 RDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLT-GEIPSGLSNCTNL 492
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|1H6U|A Chain A, Internalin H: Crystal Structure Of Fused N-Terminal Domains Length = 308 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|4FMZ|A Chain A, Crystal Structure Of An Internalin (Inlf) From Listeria Monocytogenes Str. 4b F2365 At 1.91 A Resolution Length = 347 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query326
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-78
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-48
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-62
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-62
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-59
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-59
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-54
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-53
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-53
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-34
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-29
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-49
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-45
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-42
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-40
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-40
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-38
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-32
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-29
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-20
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-15
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-48
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-47
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-45
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-45
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-42
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-42
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-42
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-41
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-40
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-40
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-36
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-31
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-23
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-47
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-44
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-42
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-40
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-37
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-35
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-32
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-29
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-26
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-42
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-37
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-31
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-19
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-42
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-41
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-39
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-39
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-36
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-35
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-28
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-25
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-41
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-39
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-38
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-36
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-34
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-34
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-29
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-25
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-39
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-36
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-35
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-34
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-32
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-32
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-27
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-23
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-16
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-39
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-35
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-25
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-37
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-35
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-33
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-37
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-33
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-25
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-20
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-19
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-15
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-36
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-36
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-24
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 3e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-34
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-31
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-30
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-27
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-23
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-34
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-33
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-33
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-29
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-26
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-23
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-33
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-32
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-30
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-28
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-27
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-22
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-20
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-20
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-32
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-29
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-25
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-22
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 1e-18
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 7e-32
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-30
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-32
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-29
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-24
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-23
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-22
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-22
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-21
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-19
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-31
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-31
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-31
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-19
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-31
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-30
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-20
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-14
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-31
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-31
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-30
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-30
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-30
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-31
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 6e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-25
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-24
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-19
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-30
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-28
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-24
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-22
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-18
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-17
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-12
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 9e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-30
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-28
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-22
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 1e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-29
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-28
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-10
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-29
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-26
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-29
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-24
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 7e-29
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-26
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-26
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-25
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-21
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-21
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-18
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-28
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-25
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-28
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-19
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-28
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-17
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-15
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-15
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-12
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-28
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-23
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-22
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 5e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-10
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 2e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-27
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-26
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-27
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-24
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-24
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-23
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-14
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-26
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-26
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-26
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-26
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-19
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-26
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-24
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-19
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-25
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-16
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-15
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-13
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-11
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-10
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-24
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-23
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-22
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-16
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-09
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-24
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 9e-19
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-11
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 7e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-24
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-24
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-23
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-17
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-23
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-22
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 8e-04
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-22
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-20
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-13
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-22
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-18
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-15
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-18
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-17
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-17
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-15
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-15
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-14
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-16
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-16
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-14
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-12
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-12
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-15
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-13
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-15
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-12
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-12
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-13
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-11
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-13
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-12
3rfs_A 272 Internalin B, repeat modules, variable lymphocyte 2e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-12
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-12
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-11
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-10
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-11
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 9e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-11
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 9e-11
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 8e-09
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 8e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-10
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-10
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 6e-09
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-08
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 9e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 4e-08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 9e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 6e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 6e-08
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 7e-06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 7e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-06
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 3e-05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 3e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-04
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 5e-04
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 5e-04
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 8e-04
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 7e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  240 bits (614), Expect = 4e-78
 Identities = 75/283 (26%), Positives = 123/283 (43%), Gaps = 15/283 (5%)

Query: 28  DVKALNEIKASLG-WRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIV 86
           D +AL +IK  LG    + +W+    C +     W GV C T      V  L++  +++ 
Sbjct: 7   DKQALLQIKKDLGNPTTLSSWLPTTDCCNRT---WLGVLCDTDTQTYRVNNLDLSGLNLP 63

Query: 87  GPFPI--AVTNLLDLTRLDLHN-NKLTGPIPPQIGRLKRLRILNLRWNKLQDVIPAEIGE 143
            P+PI  ++ NL  L  L +   N L GPIPP I +L +L  L +    +   IP  + +
Sbjct: 64  KPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQ 123

Query: 144 LKRLTHLSLSFNNFKGEIPKEIANLPELRYLYLQENRLTGRIPPELGILPN-FRHLDVGN 202
           +K L  L  S+N   G +P  I++LP L  +    NR++G IP   G     F  + +  
Sbjct: 124 IKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISR 183

Query: 203 NHLVGTI-RELIRFEGSFPVLRNLYLNNNYLTGGVPAQLANLTNLEILYLSHNKMSGTIP 261
           N L G I             L  + L+ N L G       +  N + ++L+ N ++  + 
Sbjct: 184 NRLTGKIPPTFANLN-----LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG 238

Query: 262 LALAHIPKLTYLYLDHNQFSGRIPDAFYKHPFLKEMYIEGNAF 304
             +     L  L L +N+  G +P    +  FL  + +  N  
Sbjct: 239 -KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNL 280
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query326
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.98
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.97
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.97
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.97
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.97
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.96
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.96
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.96
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.96
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.96
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.96
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.95
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.95
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.95
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.95
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.95
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.94
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.93
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.93
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.93
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.93
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.93
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.92
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.92
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.92
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.92
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.92
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.91
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.91
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.91
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.91
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.91
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.9
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.9
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.89
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.89
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.88
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.88
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.87
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.87
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.87
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.87
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.86
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.85
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.84
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.84
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.84
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.84
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.84
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.84
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.83
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.83
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.82
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.82
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.81
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.81
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.81
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.79
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.77
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.77
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.77
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.76
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.76
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.74
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.73
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.73
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.73
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.72
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.72
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.71
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.71
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.69
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.68
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.67
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.66
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.64
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.62
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.62
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.6
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.59
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.59
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.58
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.54
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.53
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.52
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.5
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.5
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.49
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.44
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.43
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.42
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.3
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.28
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.21
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.81
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.81
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.8
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.77
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.64
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.58
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.41
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.39
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.38
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.38
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.32
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.07
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.83
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.44
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.3
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.83
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=100.00  E-value=6e-43  Score=308.65  Aligned_cols=292  Identities=26%  Similarity=0.458  Sum_probs=261.2

Q ss_pred             cCCHHHHHHHHHHHHhcCCC-CCCCCCC-CCCCCCCCCCCceeeEcCCCCCcceEEEEEecCCcccc--cCcccccCCCC
Q 020398           23 KTLKRDVKALNEIKASLGWR-VVYAWVG-DDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVG--PFPIAVTNLLD   98 (326)
Q Consensus        23 ~~~~~~~~al~~~~~~~~~~-~~~~w~~-~~~C~~~~~~~w~~v~c~~~~~~~~l~~L~l~~~~l~~--~~~~~~~~l~~   98 (326)
                      .+.++|.+||++||++++.. .+.+|.. .++|.    +.|.||.|+......+++.|+++++.+.+  .+|..+.++++
T Consensus         2 ~c~~~~~~aL~~~k~~~~~~~~l~~W~~~~~~C~----~~w~gv~C~~~~~~~~l~~L~L~~~~l~~~~~~~~~l~~l~~   77 (313)
T 1ogq_A            2 LCNPQDKQALLQIKKDLGNPTTLSSWLPTTDCCN----RTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPY   77 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCGGGTTCCTTSCTTT----TCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGCTT
T ss_pred             CCCHHHHHHHHHHHHhcCCcccccCCCCCCCCCc----CCCcceEeCCCCCCceEEEEECCCCCccCCcccChhHhCCCC
Confidence            46778999999999998642 4678964 35662    24999999865433579999999999999  89999999999


Q ss_pred             CCEEEccC-CcccCCCCccccCCCCCcEEEeecccCCccCchhhcCCCCCCEEECccCcCCCCchhhcCCCCCCceeecc
Q 020398           99 LTRLDLHN-NKLTGPIPPQIGRLKRLRILNLRWNKLQDVIPAEIGELKRLTHLSLSFNNFKGEIPKEIANLPELRYLYLQ  177 (326)
Q Consensus        99 L~~L~L~~-n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~  177 (326)
                      |++|++++ |.+.+.+|..|+++++|++|++++|.+++.+|..+.++++|++|++++|.+++.+|..+..+++|++|+++
T Consensus        78 L~~L~L~~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L~  157 (313)
T 1ogq_A           78 LNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFD  157 (313)
T ss_dssp             CSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECC
T ss_pred             CCeeeCCCCCcccccCChhHhcCCCCCEEECcCCeeCCcCCHHHhCCCCCCEEeCCCCccCCcCChHHhcCCCCCeEECc
Confidence            99999995 99999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccCCCCCCccCCCCC-CCcEEEeecCcCcccchhhhhccCCCCcccEEEeecCcCCCCCchhhhCCCCCceeeeecCcC
Q 020398          178 ENRLTGRIPPELGILP-NFRHLDVGNNHLVGTIRELIRFEGSFPVLRNLYLNNNYLTGGVPAQLANLTNLEILYLSHNKM  256 (326)
Q Consensus       178 ~n~l~~~~~~~l~~l~-~L~~L~l~~n~l~~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~l~~~~~L~~L~l~~n~l  256 (326)
                      +|.+++.+|..+..++ +|++|++++|.+.+..+..+.   .++ |++|++++|.+++..|..+..+++|++|++++|.+
T Consensus       158 ~N~l~~~~p~~l~~l~~~L~~L~L~~N~l~~~~~~~~~---~l~-L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~N~l  233 (313)
T 1ogq_A          158 GNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFA---NLN-LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSL  233 (313)
T ss_dssp             SSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGG---GCC-CSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEE
T ss_pred             CCcccCcCCHHHhhhhhcCcEEECcCCeeeccCChHHh---CCc-ccEEECcCCcccCcCCHHHhcCCCCCEEECCCCce
Confidence            9999999999999998 999999999999988887773   444 99999999999999999999999999999999999


Q ss_pred             CccchhhccCCCCCCEEecccccCCCcCcccccCCCCCcEEEeeCCcCCCCCCCcC---ccccccccCCc
Q 020398          257 SGTIPLALAHIPKLTYLYLDHNQFSGRIPDAFYKHPFLKEMYIEGNAFRPGVNPIG---IHKVLELTDTE  323 (326)
Q Consensus       257 ~~~~p~~l~~l~~L~~L~l~~n~l~~~~~~~l~~~~~L~~L~ls~N~l~~~~~~~~---~~~~l~l~~~~  323 (326)
                      ++.+|. +..+++|++|++++|.+++.+|..+..+++|++|++++|+++|.+|..+   ..+.+++.+|.
T Consensus       234 ~~~~~~-~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~ip~~~~l~~L~~l~l~~N~  302 (313)
T 1ogq_A          234 AFDLGK-VGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNK  302 (313)
T ss_dssp             CCBGGG-CCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCSTTGGGSCGGGTCSSS
T ss_pred             eeecCc-ccccCCCCEEECcCCcccCcCChHHhcCcCCCEEECcCCcccccCCCCccccccChHHhcCCC
Confidence            977776 7889999999999999999999999999999999999999998888753   34556676665
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 326
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-28
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-25
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-10
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-08
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-06
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-04
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-23
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-15
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-16
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-15
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-06
d1ozna_ 284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.003
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-15
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-12
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-09
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-11
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-11
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-10
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-09
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-09
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-08
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-10
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-10
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-09
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-09
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 5e-07
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 4e-06
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 1e-08
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 2e-08
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 8e-06
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 1e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 4e-07
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 3e-06
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 5e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-05
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-04
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.004
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 5e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 8e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1xwdc1 242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 2e-04
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score =  108 bits (270), Expect = 6e-28
 Identities = 75/308 (24%), Positives = 116/308 (37%), Gaps = 54/308 (17%)

Query: 27  RDVKALNEIKASLGW-RVVYAWV-GDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVS 84
           +D +AL +IK  LG    + +W+   D C       W GV C T      V  L++  ++
Sbjct: 6   QDKQALLQIKKDLGNPTTLSSWLPTTDCCNR----TWLGVLCDTDTQTYRVNNLDLSGLN 61

Query: 85  IVGPFPI--AVTNLLDLTRLDLHNN-KLTGPIPPQIGRLKRLRILNLRWNKLQDVIPAEI 141
           +  P+PI  ++ NL  L  L +     L GPIPP I +L +L  L +    +   IP  +
Sbjct: 62  LPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFL 121

Query: 142 GELKRLTHLSLSFNNFKGEIPKEIANLPELRYLYLQENRLTGRIPPELGILPN-FRHLDV 200
            ++K L  L  S+N   G +P  I++LP L  +    NR++G IP   G     F  + +
Sbjct: 122 SQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTI 181

Query: 201 GNNHLVGTIRELIRFEGSFPVLRNLY---------------------------------- 226
             N L G I           V  +                                    
Sbjct: 182 SRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKVG 241

Query: 227 ---------LNNNYLTGGVPAQLANLTNLEILYLSHNKMSGTIPLALAHIPKLTYLYLDH 277
                    L NN + G +P  L  L  L  L +S N + G IP    ++ +       +
Sbjct: 242 LSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIP-QGGNLQRFDVSAYAN 300

Query: 278 NQFSGRIP 285
           N+     P
Sbjct: 301 NKCLCGSP 308
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query326
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.93
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.89
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.88
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.86
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.82
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.8
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.8
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.79
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.78
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.78
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.77
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.75
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.69
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.65
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.65
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.62
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.61
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.6
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.58
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.57
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.57
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.56
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.49
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.4
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.37
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.36
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.35
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.31
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.32
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.29
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.29
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.05
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.81
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.5
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=4e-41  Score=294.97  Aligned_cols=292  Identities=26%  Similarity=0.460  Sum_probs=258.6

Q ss_pred             CCHHHHHHHHHHHHhcCC-CCCCCCC-CCCCCCCCCCCCceeeEcCCCCCcceEEEEEecCCcccc--cCcccccCCCCC
Q 020398           24 TLKRDVKALNEIKASLGW-RVVYAWV-GDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVG--PFPIAVTNLLDL   99 (326)
Q Consensus        24 ~~~~~~~al~~~~~~~~~-~~~~~w~-~~~~C~~~~~~~w~~v~c~~~~~~~~l~~L~l~~~~l~~--~~~~~~~~l~~L   99 (326)
                      +.++|++||++||+++.. ..+.+|. ++|||.    +.|.||+|+..+...+|+.|+++++.+.|  .+|.+++++++|
T Consensus         3 c~~~e~~aLl~~k~~~~~~~~l~sW~~~~d~C~----~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~L   78 (313)
T d1ogqa_           3 CNPQDKQALLQIKKDLGNPTTLSSWLPTTDCCN----RTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYL   78 (313)
T ss_dssp             SCHHHHHHHHHHHHHTTCCGGGTTCCTTSCTTT----TCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGCTTC
T ss_pred             CCHHHHHHHHHHHHHCCCCCcCCCCCCCCCCCC----CcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCCChHHhcCccc
Confidence            568899999999999864 3467895 457774    25999999987777789999999999987  578999999999


Q ss_pred             CEEEccC-CcccCCCCccccCCCCCcEEEeecccCCccCchhhcCCCCCCEEECccCcCCCCchhhcCCCCCCceeeccc
Q 020398          100 TRLDLHN-NKLTGPIPPQIGRLKRLRILNLRWNKLQDVIPAEIGELKRLTHLSLSFNNFKGEIPKEIANLPELRYLYLQE  178 (326)
Q Consensus       100 ~~L~L~~-n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~  178 (326)
                      ++|+|++ |+++|.+|..++++++|++|++++|++.+..+..+..+.+|+++++++|.+.+.+|..+.++++++++++++
T Consensus        79 ~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~  158 (313)
T d1ogqa_          79 NFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDG  158 (313)
T ss_dssp             SEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCS
T ss_pred             cccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCcccceeeccc
Confidence            9999997 899999999999999999999999999999899999999999999999999999999999999999999999


Q ss_pred             ccCCCCCCccCCCCCCC-cEEEeecCcCcccchhhhhccCCCCcccEEEeecCcCCCCCchhhhCCCCCceeeeecCcCC
Q 020398          179 NRLTGRIPPELGILPNF-RHLDVGNNHLVGTIRELIRFEGSFPVLRNLYLNNNYLTGGVPAQLANLTNLEILYLSHNKMS  257 (326)
Q Consensus       179 n~l~~~~~~~l~~l~~L-~~L~l~~n~l~~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~l~~~~~L~~L~l~~n~l~  257 (326)
                      |.+.+.+|..+..+.++ +.+++++|++++..+..+.   .+ ....+++..+...+.+|..+..+++++.+++++|.+.
T Consensus       159 n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~---~l-~~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~  234 (313)
T d1ogqa_         159 NRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFA---NL-NLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLA  234 (313)
T ss_dssp             SCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGG---GC-CCSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEEC
T ss_pred             ccccccccccccccccccccccccccccccccccccc---cc-ccccccccccccccccccccccccccccccccccccc
Confidence            99999999999888876 8899999999988877663   33 4557999999999999999999999999999999998


Q ss_pred             ccchhhccCCCCCCEEecccccCCCcCcccccCCCCCcEEEeeCCcCCCCCCCcC---ccccccccCCcc
Q 020398          258 GTIPLALAHIPKLTYLYLDHNQFSGRIPDAFYKHPFLKEMYIEGNAFRPGVNPIG---IHKVLELTDTEF  324 (326)
Q Consensus       258 ~~~p~~l~~l~~L~~L~l~~n~l~~~~~~~l~~~~~L~~L~ls~N~l~~~~~~~~---~~~~l~l~~~~~  324 (326)
                      +.+| .+..+++|++|++++|+++|.+|+.++++++|++|+|++|+|+|.+|..+   .++.+++++|.+
T Consensus       235 ~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~~~L~~L~~l~l~~N~~  303 (313)
T d1ogqa_         235 FDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKC  303 (313)
T ss_dssp             CBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCSTTGGGSCGGGTCSSSE
T ss_pred             cccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCcccCCCCCHHHhCCCcc
Confidence            7766 58888999999999999999999999999999999999999999888754   444566777753
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure