Citrus Sinensis ID: 020453


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320------
MDSASIPPKCPFGYDAQSFKIGPLSCMICQALLFECSKCTPCSHVYCKACISRFKDCPLCGADIEKIEADTTLQDVVDRFIEGHARIKRSHTNSDKEEDEAGENKKVIYEDVSMERGAFLVQQAMRAFRAQNVESAKSRLSLCTEDIRDQIERMGNTSELCSQLGAVLGMLGDCCRAMGDADAAVAYFADSVEFLMKLPMDDLEIIHTLSVSLNKIGDLKYYGGDLQAARSYYVRSLNVRRDAVKRHSNVPSQVLDVAVSLAKVADVDRSIGNEDVAVDGFQEAIKRLESLTLKPEEAGLEQRCWNSSTTNFQKNHLNQLPKFRSA
cccccccccccccccccccccccEEcccccccccccccccccccccHHHHHHcccccccccHHHHHccccHHHHHHHHHHHcccHHHHcccccccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccccHHcHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccHHHHcc
ccccccccccccccccccccccccEEHHHHHHHHcHccccccHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHcccHHccccccccHHHHHccccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHccHHHHHHHHHHHHHHHHHccccccHHHEEEEEEHcccccHHHHccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccHcHHHHHHHHHHHHHHHHHHHHcccccccc
mdsasippkcpfgydaqsfkigplsCMICQALLfecskctpcshvyckacisrfkdcplcgadiekieadTTLQDVVDRFIEGHARIkrshtnsdkeedeagenkkVIYEDVSMERGAFLVQQAMRAFRAQNVESAKSRLSLCTEDIRDQIERMGNTSELCSQLGAVLGMLGDCCRAMGDADAAVAYFADSVEFLMKLPMDDLEIIHTLSVSLNKigdlkyyggdlQAARSYYVRSLNVRRdavkrhsnvpsQVLDVAVSLAKVAdvdrsignedvaVDGFQEAIKRLESltlkpeeagleqrcwnssttnfqknhlnqlpkfrsa
mdsasippkcpfGYDAQSFKIGPLSCMICQALLFECSKCTPCSHVYCKACISRFKDCPLCGADIEKIEADTTLQDVVDRFIEGHarikrshtnsdkeedeagenkkviyeDVSMERGAFLVQQAMRAFRAQNvesaksrlslCTEDIRDQIERMGNTSELCSQLGAVLGMLGDCCRAMGDADAAVAYFADSVEFLMKLPMDDLEIIHTLSVSLNKIGDLKYYGGDLQAARSYYVRSLNVRRDavkrhsnvpsqvlDVAVSLAKVADVDRSIGNEDVAVDGFQEAIKRLESLTLKPEEAGLEqrcwnssttnfqknhlnqlpkfrsa
MDSASIPPKCPFGYDAQSFKIGPLSCMICQALLFECSKCTPCSHVYCKACISRFKDCPLCGADIEKIEADTTLQDVVDRFIEGHARIKRSHTNSDKEEDEAGENKKVIYEDVSMERGAFLVQQAMRAFRAQNVESAKSRLSLCTEDIRDQIERMGNTSELCSQLGAVLGMLGDCCRAMGDADAAVAYFADSVEFLMKLPMDDLEIIHTLSVSLNKIGDLKYYGGDLQAARSYYVRSLNVRRDAVKRHSNVPSQVLDVAVSLAKVADVDRSIGNEDVAVDGFQEAIKRLESLTLKPEEAGLEQRCWNSSTTNFQKNHLNQLPKFRSA
*********CPFGYDAQSFKIGPLSCMICQALLFECSKCTPCSHVYCKACISRFKDCPLCGADIEKIEADTTLQDVVDRFIEGHA*********************VIYEDVSMERGAFLVQQAMRAFRAQ********LSLCTEDIRDQIERMGNTSELCSQLGAVLGMLGDCCRAMGDADAAVAYFADSVEFLMKLPMDDLEIIHTLSVSLNKIGDLKYYGGDLQAARSYYVRSLNVRRDAVKRHSNVPSQVLDVAVSLAKVADVDRSIGNEDVAVDGFQEAIKRLESLT**********************************
*****************SFKIGPLSCMICQALLFECSKCTPCSHVYCKACISRFKDCPLCGADIEKIEADTTLQDVVDRFIEGHARIKRSHTNSDKEEDEAGENKKVIYEDVSMERGAFLVQQAMRAFRAQNVESAKSRLSLCTEDIRDQIERMGNTSELCSQLGAVLGMLGDCCRAMGDADAAVAYFADSVEFLMKLPMDDLEIIHTLSVSLNKIGDLKYYGGDLQAARSYYVRSLNVRRDAVKRHSNVPSQVLDVAVSLAKVADVDRSIGNEDVAVDGFQEAIKRLESLTLKPEEAGLEQRCWNSSTTNFQKNHLNQ*******
MDSASIPPKCPFGYDAQSFKIGPLSCMICQALLFECSKCTPCSHVYCKACISRFKDCPLCGADIEKIEADTTLQDVVDRFIEGHARIKR*************ENKKVIYEDVSMERGAFLVQQAMRAFRAQNVESAKSRLSLCTEDIRDQIERMGNTSELCSQLGAVLGMLGDCCRAMGDADAAVAYFADSVEFLMKLPMDDLEIIHTLSVSLNKIGDLKYYGGDLQAARSYYVRSLNVRRDAVKRHSNVPSQVLDVAVSLAKVADVDRSIGNEDVAVDGFQEAIKRLESLTLKPEEAGLEQRCWNSSTTNFQKNHLNQLPKFRSA
*****IPPKCPFGYDAQSFKIGPLSCMICQALLFECSKCTPCSHVYCKACISRFKDCPLCGADIEKIEADTTLQDVVDRFIEGHA******************NKKVIYEDVSMERGAFLVQQAMRAFRAQNVESAKSRLSLCTEDIRDQIERMGNTSELCSQLGAVLGMLGDCCRAMGDADAAVAYFADSVEFLMKLPMDDLEIIHTLSVSLNKIGDLKYYGGDLQAARSYYVRSLNVRRDAVKRHSNVPSQVLDVAVSLAKVADVDRSIGNEDVAVDGFQEAIKRLESLTLKPEEAGLEQRCWNSSTTNFQKNHLNQ*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSASIPPKCPFGYDAQSFKIGPLSCMICQALLFECSKCTPCSHVYCKACISRFKDCPLCGADIEKIEADTTLQDVVDRFIEGHARIKRSHTNSDKEEDEAGENKKVIYEDVSMERGAFLVQQAMRAFRAQNVESAKSRLSLCTEDIRDQIERMGNTSELCSQLGAVLGMLGDCCRAMGDADAAVAYFADSVEFLMKLPMDDLEIIHTLSVSLNKIGDLKYYGGDLQAARSYYVRSLNVRRDAVKRHSNVPSQVLDVAVSLAKVADVDRSIGNEDVAVDGFQEAIKRLESLTLKPEEAGLEQRCWNSSTTNFQKNHLNQLPKFRSA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query326 2.2.26 [Sep-21-2011]
Q5FWP4625 E3 ubiquitin-protein liga N/A no 0.260 0.136 0.309 2e-07
A5WW08637 E3 ubiquitin-protein liga yes no 0.205 0.105 0.338 8e-07
Q810L3664 E3 ubiquitin-protein liga yes no 0.205 0.100 0.352 2e-06
Q6P256626 E3 ubiquitin-protein liga yes no 0.205 0.107 0.352 2e-06
Q96EP1664 E3 ubiquitin-protein liga yes no 0.205 0.100 0.352 2e-06
Q5RF77571 E3 ubiquitin-protein liga yes no 0.205 0.117 0.352 3e-06
Q640D5323 Polycomb complex protein N/A no 0.269 0.272 0.265 5e-06
Q91648326 Polycomb complex protein N/A no 0.269 0.269 0.309 7e-06
Q5SDR3326 Polycomb complex protein no no 0.269 0.269 0.300 2e-05
Q8JIR0320 Polycomb complex protein no no 0.269 0.275 0.256 2e-05
>sp|Q5FWP4|CHFR_XENLA E3 ubiquitin-protein ligase CHFR OS=Xenopus laevis GN=chfr PE=1 SV=1 Back     alignment and function desciption
 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 12/97 (12%)

Query: 6   IPPKCPFGY--DAQSFKIGP------LSCMICQALLFECSKCTPCSHVYCKACISRFKD- 56
           +P  CP G   ++++  + P      L+C+ICQ LL +C    PC H +C AC S + + 
Sbjct: 238 VPASCPIGASDESKTPSMKPDKMEETLTCIICQELLHDCVSLQPCMHTFCAACYSGWMER 297

Query: 57  ---CPLCGADIEKIEADTTLQDVVDRFIEGHARIKRS 90
              CP C   +E+I  +  L ++V+ ++  H    RS
Sbjct: 298 SSLCPTCRCPVERICKNHILNNLVEAYLIQHPEKCRS 334




E3 ubiquitin-protein ligase that functions in the antephase checkpoint by actively delaying passage into mitosis in response to microtubule poisons. Acts in early prophase before chromosome condensation, when the centrosome move apart from each other along the periphery of the nucleus. Probably involved in signaling the presence of mitotic stress caused by microtubule poisons by mediating the 'Lys-48'-linked ubiquitination of target proteins, leading to their degradation by the proteasome. May also promote the formation of 'Lys-63'-linked polyubiquitin chains and functions with the specific ubiquitin-conjugating ubc13-mms2 (ube2n-ube2v2) heterodimer. Substrates that are polyubiquitinated at 'Lys-63' are usually not targeted for degradation, but are rather involved in signaling cellular stress.
Xenopus laevis (taxid: 8355)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|A5WW08|CHFR_DANRE E3 ubiquitin-protein ligase CHFR OS=Danio rerio GN=chfr PE=2 SV=1 Back     alignment and function description
>sp|Q810L3|CHFR_MOUSE E3 ubiquitin-protein ligase CHFR OS=Mus musculus GN=Chfr PE=1 SV=1 Back     alignment and function description
>sp|Q6P256|CHFR_XENTR E3 ubiquitin-protein ligase CHFR OS=Xenopus tropicalis GN=chfr PE=2 SV=1 Back     alignment and function description
>sp|Q96EP1|CHFR_HUMAN E3 ubiquitin-protein ligase CHFR OS=Homo sapiens GN=CHFR PE=1 SV=2 Back     alignment and function description
>sp|Q5RF77|CHFR_PONAB E3 ubiquitin-protein ligase CHFR OS=Pongo abelii GN=CHFR PE=2 SV=1 Back     alignment and function description
>sp|Q640D5|BMI1B_XENLA Polycomb complex protein BMI-1-B OS=Xenopus laevis GN=bmi1b PE=2 SV=1 Back     alignment and function description
>sp|Q91648|BMI1A_XENLA Polycomb complex protein BMI-1-A OS=Xenopus laevis GN=bmi1a PE=1 SV=1 Back     alignment and function description
>sp|Q5SDR3|BMI1_CHICK Polycomb complex protein BMI-1 OS=Gallus gallus GN=BMI1 PE=2 SV=1 Back     alignment and function description
>sp|Q8JIR0|BMI1A_DANRE Polycomb complex protein BMI-1-A OS=Danio rerio GN=bmi1a PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query326
118489075363 unknown [Populus trichocarpa x Populus d 0.966 0.867 0.798 1e-144
224075908353 predicted protein [Populus trichocarpa] 0.923 0.852 0.827 1e-143
224053090363 predicted protein [Populus trichocarpa] 0.920 0.826 0.817 1e-143
296085428394 unnamed protein product [Vitis vinifera] 0.926 0.766 0.801 1e-143
225465383369 PREDICTED: uncharacterized protein LOC10 0.926 0.818 0.801 1e-142
356508245367 PREDICTED: uncharacterized protein LOC10 0.957 0.850 0.787 1e-141
356517714367 PREDICTED: uncharacterized protein LOC10 0.957 0.850 0.781 1e-138
255569221392 ubiquitin-protein ligase, putative [Rici 0.957 0.795 0.752 1e-135
449458710404 PREDICTED: uncharacterized protein LOC10 0.926 0.747 0.741 1e-132
297820180415 binding protein [Arabidopsis lyrata subs 0.926 0.727 0.728 1e-130
>gi|118489075|gb|ABK96344.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
 Score =  516 bits (1328), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 254/318 (79%), Positives = 276/318 (86%), Gaps = 3/318 (0%)

Query: 2   DSASIPPKCPFGYDAQSFKIGPLSCMICQALLFECSKCTPCSHVYCKACISRFKDCPLCG 61
           +SA++ PKCPFGYD+Q+FK+GPLSCMICQALLF+CSKC PCSHVYCK CISRFKDCPLCG
Sbjct: 45  ESATVSPKCPFGYDSQTFKLGPLSCMICQALLFDCSKCVPCSHVYCKVCISRFKDCPLCG 104

Query: 62  ADIEKIEADTTLQDVVDRFIEGHARIKRSHTNSDKEEDEAGENKKVIYEDVSMERGAFLV 121
           AD+EKIEADT LQ VVDRFI+GHARIKRSH + DKE  EAGENKKVIYEDVS+ERGAFLV
Sbjct: 105 ADVEKIEADTDLQSVVDRFIDGHARIKRSHVDMDKE-GEAGENKKVIYEDVSLERGAFLV 163

Query: 122 QQAMRAFRAQNVESAKSRLSLCTEDIRDQIERMGNTSELCSQLGAVLGMLGDCCRAMGDA 181
           QQAMRAFRAQNVESAKSRLSLC EDIR +IE +GNTSELCSQLGAVLGMLGDCCRA+GDA
Sbjct: 164 QQAMRAFRAQNVESAKSRLSLCAEDIRGRIETVGNTSELCSQLGAVLGMLGDCCRAVGDA 223

Query: 182 DAAVAYFADSVEFLMKLPMDDLEIIHTLSVSLNKIGDLKYYGGDLQAARSYYVRSLNVRR 241
            +AV YF +SVEFL KL   DLEI HT SVSLNKIGDLKYY GDL+AARSYY+RSLNVRR
Sbjct: 224 GSAVTYFEESVEFLSKLAAADLEITHTHSVSLNKIGDLKYYDGDLEAARSYYMRSLNVRR 283

Query: 242 DAVKRHSNVPSQVLDVAVSLAKVADVDRSIGNEDVAVDGFQEAIKRLESLTLKPEEAGLE 301
           DA+K H +V SQ LDVAVSLAKVAD DRSIGNED A+D F EAIK LESLTLKPEEAGLE
Sbjct: 284 DAIKHHPSVSSQTLDVAVSLAKVADADRSIGNEDAALDRFHEAIKLLESLTLKPEEAGLE 343

Query: 302 QRCWNSSTTNFQKNHLNQ 319
           QR    S   F  N L +
Sbjct: 344 QR--RLSVLEFLNNQLAE 359




Source: Populus trichocarpa x Populus deltoides

Species: Populus trichocarpa x Populus deltoides

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224075908|ref|XP_002304823.1| predicted protein [Populus trichocarpa] gi|222842255|gb|EEE79802.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224053090|ref|XP_002297702.1| predicted protein [Populus trichocarpa] gi|222844960|gb|EEE82507.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296085428|emb|CBI29160.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225465383|ref|XP_002276838.1| PREDICTED: uncharacterized protein LOC100262520 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356508245|ref|XP_003522869.1| PREDICTED: uncharacterized protein LOC100813258 [Glycine max] Back     alignment and taxonomy information
>gi|356517714|ref|XP_003527531.1| PREDICTED: uncharacterized protein LOC100813844 [Glycine max] Back     alignment and taxonomy information
>gi|255569221|ref|XP_002525579.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223535158|gb|EEF36838.1| ubiquitin-protein ligase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449458710|ref|XP_004147090.1| PREDICTED: uncharacterized protein LOC101210945 [Cucumis sativus] gi|449503311|ref|XP_004161939.1| PREDICTED: uncharacterized LOC101210945 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297820180|ref|XP_002877973.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297323811|gb|EFH54232.1| binding protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query326
TAIR|locus:2096179405 AT3G54360 [Arabidopsis thalian 0.926 0.745 0.725 2.9e-119
UNIPROTKB|Q5T8Z4150 BMI1 "Polycomb complex protein 0.196 0.426 0.32 1.9e-06
UNIPROTKB|Q5T8Z592 BMI1 "Polycomb complex protein 0.196 0.695 0.32 1.9e-06
UNIPROTKB|Q5T8Z6105 BMI1 "Polycomb complex protein 0.196 0.609 0.32 1.9e-06
ZFIN|ZDB-GENE-030131-3522637 chfr "checkpoint with forkhead 0.242 0.124 0.325 2.5e-06
UNIPROTKB|Q5FWP4625 chfr "E3 ubiquitin-protein lig 0.260 0.136 0.319 5.3e-06
UNIPROTKB|F5GWT6349 CHFR "E3 ubiquitin-protein lig 0.242 0.226 0.325 5.7e-06
UNIPROTKB|E1BBP0663 CHFR "Uncharacterized protein" 0.383 0.188 0.284 9.7e-06
MGI|MGI:2444898664 Chfr "checkpoint with forkhead 0.438 0.215 0.277 1.2e-05
UNIPROTKB|Q5RF77571 CHFR "E3 ubiquitin-protein lig 0.242 0.138 0.325 1.3e-05
TAIR|locus:2096179 AT3G54360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1174 (418.3 bits), Expect = 2.9e-119, P = 2.9e-119
 Identities = 219/302 (72%), Positives = 258/302 (85%)

Query:     2 DSASIPPKCPFGYDAQSFKIGPLSCMICQALLFECSKCTPCSHVYCKACISRFKDCPLCG 61
             DSA++P KCPFGYD+Q+FK+GP SCM+CQALL+E S+C PC+HV+CK C++RFKDCPLCG
Sbjct:    84 DSATVPAKCPFGYDSQTFKLGPFSCMLCQALLYESSRCVPCTHVFCKVCLTRFKDCPLCG 143

Query:    62 ADIEKIEADTTLQDVVDRFIEGHARIKRSHTNSDKEEDEAGENKKVIYEDVSMERGAFLV 121
             ADIE IE D  LQ +VD+FIEGHARIKRS  N  ++E+   +NKKVIY DVSMERG+FLV
Sbjct:   144 ADIESIEVDENLQKMVDQFIEGHARIKRSVVNGTEKEEVENDNKKVIYADVSMERGSFLV 203

Query:   122 QQAMRAFRAQNVESAKSRLSLCTEDIRDQIERMGNTSELCSQLGAVLGMLGDCCRAMGDA 181
             QQAMRAF AQN ESAKSRL++CTEDIRDQ+ R GNT ELCSQLGAVLGMLGDC RAMGD+
Sbjct:   204 QQAMRAFSAQNYESAKSRLAMCTEDIRDQLGREGNTPELCSQLGAVLGMLGDCSRAMGDS 263

Query:   182 DAAVAYFADSVEFLMKLPMDDLEIIHTLSVSLNKIGDLKYYGGDLQAARSYYVRSLNVRR 241
              +AV +F +SVEFLMKLP++DLEI HTLSVSLNKIGDLKYY  DLQAARSYY R+LNVRR
Sbjct:   264 SSAVKHFEESVEFLMKLPLNDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYDRALNVRR 323

Query:   242 DAVKRHSNVPSQVLDVAVSLAKVADVDRSIGNEDVAVDGFQEAIKRLESLTLKPEEAGLE 301
             DA+K H N PSQ+LDVAVSLAKVAD+DR++ NE  A DGF+E ++ LESL L  E++ LE
Sbjct:   324 DAMKHHPNAPSQILDVAVSLAKVADIDRTLQNEVAATDGFKEGMRLLESLKLDSEDSALE 383

Query:   302 QR 303
             QR
Sbjct:   384 QR 385




GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
UNIPROTKB|Q5T8Z4 BMI1 "Polycomb complex protein BMI-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5T8Z5 BMI1 "Polycomb complex protein BMI-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5T8Z6 BMI1 "Polycomb complex protein BMI-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-3522 chfr "checkpoint with forkhead and ring finger domains, E3 ubiquitin protein ligase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5FWP4 chfr "E3 ubiquitin-protein ligase CHFR" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|F5GWT6 CHFR "E3 ubiquitin-protein ligase CHFR" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BBP0 CHFR "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:2444898 Chfr "checkpoint with forkhead and ring finger domains" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RF77 CHFR "E3 ubiquitin-protein ligase CHFR" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.20.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
grail3.0074014501
hypothetical protein (353 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query326
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 1e-07
cd0016245 cd00162, RING, RING-finger (Really Interesting New 8e-07
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 2e-06
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 1e-05
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 1e-05
smart0018440 smart00184, RING, Ring finger 1e-05
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 7e-04
TIGR00599397 TIGR00599, rad18, DNA repair protein rad18 0.003
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
 Score = 48.1 bits (115), Expect = 1e-07
 Identities = 22/80 (27%), Positives = 31/80 (38%), Gaps = 4/80 (5%)

Query: 163 QLGAVLGMLGDCCRAMGDADAAVAYFADSVEFLMKLPMDDLEIIHTLSVSLNKIGDLKYY 222
            L A L  L    R +GD D A+     ++E   +L  D  E        LN +  L   
Sbjct: 3   DLAAALNNLALVLRRLGDYDEALELLEKALELARELGEDHPETARA----LNNLARLYLA 58

Query: 223 GGDLQAARSYYVRSLNVRRD 242
            GD   A  Y  ++L +R  
Sbjct: 59  LGDYDEALEYLEKALALREA 78


Length = 78

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 326
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.29
KOG4367 699 consensus Predicted Zn-finger protein [Function un 99.19
KOG1840 508 consensus Kinesin light chain [Cytoskeleton] 99.03
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.0
TIGR00599397 rad18 DNA repair protein rad18. This family is bas 98.95
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.84
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.81
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.8
KOG2177386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.8
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.72
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.69
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.68
PHA02929238 N1R/p28-like protein; Provisional 98.65
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.63
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.62
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.59
PF1463444 zf-RING_5: zinc-RING finger domain 98.58
KOG1840 508 consensus Kinesin light chain [Cytoskeleton] 98.58
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.58
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.54
PHA02926242 zinc finger-like protein; Provisional 98.49
COG5432391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.47
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.46
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.41
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.26
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.22
KOG2660331 consensus Locus-specific chromosome binding protei 98.21
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 98.19
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.08
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.04
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.04
KOG2164513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.99
KOG0311381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.8
KOG4159398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.73
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 97.72
PF14938 282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.55
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.53
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 97.52
COG5152259 Uncharacterized conserved protein, contains RING a 97.46
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 97.45
KOG0824324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.37
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.37
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 97.36
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 97.19
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 97.15
KOG4185296 consensus Predicted E3 ubiquitin ligase [Posttrans 97.07
COG5222427 Uncharacterized conserved protein, contains RING Z 96.96
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.95
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 96.94
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 96.93
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 96.91
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.88
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.82
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.74
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 96.73
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 96.7
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.66
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.57
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.54
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.53
KOG0297391 consensus TNF receptor-associated factor [Signal t 96.39
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 96.39
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 96.35
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 96.22
PRK15359144 type III secretion system chaperone protein SscB; 96.14
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 96.12
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 96.08
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 96.05
PRK02603172 photosystem I assembly protein Ycf3; Provisional 95.94
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 95.82
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 95.77
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 95.66
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 95.52
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.45
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 95.38
KOG0825 1134 consensus PHD Zn-finger protein [General function 95.32
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 95.17
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 95.11
PRK11189296 lipoprotein NlpI; Provisional 95.05
KOG1002791 consensus Nucleotide excision repair protein RAD16 94.99
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 94.96
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 94.85
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 94.8
cd00189100 TPR Tetratricopeptide repeat domain; typically con 94.79
KOG0553304 consensus TPR repeat-containing protein [General f 94.71
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 94.6
KOG1126638 consensus DNA-binding cell division cycle control 94.58
TIGR02552135 LcrH_SycD type III secretion low calcium response 94.53
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 94.47
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 94.41
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 94.36
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 94.35
PRK11788389 tetratricopeptide repeat protein; Provisional 94.29
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 94.28
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 94.23
KOG2003 840 consensus TPR repeat-containing protein [General f 94.22
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 94.06
KOG3002299 consensus Zn finger protein [General function pred 93.77
KOG4739233 consensus Uncharacterized protein involved in syna 93.67
PRK11788 389 tetratricopeptide repeat protein; Provisional 93.66
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 93.54
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 93.46
KOG1125579 consensus TPR repeat-containing protein [General f 93.39
PRK15359144 type III secretion system chaperone protein SscB; 93.29
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 93.26
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 93.23
KOG4555175 consensus TPR repeat-containing protein [Function 93.2
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 93.1
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 93.03
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 92.95
PRK10370198 formate-dependent nitrite reductase complex subuni 92.93
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 92.88
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 92.75
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 92.64
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 92.59
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 92.58
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 92.54
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 92.49
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 92.35
KOG3800300 consensus Predicted E3 ubiquitin ligase containing 92.34
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 92.26
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 92.06
PF1286294 Apc5: Anaphase-promoting complex subunit 5 91.78
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 91.59
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 91.59
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 91.37
PF1337173 TPR_9: Tetratricopeptide repeat 91.31
cd00189100 TPR Tetratricopeptide repeat domain; typically con 91.25
KOG1001674 consensus Helicase-like transcription factor HLTF/ 91.23
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 91.04
KOG3039303 consensus Uncharacterized conserved protein [Funct 90.95
KOG2376 652 consensus Signal recognition particle, subunit Srp 90.81
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 90.78
PRK11189296 lipoprotein NlpI; Provisional 90.75
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 90.68
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 90.38
PRK10803263 tol-pal system protein YbgF; Provisional 90.33
PF06552186 TOM20_plant: Plant specific mitochondrial import r 90.28
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 90.19
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 90.12
PRK04841 903 transcriptional regulator MalT; Provisional 90.11
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 90.03
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 89.97
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 89.97
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 89.81
KOG1941 518 consensus Acetylcholine receptor-associated protei 89.73
KOG1129 478 consensus TPR repeat-containing protein [General f 89.61
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 89.61
KOG1129 478 consensus TPR repeat-containing protein [General f 89.41
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 89.19
KOG1125579 consensus TPR repeat-containing protein [General f 89.06
PRK10370198 formate-dependent nitrite reductase complex subuni 88.98
KOG1586288 consensus Protein required for fusion of vesicles 88.85
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 88.68
PRK04841 903 transcriptional regulator MalT; Provisional 88.57
KOG1585 308 consensus Protein required for fusion of vesicles 88.53
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 88.37
PRK12370 553 invasion protein regulator; Provisional 88.34
PF04641260 Rtf2: Rtf2 RING-finger 88.22
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 88.17
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 88.16
KOG2932389 consensus E3 ubiquitin ligase involved in ubiquiti 88.12
KOG0553 304 consensus TPR repeat-containing protein [General f 88.11
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 88.05
PRK12370553 invasion protein regulator; Provisional 87.99
PRK10803263 tol-pal system protein YbgF; Provisional 87.84
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 87.66
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 87.59
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 87.57
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 87.32
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 87.11
PF12688120 TPR_5: Tetratrico peptide repeat 87.1
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 86.72
COG5236 493 Uncharacterized conserved protein, contains RING Z 86.62
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 86.32
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 86.26
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 85.82
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 85.71
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 85.23
KOG1126638 consensus DNA-binding cell division cycle control 85.06
PF1342844 TPR_14: Tetratricopeptide repeat 84.95
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 83.91
KOG2003 840 consensus TPR repeat-containing protein [General f 83.52
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 83.42
KOG1941 518 consensus Acetylcholine receptor-associated protei 83.15
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 82.93
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 82.79
PF1337173 TPR_9: Tetratricopeptide repeat 82.56
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 82.32
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 82.05
KOG2076 895 consensus RNA polymerase III transcription factor 81.75
COG52191525 Uncharacterized conserved protein, contains RING Z 81.34
PF06552186 TOM20_plant: Plant specific mitochondrial import r 81.1
TIGR02552135 LcrH_SycD type III secretion low calcium response 80.98
PF0421269 MIT: MIT (microtubule interacting and transport) d 80.66
PF09986214 DUF2225: Uncharacterized protein conserved in bact 80.58
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 80.56
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 80.53
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 80.4
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 80.31
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
Probab=99.29  E-value=6e-13  Score=81.50  Aligned_cols=34  Identities=41%  Similarity=1.176  Sum_probs=28.1

Q ss_pred             cccccccccCCCeecccCCcchHHhHhcCCC--------CCCC
Q 020453           26 CMICQALLFECSKCTPCSHVYCKACISRFKD--------CPLC   60 (326)
Q Consensus        26 C~iC~~~l~~~p~~l~C~h~fC~~Cl~~~~~--------CP~C   60 (326)
                      ||||+++ +.+|++|+|||+||+.||.++|.        ||.|
T Consensus         1 CpiC~~~-~~~Pv~l~CGH~FC~~Cl~~~~~~~~~~~~~CP~C   42 (42)
T PF15227_consen    1 CPICLDL-FKDPVSLPCGHSFCRSCLERLWKEPSGSGFSCPEC   42 (42)
T ss_dssp             ETTTTSB--SSEEE-SSSSEEEHHHHHHHHCCSSSST---SSS
T ss_pred             CCccchh-hCCccccCCcCHHHHHHHHHHHHccCCcCCCCcCC
Confidence            8999999 57799999999999999998864        7776



>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query326
2h0d_A97 Structure Of A Bmi-1-Ring1b Polycomb Group Ubiquiti 3e-06
2ckl_A108 Ring1b-Bmi1 E3 Catalytic Domain Structure Length = 3e-06
3rpg_B117 Bmi1RING1B-Ubch5c Complex Structure Length = 117 1e-05
>pdb|2H0D|A Chain A, Structure Of A Bmi-1-Ring1b Polycomb Group Ubiquitin Ligase Complex Length = 97 Back     alignment and structure

Iteration: 1

Score = 49.3 bits (116), Expect = 3e-06, Method: Composition-based stats. Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 10/70 (14%) Query: 24 LSCMICQALLFECSKCTPCSHVYCKACISRF----KDCPLCGADIEK------IEADTTL 73 L C++C + + C H +CK CI R+ K CP+C + K I +D TL Sbjct: 12 LMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTL 71 Query: 74 QDVVDRFIEG 83 QD+V + + G Sbjct: 72 QDIVYKLVPG 81
>pdb|2CKL|A Chain A, Ring1b-Bmi1 E3 Catalytic Domain Structure Length = 108 Back     alignment and structure
>pdb|3RPG|B Chain B, Bmi1RING1B-Ubch5c Complex Structure Length = 117 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query326
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 1e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-06
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 6e-10
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 2e-09
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 2e-09
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 2e-09
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 3e-05
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 5e-09
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 4e-06
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 6e-06
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 1e-04
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 8e-04
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 9e-09
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 1e-08
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 1e-07
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 3e-06
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 5e-06
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 8e-06
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 5e-05
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 7e-04
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-08
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 7e-07
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-05
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 2e-05
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 2e-08
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 4e-08
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 5e-08
1z6u_A150 NP95-like ring finger protein isoform B; structura 1e-07
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 2e-07
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 3e-07
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 3e-07
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 4e-07
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 4e-07
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 6e-07
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 2e-06
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 6e-06
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 8e-06
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 3e-05
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 8e-06
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 9e-06
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 1e-05
3q15_A378 PSP28, response regulator aspartate phosphatase H; 1e-05
3q15_A 378 PSP28, response regulator aspartate phosphatase H; 2e-05
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 3e-05
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 3e-05
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 3e-05
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 4e-05
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 2e-04
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 2e-04
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 4e-05
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 6e-05
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 6e-05
3nw0_A238 Non-structural maintenance of chromosomes element 9e-05
2ysj_A63 Tripartite motif-containing protein 31; ring-type 1e-04
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 1e-04
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 2e-04
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 9e-04
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 2e-04
2ecw_A85 Tripartite motif-containing protein 30; metal bind 2e-04
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 2e-04
2ysl_A73 Tripartite motif-containing protein 31; ring-type 3e-04
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 4e-04
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 5e-04
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 7e-04
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 8e-04
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
 Score = 65.6 bits (160), Expect = 1e-13
 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 10/70 (14%)

Query: 24 LSCMICQALLFECSKCTPCSHVYCKACISRF----KDCPLCGADI------EKIEADTTL 73
          L C++C     + +    C H +CK CI R+    K CP+C   +        I +D TL
Sbjct: 16 LMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTL 75

Query: 74 QDVVDRFIEG 83
          QD+V + + G
Sbjct: 76 QDIVYKLVPG 85


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Length = 101 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query326
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.45
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.42
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.41
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.39
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.39
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.38
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.33
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.32
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.29
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.27
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.26
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.26
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.25
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.25
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.25
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.19
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.19
2f42_A179 STIP1 homology and U-box containing protein 1; cha 99.16
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.16
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.13
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.12
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.11
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.11
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.1
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.09
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.09
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.08
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.07
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.07
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.07
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.06
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.04
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 99.03
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.01
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.01
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.0
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.98
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.98
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.98
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.96
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.94
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.94
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.93
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.92
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.9
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.87
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.86
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.85
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.84
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.83
2ect_A78 Ring finger protein 126; metal binding protein, st 98.82
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.8
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.8
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.79
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.78
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.77
2ea5_A68 Cell growth regulator with ring finger domain prot 98.76
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.74
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.71
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.67
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.65
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.63
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.61
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.58
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.56
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.54
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.53
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.52
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.5
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.46
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.46
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.43
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.41
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.4
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.38
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.38
1qqe_A 292 Vesicular transport protein SEC17; helix-turn-heli 98.36
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 98.36
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.35
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.32
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.28
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.27
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.26
3edt_B 283 KLC 2, kinesin light chain 2; superhelical, struct 98.26
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 98.2
3q15_A 378 PSP28, response regulator aspartate phosphatase H; 98.19
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.19
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.17
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.16
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 98.14
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 98.13
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.09
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.07
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.06
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.06
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.03
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 98.0
4g1t_A 472 Interferon-induced protein with tetratricopeptide 98.0
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 97.96
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.95
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 97.94
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.92
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.92
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 97.9
4i17_A228 Hypothetical protein; TPR repeats protein, structu 97.88
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.84
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.8
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.8
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 97.74
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 97.71
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.63
4eqf_A365 PEX5-related protein; accessory protein, tetratric 97.61
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 97.6
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 97.57
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 97.54
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.52
4eqf_A365 PEX5-related protein; accessory protein, tetratric 97.5
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.49
4g1t_A 472 Interferon-induced protein with tetratricopeptide 97.48
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.48
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.44
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.43
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 97.43
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 97.38
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.37
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 97.35
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.32
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 97.31
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.29
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.26
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.24
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.2
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 97.2
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.18
4i17_A228 Hypothetical protein; TPR repeats protein, structu 97.16
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.11
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 97.11
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.1
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.09
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.08
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 97.08
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 97.07
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 97.02
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 97.01
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 97.0
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 97.0
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 96.99
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 96.98
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 96.97
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 96.96
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 96.95
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 96.94
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 96.93
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 96.93
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 96.93
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 96.92
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 96.91
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 96.91
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 96.89
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 96.89
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 96.89
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 96.88
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 96.87
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 96.87
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 96.86
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 96.86
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 96.86
3k9i_A117 BH0479 protein; putative protein binding protein, 96.83
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 96.81
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 96.8
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 96.79
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 96.78
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 96.77
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 96.75
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 96.75
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 96.73
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 96.72
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 96.72
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 96.71
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 96.71
3u4t_A272 TPR repeat-containing protein; structural genomics 96.69
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 96.69
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 96.69
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 96.67
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 96.67
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 96.67
3u4t_A 272 TPR repeat-containing protein; structural genomics 96.66
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 96.64
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 96.63
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 96.63
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 96.6
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 96.58
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.57
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 96.56
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.54
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 96.5
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 96.49
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 96.46
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 96.42
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 96.41
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 96.41
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 96.39
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 96.39
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.31
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 96.27
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 96.26
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 96.22
2gw1_A514 Mitochondrial precursor proteins import receptor; 96.14
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 96.13
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 96.05
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 96.04
3k9i_A117 BH0479 protein; putative protein binding protein, 96.04
1hh8_A 213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 96.03
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 96.02
3q49_B137 STIP1 homology and U box-containing protein 1; E3 95.97
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 95.88
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 95.79
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 95.79
2kat_A115 Uncharacterized protein; NESG, structure, structur 95.78
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 95.62
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 95.61
2gw1_A 514 Mitochondrial precursor proteins import receptor; 95.54
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 95.53
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 95.53
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 95.46
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 95.44
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 95.43
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 95.35
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 95.33
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 95.3
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 95.21
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 95.19
2csv_A72 Tripartite motif protein 29; ZF-B_BOX domain, TRIM 94.92
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 94.91
3qky_A 261 Outer membrane assembly lipoprotein YFIO; membrane 94.82
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 94.66
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 94.63
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 94.59
2l6j_A111 TPR repeat-containing protein associated with HSP; 94.43
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 94.39
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 94.22
2kat_A115 Uncharacterized protein; NESG, structure, structur 94.1
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 94.07
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 93.92
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 93.66
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 93.17
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 93.06
2yhc_A 225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 92.97
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 92.39
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 92.37
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 92.31
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 91.74
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 91.02
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 90.26
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 89.96
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 89.47
1klx_A138 Cysteine rich protein B; structural genomics, heli 88.33
2jne_A101 Hypothetical protein YFGJ; zinc fingers, two zinc, 88.21
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 88.12
2ffw_A78 Midline-1; B-BOX, ring finger, zinc-finger, ligase 87.89
2d8u_A64 Ubiquitin ligase TRIM63; tripartite motif-containi 87.41
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 86.94
2ond_A 308 Cleavage stimulation factor 77 kDa subunit; HAT do 86.89
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 86.57
2yvr_A50 Transcription intermediary factor 1-beta; ZF-B_BOX 86.45
1klx_A138 Cysteine rich protein B; structural genomics, heli 85.08
2did_A53 Tripartite motif protein 39; ZF-B-box domian, Zn b 83.3
2dja_A84 Midline-2; tripartite motif protein 1, ZF-B_BOX, s 83.09
2w2u_A83 Hypothetical P60 katanin; hydrolase transport comp 83.03
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 82.72
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 82.43
2rpa_A78 Katanin P60 ATPase-containing subunit A1; AAA ATPa 81.65
3nw0_A238 Non-structural maintenance of chromosomes element 81.58
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 81.14
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 80.92
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 80.16
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
Probab=99.45  E-value=5.7e-14  Score=101.93  Aligned_cols=62  Identities=27%  Similarity=0.666  Sum_probs=55.1

Q ss_pred             cCCcccccccccccCCCeecc-cCCcchHHhHhcCC------CCCCCCcccc---cccccHHHHHHHHHHHhc
Q 020453           21 IGPLSCMICQALLFECSKCTP-CSHVYCKACISRFK------DCPLCGADIE---KIEADTTLQDVVDRFIEG   83 (326)
Q Consensus        21 ~~~l~C~iC~~~l~~~p~~l~-C~h~fC~~Cl~~~~------~CP~Cr~~~~---~~~~n~~l~~~~~~~~~~   83 (326)
                      .+.++|+||+++ +.+|++++ |||+||..||..|+      .||.||..+.   .+.+|..+.++++.+...
T Consensus        11 ~~~~~C~IC~~~-~~~p~~~~~CgH~fC~~Ci~~~~~~~~~~~CP~Cr~~~~~~~~~~~n~~l~~~i~~~~~~   82 (92)
T 3ztg_A           11 PDELLCLICKDI-MTDAVVIPCCGNSYCDECIRTALLESDEHTCPTCHQNDVSPDALIANKFLRQAVNNFKNE   82 (92)
T ss_dssp             CTTTEETTTTEE-CSSCEECTTTCCEECHHHHHHHHHHCTTCCCTTTCCSSCCTTSCEECHHHHHHHHHHHHH
T ss_pred             CcCCCCCCCChh-hcCceECCCCCCHHHHHHHHHHHHhcCCCcCcCCCCcCCCccccCcCHHHHHHHHHHHHH
Confidence            378999999999 57799999 99999999999885      4999999974   589999999999998764



>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2csv_A Tripartite motif protein 29; ZF-B_BOX domain, TRIM29, ataxia-telangiectasia group D-associated protein, ATDC, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.43.1.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2jne_A Hypothetical protein YFGJ; zinc fingers, two zinc, structural genomics, PSI-2, protein structure initiative; NMR {Escherichia coli} SCOP: g.41.18.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2ffw_A Midline-1; B-BOX, ring finger, zinc-finger, ligase; NMR {Homo sapiens} Back     alignment and structure
>2d8u_A Ubiquitin ligase TRIM63; tripartite motif-containing 63, muscle-specific ring finger protein 1, MURF1, ring finger protein 28; NMR {Homo sapiens} SCOP: g.43.1.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2yvr_A Transcription intermediary factor 1-beta; ZF-B_BOX domain, structural genomics, NPPSFA; 1.80A {Homo sapiens} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2did_A Tripartite motif protein 39; ZF-B-box domian, Zn binding, one sequence two fold, NPPSFA; NMR {Homo sapiens} SCOP: g.43.1.1 PDB: 2dif_A Back     alignment and structure
>2dja_A Midline-2; tripartite motif protein 1, ZF-B_BOX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.43.1.1 PDB: 2dq5_A Back     alignment and structure
>2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2rpa_A Katanin P60 ATPase-containing subunit A1; AAA ATPase, ATP-binding, cell cycle, cell division, cytoplas hydrolase, microtubule; NMR {Mus musculus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 326
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 2e-07
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 2e-06
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 3e-06
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 3e-06
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 5e-06
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 7e-05
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 2e-04
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 0.002
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Immediate early protein, IEEHV
species: Equine herpesvirus 1 [TaxId: 10326]
 Score = 45.7 bits (108), Expect = 2e-07
 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 8/58 (13%)

Query: 26 CMICQALLFECSKCTPCSHVYCKACISRF----KDCPLCGADIEKI----EADTTLQD 75
          C IC       S   PC H +C  CI+R+      CPLC   +E +    E+D+   D
Sbjct: 8  CPICLEDPSNYSMALPCLHAFCYVCITRWIRQNPTCPLCKVPVESVVHTIESDSEFGD 65


>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query326
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.45
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.42
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.39
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.38
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.3
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.29
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.23
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.03
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.01
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.0
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.99
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.88
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.77
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.32
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.32
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.31
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.27
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.23
d1qqea_ 290 Vesicular transport protein sec17 {Baker's yeast ( 98.15
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.1
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.05
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.01
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.87
d2c2la1 201 STIP1 homology and U box-containing protein 1, STU 97.85
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.84
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.74
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.66
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 97.61
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.59
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.48
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.47
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.46
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.43
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.38
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.37
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.32
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.28
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 97.2
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.17
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.1
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 97.06
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 96.99
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 96.9
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 96.88
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 96.75
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.66
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 96.48
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 96.31
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.27
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 96.14
d2csva159 Tripartite motif-containing protein 29 {Human (Hom 96.09
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 95.71
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 95.63
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 95.27
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 94.76
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 94.19
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 94.1
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 93.74
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 92.52
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 92.38
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 92.34
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 91.56
d2dida140 Tripartite motif-containing protein 39 {Human (Hom 89.18
d2jnea171 Hypothetical protein YfgJ {Escherichia coli [TaxId 87.95
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 83.59
d2djaa171 Midline-2 {Human (Homo sapiens) [TaxId: 9606]} 83.14
d1wr0a177 Vacuolar sorting protein 4b (VPS4B, SKD1 protein) 81.83
d1frea_39 Nuclear factor XNF7 {African clawed frog (Xenopus 81.23
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 80.03
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: U-box
domain: STIP1 homology and U box-containing protein 1, STUB1
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.45  E-value=1.1e-14  Score=100.92  Aligned_cols=61  Identities=20%  Similarity=0.271  Sum_probs=54.6

Q ss_pred             CCcccccccccccCCCeecccCCcchHHhHhcCC-----CCCCCCcccc--cccccHHHHHHHHHHHhc
Q 020453           22 GPLSCMICQALLFECSKCTPCSHVYCKACISRFK-----DCPLCGADIE--KIEADTTLQDVVDRFIEG   83 (326)
Q Consensus        22 ~~l~C~iC~~~l~~~p~~l~C~h~fC~~Cl~~~~-----~CP~Cr~~~~--~~~~n~~l~~~~~~~~~~   83 (326)
                      ++|.||||+++ +.+|++++|||+||+.||.+|+     .||.|+..+.  ++.+|..|+++++.+...
T Consensus         6 ~~l~CpIc~~l-~~dPv~~~cGhtfc~~ci~~~l~~~~~~cP~c~~~l~~~~l~pN~~L~~~I~~~l~~   73 (80)
T d2c2la2           6 DYLCGKISFEL-MREPCITPSGITYDRKDIEEHLQRVGHFNPVTRSPLTQEQLIPNLAMKEVIDAFISE   73 (80)
T ss_dssp             STTBCTTTCSB-CSSEEECSSCCEEETTHHHHHHHHTCSSCTTTCCCCCGGGCEECHHHHHHHHHHHTT
T ss_pred             ccccCcCcCch-hhhhcccCCcCeecHHHHHHHHhcCCccCCCccccccccccccHHHHHHHHHHHHHH
Confidence            78999999999 5779999999999999999885     3999999887  488999999999998654



>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2csva1 g.43.1.1 (A:8-66) Tripartite motif-containing protein 29 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dida1 g.43.1.1 (A:8-47) Tripartite motif-containing protein 39 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2djaa1 g.43.1.1 (A:8-78) Midline-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wr0a1 a.7.14.1 (A:5-81) Vacuolar sorting protein 4b (VPS4B, SKD1 protein) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1frea_ g.43.1.1 (A:) Nuclear factor XNF7 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure