Citrus Sinensis ID: 020491


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-----
MREPSMMVRETAAEQLEERQSDWAYSKPVVVLDIIWNLAFVAVAFSVMVLSQNERPNMPLRLWIVGYAIQCVLHMVCVCVEYKRRSRRRVSAFGGAEEGNLNSGTTRGDSGEYVSLANQLEEEGTSSVAKHLESANTMFSFIWWIIGFYWVSAGGQALARDSPLLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVADQQEGASKEDIERLSKFKFRRMVDTEKLSDDGQGSQGGIMTECGTETPNEHVLSNEDAECCICLSAYDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSNQDREEV
cccccHHHHHHHHHHHHHHHHcccccccEEEHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHEEEEEEEEEEEEEEEcccccccccccccccccccccccccHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHcEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccHHHHHccccccccccccccccccccccccc
cccccHHHHHHHHHHHHHHcccccccccEEHHHHHHHHHHHHHHHHHHHHcccccccccHEEEEEEHHHHHHEEEHHEHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcHEEEEccccccHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHcccEEEEEcccccccccccccccccEEEEEcccccccEccccccccEEEEEEccccccEEEEccccccHHHHHHHHHHHHHccccHHHHHHHccccccccccc
MREPSMMVRETAAEQLEErqsdwayskpVVVLDIIWNLAFVAVAFSVMVLsqnerpnmplRLWIVGYAIQCVLHMVCVCVEYkrrsrrrvsafggaeegnlnsgttrgdsgeYVSLANQLEEEGTSSVAKHLESANTMFSFIWWIIGFYWVSaggqalardspLLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVAdqqegaskeDIERLSKFKFRrmvdteklsddgqgsqggimtecgtetpnehvlsnedaecciclsayddgvelrelpcghhfhcacvdkwlyinatcplckynilksssnqdreev
MREPSMMVRETAAEQLeerqsdwaySKPVVVLDIIWNLAFVAVAFSVMVLSQNERPNMPLRLWIVGYAIQCVLHMVCVCVEYKRRSRRRvsafggaeegnlnsgttrgdsGEYVSLANQLEEEGTSSVAKHLESANTMFSFIWWIIGFYWVSAGGQALARDSPLLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVADQQEGASKEDIERLSkfkfrrmvdteklsddgqgsqgGIMTECGTETPNEHVLSNEDAECCICLSAYDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNilksssnqdreev
MREPSMMVRETAAEQLEERQSDWAYSKPVVVLDIIWNLAFVAVAFSVMVLSQNERPNMPLRLWIVGYAIQCVLHMVCVCVEYKRRSRRRVSAFGGAEEGNLNSGTTRGDSGEYVSLANQLEEEGTSSVAKHLESANTMFSFIWWIIGFYWVSAGGQALARDSPLLYWLCIIFLGfdvffvvfcvALACIIGIAVCCCLPCIIAILYAVADQQEGASKEDIERLSKFKFRRMVDTEKLSDDGQGSQGGIMTECGTETPNEHVLSNEDAECCICLSAYDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSNQDREEV
*********************DWAYSKPVVVLDIIWNLAFVAVAFSVMVLSQNERPNMPLRLWIVGYAIQCVLHMVCVCVEYKR*************************************************SANTMFSFIWWIIGFYWVSAGGQALARDSPLLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVAD**************************************************VLSNEDAECCICLSAYDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNIL***********
***********************AYSKPVVVLDIIWNLAFVAVAFSVMVLSQNERPNMPLRLWIVGYAIQCVLHMVCVCVEYKRR****************************************SSVAKHLESANTMFSFIWWIIGFYWVSAGGQALARDSPLLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIAILY********************KFRR********************************SNEDAECCICLSAYDDGVELRELPCGHHFHCACVDKWLYINATCPLC****************
*******************QSDWAYSKPVVVLDIIWNLAFVAVAFSVMVLSQNERPNMPLRLWIVGYAIQCVLHMVCVCVEYKRRSRRRVSAFGGAEEGNLNSGTTRGDSGEYVSLANQLEEEGTSSVAKHLESANTMFSFIWWIIGFYWVSAGGQALARDSPLLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVADQ********IERLSKFKFRRMVDTEK*********GGIMTECGTETPNEHVLSNEDAECCICLSAYDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKS*********
******************RQSDWAYSKPVVVLDIIWNLAFVAVAFSVMVLSQNERPNMPLRLWIVGYAIQCVLHMVCVCVEYKRRSR************************************GTSSVAKHLESANTMFSFIWWIIGFYWVSAGGQALARDSPLLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVADQQEGASKEDIERLSKFKFRRMV*************GGIMTECG*ETPNEHVLSNEDAECCICLSAYDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILK**********
iiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MREPSMMVRETAAEQLEERQSDWAYSKPVVVLDIIWNLAFVAVAFSVMVLSQNERPNMPLRLWIVGYAIQCVLHMVCVCVEYKRRSRRRVSAFGGAEEGNLNSGTTRGDSGEYVSLANQLEEEGTSSVAKHLESANTMFSFIWWIIGFYWVSAGGQALARDSPLLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVADQQEGASKEDIERLSKFKFRRMVDTEKLSDDGQGSQGGIMTECGTETPNEHVLSNEDAECCICLSAYDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSNQDREEV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query325 2.2.26 [Sep-21-2011]
Q93Z92390 E3 ubiquitin-protein liga yes no 0.947 0.789 0.725 1e-123
Q9LN71408 E3 ubiquitin-protein liga no no 0.981 0.781 0.711 1e-123
Q8LDB8381 E3 ubiquitin-protein liga no no 0.984 0.839 0.697 1e-116
Q8GUU2359 E3 ubiquitin protein liga no no 0.947 0.857 0.509 3e-84
Q5SSZ7 913 E3 ubiquitin-protein liga yes no 0.424 0.151 0.335 7e-14
Q9ULT6 936 E3 ubiquitin-protein liga yes no 0.403 0.139 0.337 4e-12
Q4KLR8 784 E3 ubiquitin-protein liga N/A no 0.390 0.161 0.346 9e-12
E9QAU8347 RING finger protein 165 O no no 0.249 0.233 0.359 1e-11
Q6ZSG1346 RING finger protein 165 O no no 0.249 0.234 0.359 2e-11
Q9WTV7600 E3 ubiquitin-protein liga no no 0.147 0.08 0.458 3e-11
>sp|Q93Z92|RING4_ARATH E3 ubiquitin-protein ligase At4g11680 OS=Arabidopsis thaliana GN=At4g11680 PE=2 SV=1 Back     alignment and function desciption
 Score =  441 bits (1135), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 233/321 (72%), Positives = 268/321 (83%), Gaps = 13/321 (4%)

Query: 1   MREPSMMVRETAAEQLEERQSDWAYSKPVVVLDIIWNLAFVAVAFSVMVLSQNERPNMPL 60
           MREPSM+VRETAAEQLEERQSDWAYSKPVV LDI+WNLAFVA+  +V++LS++E+PNMPL
Sbjct: 81  MREPSMLVRETAAEQLEERQSDWAYSKPVVFLDILWNLAFVAIGVAVLILSRDEKPNMPL 140

Query: 61  RLWIVGYAIQCVLHMVCVCVEYKRRSRRRVSAFGGAEEGNLNSGTTRGDSGEYVSLANQL 120
           R+W+VGY IQC LHM CVCVEY+RR RRR    GG       SG T   S +YVSLA QL
Sbjct: 141 RVWVVGYGIQCWLHMACVCVEYRRRRRRRHPEDGGG------SGLTNSSSQQYVSLA-QL 193

Query: 121 EEEG-TSSVAKHLESANTMFSFIWWIIGFYWVSAGGQALARDSPLLYWLCIIFLGFDVFF 179
           E+ G TS+ AKHLESANTMFSFIWWIIGFYWVSAGGQ L+ DSP LYWLCIIFLGFDVFF
Sbjct: 194 EDRGETSNPAKHLESANTMFSFIWWIIGFYWVSAGGQTLSSDSPQLYWLCIIFLGFDVFF 253

Query: 180 VVFCVALACIIGIAVCCCLPCIIAILYAVADQQEGASKEDIERLSKFKFRRMVDTEKLSD 239
           VVFCVALAC+IG+AVCCCLPCIIAILYAVAD QEGASK DI+++ KF+F +  + EKLS 
Sbjct: 254 VVFCVALACVIGLAVCCCLPCIIAILYAVAD-QEGASKNDIDQMPKFRFTKTGNVEKLS- 311

Query: 240 DGQGSQGGIMTECGTETPNEHVLSNEDAECCICLSAYDDGVELRELPCGHHFHCACVDKW 299
              G   GIMTECGT++P E  LS EDAECCICL  Y+DGVELRELPC HHFHC C+DKW
Sbjct: 312 ---GKARGIMTECGTDSPIERSLSPEDAECCICLCEYEDGVELRELPCNHHFHCTCIDKW 368

Query: 300 LYINATCPLCKYNILKSSSNQ 320
           L+IN+ CPLCK+NILK+++N+
Sbjct: 369 LHINSRCPLCKFNILKNANNE 389




Mediates E2-dependent protein ubiquitination in vitro.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q9LN71|RING1_ARATH E3 ubiquitin-protein ligase At1g12760 OS=Arabidopsis thaliana GN=At1g12760 PE=2 SV=1 Back     alignment and function description
>sp|Q8LDB8|RING2_ARATH E3 ubiquitin-protein ligase At1g63170 OS=Arabidopsis thaliana GN=At1g63170 PE=2 SV=2 Back     alignment and function description
>sp|Q8GUU2|RIE1_ARATH E3 ubiquitin protein ligase RIE1 OS=Arabidopsis thaliana GN=RIE1 PE=2 SV=1 Back     alignment and function description
>sp|Q5SSZ7|ZNRF3_MOUSE E3 ubiquitin-protein ligase ZNRF3 OS=Mus musculus GN=Znrf3 PE=2 SV=1 Back     alignment and function description
>sp|Q9ULT6|ZNRF3_HUMAN E3 ubiquitin-protein ligase ZNRF3 OS=Homo sapiens GN=ZNRF3 PE=1 SV=3 Back     alignment and function description
>sp|Q4KLR8|ZNRF3_XENLA E3 ubiquitin-protein ligase ZNRF3 OS=Xenopus laevis GN=znrf3 PE=2 SV=1 Back     alignment and function description
>sp|E9QAU8|RN165_MOUSE RING finger protein 165 OS=Mus musculus GN=Rnf165 PE=2 SV=1 Back     alignment and function description
>sp|Q6ZSG1|RN165_HUMAN RING finger protein 165 OS=Homo sapiens GN=RNF165 PE=1 SV=1 Back     alignment and function description
>sp|Q9WTV7|RNF12_MOUSE E3 ubiquitin-protein ligase RLIM OS=Mus musculus GN=Rlim PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query325
255537347383 cleavage and polyadenylation specificity 0.984 0.835 0.815 1e-141
356565289379 PREDICTED: E3 ubiquitin-protein ligase A 0.972 0.833 0.737 1e-137
449460475383 PREDICTED: E3 ubiquitin-protein ligase A 0.987 0.838 0.772 1e-137
356514046380 PREDICTED: E3 ubiquitin-protein ligase A 0.981 0.839 0.746 1e-134
356539808387 PREDICTED: E3 ubiquitin-protein ligase A 0.990 0.832 0.740 1e-127
359474241383 PREDICTED: E3 ubiquitin-protein ligase A 0.981 0.832 0.782 1e-127
357481703387 E3 ubiquitin-protein ligase [Medicago tr 0.987 0.829 0.752 1e-126
359474243392 PREDICTED: E3 ubiquitin-protein ligase A 0.984 0.816 0.767 1e-126
356497216385 PREDICTED: E3 ubiquitin-protein ligase A 0.981 0.828 0.756 1e-125
225453718382 PREDICTED: E3 ubiquitin-protein ligase A 0.966 0.821 0.704 1e-124
>gi|255537347|ref|XP_002509740.1| cleavage and polyadenylation specificity factor, putative [Ricinus communis] gi|223549639|gb|EEF51127.1| cleavage and polyadenylation specificity factor, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  508 bits (1307), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 266/326 (81%), Positives = 294/326 (90%), Gaps = 6/326 (1%)

Query: 3   EPSMMVRETAAEQLEERQSDWAYSKPVVVLDIIWNLAFVAVAFSVMVLSQNERPNMPLRL 62
           EPSM+VRETAAEQLEERQSDWAYSKPVV+LDI+WN AFVAVA  V+++S+ E P+MPLRL
Sbjct: 61  EPSMLVRETAAEQLEERQSDWAYSKPVVILDILWNFAFVAVAIGVLIMSRKEDPSMPLRL 120

Query: 63  WIVGYAIQCVLHMVCVCVEYKRRSRRRVS-AFGGAEEGNLNSGTTRGDSGEYVSLANQLE 121
           WIVGY +QCVLHMVCVCVEY+RR RRR    FG   +GNL+SG+ RGDSGEYV+LA   +
Sbjct: 121 WIVGYGLQCVLHMVCVCVEYRRRRRRRRRVGFGIGSDGNLSSGS-RGDSGEYVTLAQLED 179

Query: 122 EEGTSSVAKHLESANTMFSFIWWIIGFYWVSAGGQALARDSPLLYWLCIIFLGFDVFFVV 181
            +GTSSVAKHLESANTMFSFIWWIIGFYWVSAGGQAL+ +SP LYWLCIIFLGFDVFFVV
Sbjct: 180 HDGTSSVAKHLESANTMFSFIWWIIGFYWVSAGGQALSHNSPQLYWLCIIFLGFDVFFVV 239

Query: 182 FCVALACIIGIAVCCCLPCIIAILYAVADQQEGASKEDIERLSKFKFRRMVDTEKLSDDG 241
           FCVALACIIGIAVCCCLPCIIAILYAVAD QEGASKEDIE+LSKFKFRR+ + EKL+ +G
Sbjct: 240 FCVALACIIGIAVCCCLPCIIAILYAVAD-QEGASKEDIEQLSKFKFRRVDNDEKLTGNG 298

Query: 242 --QGSQGGIMTECGTETPNEHVLSNEDAECCICLSAYDDGVELRELPCGHHFHCACVDKW 299
             QG  GG+MTECGT++P EH+LS EDAECCICLSAYDDGVELRELPCGHHFHCACVDKW
Sbjct: 299 DEQGPLGGVMTECGTDSPVEHILSEEDAECCICLSAYDDGVELRELPCGHHFHCACVDKW 358

Query: 300 LYINATCPLCKYNILKSSSNQDREEV 325
           LYINATCPLCKYNILKSSS +DREEV
Sbjct: 359 LYINATCPLCKYNILKSSS-RDREEV 383




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356565289|ref|XP_003550874.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Glycine max] Back     alignment and taxonomy information
>gi|449460475|ref|XP_004147971.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356514046|ref|XP_003525718.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Glycine max] Back     alignment and taxonomy information
>gi|356539808|ref|XP_003538385.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Glycine max] Back     alignment and taxonomy information
>gi|359474241|ref|XP_003631422.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357481703|ref|XP_003611137.1| E3 ubiquitin-protein ligase [Medicago truncatula] gi|355512472|gb|AES94095.1| E3 ubiquitin-protein ligase [Medicago truncatula] gi|388506770|gb|AFK41451.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|359474243|ref|XP_003631423.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 3 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356497216|ref|XP_003517458.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Glycine max] Back     alignment and taxonomy information
>gi|225453718|ref|XP_002271651.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query325
TAIR|locus:2195077408 AT1G12760 [Arabidopsis thalian 0.987 0.786 0.683 2.1e-123
TAIR|locus:2015248381 AT1G63170 [Arabidopsis thalian 0.990 0.845 0.675 1.9e-122
TAIR|locus:2139717390 AT4G11680 [Arabidopsis thalian 0.947 0.789 0.694 1.5e-120
TAIR|locus:2098916379 AT3G61180 [Arabidopsis thalian 0.996 0.854 0.572 3.4e-100
TAIR|locus:2200301343 AT1G68070 [Arabidopsis thalian 0.932 0.883 0.485 1.4e-80
TAIR|locus:1005452975359 RIE1 "RING-finger protein for 0.947 0.857 0.484 2.1e-75
TAIR|locus:2125652453 AT4G32600 [Arabidopsis thalian 0.864 0.620 0.348 3.6e-41
TAIR|locus:2034210407 AT1G80400 [Arabidopsis thalian 0.849 0.678 0.320 5.3e-40
TAIR|locus:2133877335 AT4G26580 [Arabidopsis thalian 0.156 0.152 0.549 6.5e-25
TAIR|locus:2161740343 AT5G55970 [Arabidopsis thalian 0.193 0.183 0.444 7e-23
TAIR|locus:2195077 AT1G12760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1213 (432.1 bits), Expect = 2.1e-123, P = 2.1e-123
 Identities = 233/341 (68%), Positives = 273/341 (80%)

Query:     1 MREPSMMVRETAAEQLEERQSDWAYSKPVVVLDIIWNLAFVAVAFSVMVLSQNERPNMPL 60
             MREPSM+VRE AAEQLEERQSDWAYSKPVVVLDI+WNLAFV+VA +++V+S+ E P MPL
Sbjct:    72 MREPSMLVREAAAEQLEERQSDWAYSKPVVVLDIVWNLAFVSVATAILVMSRKEHPIMPL 131

Query:    61 RLWIVGYAIQCVLHMVCVCVEYKRRSRRRV------------SAFGGAEEGNLNS---GT 105
             R+W++GYA+QCVLHMVCVCVEY+RR+RRR             S+   +   +L     G+
Sbjct:   132 RVWLLGYALQCVLHMVCVCVEYRRRNRRRTNRTTTTTPPRSRSSSSSSSSSSLEEEALGS 191

Query:   106 TRGDSGEYVSLANQLEEEGTSSVAKHLESANTMFSFIWWIIGFYWVSAGGQALARDSPLL 165
              R    + +SL + L+ E +SSVAKHLESANTMFSFIWWIIGFYWVSAGGQ LA++SP +
Sbjct:   192 RRNSGVQDLSLGH-LDTE-SSSVAKHLESANTMFSFIWWIIGFYWVSAGGQELAQESPRI 249

Query:   166 YWLCIIFLGXXXXXXXXXXALACIIGIAVCCCLPCIIAILYAVADQQEGASKEDIERLSK 225
             YWL I+FLG          ALAC+IGIAVCCCLPCIIA+LYAVADQ EGASKEDIE+L+K
Sbjct:   250 YWLSIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVADQ-EGASKEDIEQLTK 308

Query:   226 FKFRRMVDTEK-LSDDGQGSQGGIMTECGTETPNEHVLSNEDAECCICLSAYDDGVELRE 284
             FKFR++ D  K  +D+ QG+  GIMTECGT++P EH L  EDAECCICLSAY+DG ELRE
Sbjct:   309 FKFRKLGDANKHTNDEAQGTTEGIMTECGTDSPIEHTLLQEDAECCICLSAYEDGTELRE 368

Query:   285 LPCGHHFHCACVDKWLYINATCPLCKYNILKSSSNQDREEV 325
             LPCGHHFHC+CVDKWLYINATCPLCKYNILKSS N DREEV
Sbjct:   369 LPCGHHFHCSCVDKWLYINATCPLCKYNILKSS-NLDREEV 408




GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0004842 "ubiquitin-protein ligase activity" evidence=IDA
TAIR|locus:2015248 AT1G63170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139717 AT4G11680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098916 AT3G61180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200301 AT1G68070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1005452975 RIE1 "RING-finger protein for embryogenesis" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2125652 AT4G32600 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034210 AT1G80400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133877 AT4G26580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161740 AT5G55970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q93Z92RING4_ARATH6, ., 3, ., 2, ., -0.72580.94760.7897yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00001121001
SubName- Full=Chromosome chr2 scaffold_112, whole genome shotgun sequence; (316 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query325
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 1e-13
cd0016245 cd00162, RING, RING-finger (Really Interesting New 4e-10
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 2e-08
smart0018440 smart00184, RING, Ring finger 2e-07
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 3e-07
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 4e-07
COG5243 491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 2e-06
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 7e-06
COG52191525 COG5219, COG5219, Uncharacterized conserved protei 2e-04
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 0.004
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
 Score = 64.0 bits (156), Expect = 1e-13
 Identities = 24/43 (55%), Positives = 30/43 (69%)

Query: 268 ECCICLSAYDDGVELRELPCGHHFHCACVDKWLYINATCPLCK 310
           EC ICL  ++ G E+  LPCGH FH  C+DKWL  + TCPLC+
Sbjct: 2   ECPICLDEFEPGEEVVVLPCGHVFHKECLDKWLRSSNTCPLCR 44


Length = 46

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227544 COG5219, COG5219, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 325
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.81
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.59
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 99.41
PHA02929238 N1R/p28-like protein; Provisional 99.34
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.34
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.18
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 99.08
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 99.05
cd0016245 RING RING-finger (Really Interesting New Gene) dom 99.02
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.99
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.93
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.93
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.92
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 98.91
PF1463444 zf-RING_5: zinc-RING finger domain 98.77
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.74
PHA02926242 zinc finger-like protein; Provisional 98.73
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.71
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 98.7
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.65
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 98.62
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.61
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.6
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 98.55
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.54
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.45
KOG149384 consensus Anaphase-promoting complex (APC), subuni 98.31
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.27
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.26
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 98.25
COG52191525 Uncharacterized conserved protein, contains RING Z 98.14
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 98.1
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.02
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.01
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 98.01
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 97.97
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.92
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 97.86
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 97.81
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.8
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.72
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 97.56
KOG4445 368 consensus Uncharacterized conserved protein, conta 97.5
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 97.4
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.39
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 97.28
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.2
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.13
KOG1941518 consensus Acetylcholine receptor-associated protei 97.05
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.04
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 96.98
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 96.85
PHA02862156 5L protein; Provisional 96.77
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 96.75
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 96.69
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 96.63
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 96.56
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 96.56
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.55
KOG0297 391 consensus TNF receptor-associated factor [Signal t 96.4
PHA02825162 LAP/PHD finger-like protein; Provisional 96.17
COG5152259 Uncharacterized conserved protein, contains RING a 95.91
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 95.62
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 95.42
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 95.28
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 95.14
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 95.04
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 94.7
PHA03096284 p28-like protein; Provisional 94.52
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 94.51
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 94.43
KOG1002 791 consensus Nucleotide excision repair protein RAD16 94.36
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 94.12
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 93.88
KOG2660 331 consensus Locus-specific chromosome binding protei 93.63
KOG1609 323 consensus Protein involved in mRNA turnover and st 93.45
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 93.45
KOG1940276 consensus Zn-finger protein [General function pred 93.31
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 93.27
KOG3039303 consensus Uncharacterized conserved protein [Funct 93.23
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 92.12
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 91.84
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 91.7
COG5222427 Uncharacterized conserved protein, contains RING Z 91.62
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 91.06
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 90.96
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 90.61
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 89.76
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 89.66
PF04641260 Rtf2: Rtf2 RING-finger 89.42
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 89.15
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 88.72
COG5236 493 Uncharacterized conserved protein, contains RING Z 88.47
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 88.44
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 87.27
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 86.65
COG5175 480 MOT2 Transcriptional repressor [Transcription] 86.54
KOG3053 293 consensus Uncharacterized conserved protein [Funct 86.54
KOG03091081 consensus Conserved WD40 repeat-containing protein 86.38
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 86.28
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 85.61
PF10272358 Tmpp129: Putative transmembrane protein precursor; 84.26
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 82.79
KOG0298 1394 consensus DEAD box-containing helicase-like transc 81.77
PF11023114 DUF2614: Protein of unknown function (DUF2614); In 80.61
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.81  E-value=4.6e-20  Score=174.44  Aligned_cols=81  Identities=35%  Similarity=0.760  Sum_probs=69.3

Q ss_pred             hcCCCCHHHHhhcccceeeeccccccccCCCCCCCCCcccccCCCCCCcccCCCCCcccccccccccCCCceEEeCcCCc
Q 020491          211 QQEGASKEDIERLSKFKFRRMVDTEKLSDDGQGSQGGIMTECGTETPNEHVLSNEDAECCICLSAYDDGVELRELPCGHH  290 (325)
Q Consensus       211 ~~~~~s~~~i~~Lp~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~ed~~C~ICL~~y~~~~~lr~LPC~H~  290 (325)
                      +.+++.+..++++|..+|+...+++..                             ..|+|||++|++||++|.|||+|.
T Consensus       203 ~~~r~~k~~l~~~p~~~f~~~~~~~~~-----------------------------~~CaIClEdY~~GdklRiLPC~H~  253 (348)
T KOG4628|consen  203 RRNRLIKRLLKKLPVRTFTKGDDEDAT-----------------------------DTCAICLEDYEKGDKLRILPCSHK  253 (348)
T ss_pred             hhhhhHHHHHhhCCcEEeccccccCCC-----------------------------ceEEEeecccccCCeeeEecCCCc
Confidence            357889999999999999876544211                             489999999999999999999999


Q ss_pred             cchHHHHHHHhcCC-CCccccccccCCCCcc
Q 020491          291 FHCACVDKWLYINA-TCPLCKYNILKSSSNQ  320 (325)
Q Consensus       291 FH~~CI~~WL~~~~-tCPlCR~~I~~~~~~~  320 (325)
                      ||..|||+||..+. .||+||+++.+....+
T Consensus       254 FH~~CIDpWL~~~r~~CPvCK~di~~~~~~~  284 (348)
T KOG4628|consen  254 FHVNCIDPWLTQTRTFCPVCKRDIRTDSGSE  284 (348)
T ss_pred             hhhccchhhHhhcCccCCCCCCcCCCCCCCC
Confidence            99999999998875 5999999998765554



>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>PF11023 DUF2614: Protein of unknown function (DUF2614); InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query325
2kiz_A69 Solution Structure Of Arkadia Ring-H2 Finger Domain 9e-09
1x4j_A75 Solution Structure Of Ring Finger In Ring Finger Pr 9e-09
1iym_A55 Ring-H2 Finger Domain Of El5 Length = 55 2e-08
2ect_A78 Solution Structure Of The Zinc Finger, C3hc4 Type ( 1e-05
2l0b_A91 Solution Nmr Structure Of Zinc Finger Domain Of E3 3e-05
2ep4_A74 Solution Structure Of Ring Finger From Human Ring F 1e-04
2ecn_A70 Solution Structure Of The Ring Domain Of The Human 6e-04
4ayc_B138 Rnf8 Ring Domain Structure Length = 138 6e-04
4epo_C149 Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HE 7e-04
4ayc_A138 Rnf8 Ring Domain Structure Length = 138 8e-04
>pdb|2KIZ|A Chain A, Solution Structure Of Arkadia Ring-H2 Finger Domain Length = 69 Back     alignment and structure

Iteration: 1

Score = 57.8 bits (138), Expect = 9e-09, Method: Compositional matrix adjust. Identities = 23/46 (50%), Positives = 32/46 (69%) Query: 268 ECCICLSAYDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNI 313 +C ICLS ++G ++R LPC H FH CVD+WL N CP+C+ +I Sbjct: 16 KCTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDI 61
>pdb|1X4J|A Chain A, Solution Structure Of Ring Finger In Ring Finger Protein 38 Length = 75 Back     alignment and structure
>pdb|1IYM|A Chain A, Ring-H2 Finger Domain Of El5 Length = 55 Back     alignment and structure
>pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 Back     alignment and structure
>pdb|2L0B|A Chain A, Solution Nmr Structure Of Zinc Finger Domain Of E3 Ubiquitin-Protein Ligase Praja-1 From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr4710b Length = 91 Back     alignment and structure
>pdb|2EP4|A Chain A, Solution Structure Of Ring Finger From Human Ring Finger Protein 24 Length = 74 Back     alignment and structure
>pdb|2ECN|A Chain A, Solution Structure Of The Ring Domain Of The Human Ring Finger Protein 141 Length = 70 Back     alignment and structure
>pdb|4AYC|B Chain B, Rnf8 Ring Domain Structure Length = 138 Back     alignment and structure
>pdb|4EPO|C Chain C, Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HETERODIMER Length = 149 Back     alignment and structure
>pdb|4AYC|A Chain A, Rnf8 Ring Domain Structure Length = 138 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query325
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 1e-27
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 2e-26
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 8e-26
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 7e-23
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 1e-21
2ect_A78 Ring finger protein 126; metal binding protein, st 3e-20
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 1e-19
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 4e-14
2ecm_A55 Ring finger and CHY zinc finger domain- containing 6e-14
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 3e-12
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 9e-12
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 5e-11
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 2e-10
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 2e-09
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 3e-09
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 5e-09
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 8e-09
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 3e-08
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 7e-08
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 9e-08
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 1e-07
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 1e-07
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 1e-07
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 5e-07
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 2e-06
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 4e-06
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 6e-06
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 7e-06
1z6u_A150 NP95-like ring finger protein isoform B; structura 7e-06
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 1e-05
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 3e-05
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 4e-05
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 4e-05
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 6e-05
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 9e-05
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 1e-04
3nw0_A238 Non-structural maintenance of chromosomes element 1e-04
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 1e-04
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 1e-04
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 2e-04
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 3e-04
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 7e-04
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 8e-04
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
 Score =  102 bits (255), Expect = 1e-27
 Identities = 28/103 (27%), Positives = 40/103 (38%), Gaps = 29/103 (28%)

Query: 215 ASKEDIERLSKFKFRRMVDTEKLSDDGQGSQGGIMTECGTETPNEHVLSNEDAECCICLS 274
            S     +L  ++F                             N +   +E   C +C+ 
Sbjct: 1   GSSGSSGQLPSYRF-----------------------------NPNNHQSEQTLCVVCMC 31

Query: 275 AYDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSS 317
            ++    LR LPC H FH  CVDKWL  N TCP+C+ +   SS
Sbjct: 32  DFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADSGPSS 74


>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query325
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.71
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.69
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.6
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.6
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.59
2ect_A78 Ring finger protein 126; metal binding protein, st 99.58
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.53
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.5
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.5
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.47
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.47
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.45
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.45
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.44
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.4
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.39
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.39
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.38
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.35
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.34
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.33
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.33
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.31
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.3
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.24
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.24
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.24
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.21
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 99.21
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.2
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.18
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.17
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.17
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.17
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.17
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.16
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.15
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.12
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.11
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.09
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.05
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.02
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.01
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.01
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.98
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.97
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.93
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.91
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.9
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.89
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.86
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.84
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.83
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.83
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.82
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.81
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.79
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.79
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.77
2ea5_A68 Cell growth regulator with ring finger domain prot 98.68
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.66
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.57
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.56
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.56
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.49
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.4
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.38
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.24
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.24
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.01
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.71
3nw0_A238 Non-structural maintenance of chromosomes element 97.67
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 94.99
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 94.21
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 93.95
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 92.72
1we9_A64 PHD finger family protein; structural genomics, PH 92.13
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 91.38
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 88.57
3lqh_A 183 Histone-lysine N-methyltransferase MLL; PHD finger 88.29
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 87.56
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 86.37
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 86.22
2k16_A75 Transcription initiation factor TFIID subunit 3; p 85.78
3o36_A 184 Transcription intermediary factor 1-alpha; TRIM24, 85.33
1wem_A76 Death associated transcription factor 1; structura 84.98
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 84.57
1wil_A89 KIAA1045 protein; ring finger domain, structural g 84.45
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 84.14
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 83.84
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 82.58
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 81.63
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 81.42
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 81.25
1wee_A72 PHD finger family protein; structural genomics, PH 81.02
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 80.82
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
Probab=99.71  E-value=7.1e-18  Score=130.95  Aligned_cols=76  Identities=36%  Similarity=0.655  Sum_probs=65.4

Q ss_pred             cCCCCHHHHhhcccceeeeccccccccCCCCCCCCCcccccCCCCCCcccCCCCCcccccccccccCCCceEEeCcCCcc
Q 020491          212 QEGASKEDIERLSKFKFRRMVDTEKLSDDGQGSQGGIMTECGTETPNEHVLSNEDAECCICLSAYDDGVELRELPCGHHF  291 (325)
Q Consensus       212 ~~~~s~~~i~~Lp~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~ed~~C~ICL~~y~~~~~lr~LPC~H~F  291 (325)
                      ..+++++.++.||..++......                            ..++..|+||+++|.+++.++.|||+|.|
T Consensus        14 ~~~~s~~~i~~lp~~~~~~~~~~----------------------------~~~~~~C~IC~~~~~~~~~~~~l~C~H~F   65 (91)
T 2l0b_A           14 NPPASKESIDALPEILVTEDHGA----------------------------VGQEMCCPICCSEYVKGDVATELPCHHYF   65 (91)
T ss_dssp             CCCCCHHHHHTSCEEECCTTCSS----------------------------SSSCSEETTTTEECCTTCEEEEETTTEEE
T ss_pred             CCCCCHHHHHhCCCeeecccccc----------------------------cCCCCCCcccChhhcCCCcEEecCCCChH
Confidence            48999999999999887643211                            12447899999999999999999999999


Q ss_pred             chHHHHHHHhcCCCCccccccccC
Q 020491          292 HCACVDKWLYINATCPLCKYNILK  315 (325)
Q Consensus       292 H~~CI~~WL~~~~tCPlCR~~I~~  315 (325)
                      |..||++|++.+.+||+||..+..
T Consensus        66 h~~Ci~~wl~~~~~CP~Cr~~~~~   89 (91)
T 2l0b_A           66 HKPCVSIWLQKSGTCPVCRCMFPP   89 (91)
T ss_dssp             EHHHHHHHHTTTCBCTTTCCBSSC
T ss_pred             HHHHHHHHHHcCCcCcCcCccCCC
Confidence            999999999999999999998864



>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 325
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 3e-16
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 7e-13
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 1e-10
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 4e-09
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 5e-09
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 1e-07
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 2e-07
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 2e-07
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 1e-06
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 2e-06
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 3e-06
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 3e-05
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 2e-04
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
 Score = 69.5 bits (170), Expect = 3e-16
 Identities = 25/51 (49%), Positives = 34/51 (66%), Gaps = 1/51 (1%)

Query: 265 EDAECCICLSAYDDGVELRELP-CGHHFHCACVDKWLYINATCPLCKYNIL 314
           +  EC +CL+  +DG E R LP CGH FH  CVD WL  ++TCPLC+  ++
Sbjct: 4   DGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV 54


>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query325
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.73
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.54
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.5
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.49
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.47
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.45
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.39
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.2
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.18
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.18
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.11
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.11
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.89
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.88
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.88
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.72
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.45
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 94.08
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 93.45
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 93.09
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 92.81
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 91.22
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 90.27
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 88.91
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 87.87
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 86.48
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 85.59
d1wema_76 Death associated transcription factor 1, Datf1 (DI 84.21
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
Probab=99.73  E-value=5.1e-19  Score=123.14  Aligned_cols=50  Identities=50%  Similarity=1.194  Sum_probs=46.6

Q ss_pred             CCcccccccccccCCCceEEeC-cCCccchHHHHHHHhcCCCCcccccccc
Q 020491          265 EDAECCICLSAYDDGVELRELP-CGHHFHCACVDKWLYINATCPLCKYNIL  314 (325)
Q Consensus       265 ed~~C~ICL~~y~~~~~lr~LP-C~H~FH~~CI~~WL~~~~tCPlCR~~I~  314 (325)
                      ++.+|+|||++|++++.++.+| |+|.||.+||++|++++.+||+||++|.
T Consensus         4 d~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i~   54 (55)
T d1iyma_           4 DGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV   54 (55)
T ss_dssp             CSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCSC
T ss_pred             CCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEeE
Confidence            4578999999999999999886 9999999999999999999999999874



>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure