Citrus Sinensis ID: 020671
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 323 | ||||||
| 449463408 | 322 | PREDICTED: zinc finger CCCH domain-conta | 0.978 | 0.981 | 0.774 | 1e-140 | |
| 255562324 | 325 | RING finger protein 113A, putative [Rici | 0.981 | 0.975 | 0.770 | 1e-140 | |
| 224130524 | 323 | predicted protein [Populus trichocarpa] | 0.990 | 0.990 | 0.776 | 1e-138 | |
| 359489721 | 331 | PREDICTED: zinc finger CCCH domain-conta | 0.993 | 0.969 | 0.777 | 1e-138 | |
| 297848380 | 342 | zinc finger family protein [Arabidopsis | 0.972 | 0.918 | 0.732 | 1e-134 | |
| 186478011 | 343 | zinc finger CCCH domain-containing prote | 0.975 | 0.918 | 0.732 | 1e-132 | |
| 15240037 | 378 | zinc finger CCCH domain-containing prote | 0.981 | 0.838 | 0.726 | 1e-132 | |
| 26451788 | 343 | unknown protein [Arabidopsis thaliana] | 0.975 | 0.918 | 0.732 | 1e-132 | |
| 22531136 | 378 | putative protein [Arabidopsis thaliana] | 0.981 | 0.838 | 0.723 | 1e-131 | |
| 357511311 | 387 | Zinc finger CCCH domain-containing prote | 0.984 | 0.821 | 0.731 | 1e-131 |
| >gi|449463408|ref|XP_004149426.1| PREDICTED: zinc finger CCCH domain-containing protein 1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 503 bits (1294), Expect = e-140, Method: Compositional matrix adjust.
Identities = 247/319 (77%), Positives = 284/319 (89%), Gaps = 3/319 (0%)
Query: 4 SGSGEAQQAEQVCNFFRKPTKNKNIRKRTIREDEDEDS-IESSVLQNLKKPTKPDSKLYF 62
+ +G+ Q +EQVC+FFRKPTKNKNIRKRT+ EDE+EDS E+S L N KK K +SKLYF
Sbjct: 2 TDTGDTQPSEQVCSFFRKPTKNKNIRKRTVDEDEEEDSKAETSFLLNQKKAPKTESKLYF 61
Query: 63 STGPSKRDTSADSNADSEKPIFQFESSKEIQVQHDSKATATLETETDFLRDSRALREKVL 122
S+GPSK +S +SN + KPIFQFESSKEIQV HDS+ATATLETETDF RD+RA+RE+VL
Sbjct: 62 SSGPSKNSSSNESNVEPNKPIFQFESSKEIQVHHDSRATATLETETDFSRDARAIRERVL 121
Query: 123 KRSEEALKGK--ASGDEKLYKGIHGYVDHKAGFRREHTVSSEKAGGSHGPLRASAHIRVT 180
K++EEALKGK +SG EKLYKG++ YVD+KAGFRREHT+SSEKAGG+HGPLRASAHIR +
Sbjct: 122 KQAEEALKGKGKSSGGEKLYKGVNAYVDYKAGFRREHTISSEKAGGAHGPLRASAHIRAS 181
Query: 181 ARFDYQPDICKDYKETGYCGYGDSCKFMHDRGDYKSGWQMEKEWEEAEKARKRNLALGGG 240
ARFDYQPDICKDYKETGYCGYGD+CKFMHDRGDYKSGWQ+EKEWEE EKARKR LA+
Sbjct: 182 ARFDYQPDICKDYKETGYCGYGDACKFMHDRGDYKSGWQLEKEWEEVEKARKRKLAMKSD 241
Query: 241 DSDEEGVGQSDDDDEDSLPFACFICRKPFVDPVVTKCKHYFCEHCALKHHSKNKKCFVCN 300
D DE+ QSD+D+ED+LPFACFICR+PFVDPVVTKCKHYFCEHCALKHH+KNKKCFVCN
Sbjct: 242 DGDEDTSEQSDEDEEDALPFACFICREPFVDPVVTKCKHYFCEHCALKHHAKNKKCFVCN 301
Query: 301 EPTLGIFNTALEIRKRMAE 319
+PTLGIFNTA EIRKRMA+
Sbjct: 302 QPTLGIFNTAHEIRKRMAQ 320
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255562324|ref|XP_002522169.1| RING finger protein 113A, putative [Ricinus communis] gi|223538607|gb|EEF40210.1| RING finger protein 113A, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224130524|ref|XP_002320858.1| predicted protein [Populus trichocarpa] gi|222861631|gb|EEE99173.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359489721|ref|XP_002277034.2| PREDICTED: zinc finger CCCH domain-containing protein 1-like [Vitis vinifera] gi|297745423|emb|CBI40503.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297848380|ref|XP_002892071.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297337913|gb|EFH68330.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|186478011|ref|NP_171642.2| zinc finger CCCH domain-containing protein 1 [Arabidopsis thaliana] gi|229621709|sp|Q8GX84.2|C3H1_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 1; Short=AtC3H1 gi|225897850|dbj|BAH30257.1| hypothetical protein [Arabidopsis thaliana] gi|332189154|gb|AEE27275.1| zinc finger CCCH domain-containing protein 1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|15240037|ref|NP_196260.1| zinc finger CCCH domain-containing protein 51 [Arabidopsis thaliana] gi|30681442|ref|NP_850780.1| zinc finger CCCH domain-containing protein 51 [Arabidopsis thaliana] gi|75334125|sp|Q9FNG6.1|C3H51_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 51; Short=AtC3H51 gi|9758422|dbj|BAB08964.1| unnamed protein product [Arabidopsis thaliana] gi|21618279|gb|AAM67329.1| unknown [Arabidopsis thaliana] gi|332003629|gb|AED91012.1| zinc finger CCCH domain-containing protein 51 [Arabidopsis thaliana] gi|332003630|gb|AED91013.1| zinc finger CCCH domain-containing protein 51 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|26451788|dbj|BAC42988.1| unknown protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|22531136|gb|AAM97072.1| putative protein [Arabidopsis thaliana] gi|23198042|gb|AAN15548.1| putative protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|357511311|ref|XP_003625944.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] gi|355500959|gb|AES82162.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 323 | ||||||
| TAIR|locus:2035377 | 343 | AT1G01350 [Arabidopsis thalian | 0.975 | 0.918 | 0.686 | 6.7e-120 | |
| TAIR|locus:2164320 | 378 | AT5G06420 [Arabidopsis thalian | 0.981 | 0.838 | 0.671 | 2.3e-119 | |
| FB|FBgn0038772 | 357 | CG4973 [Drosophila melanogaste | 0.792 | 0.717 | 0.425 | 9.6e-57 | |
| ZFIN|ZDB-GENE-040825-1 | 321 | rnf113a "ring finger protein 1 | 0.900 | 0.906 | 0.385 | 3.4e-54 | |
| UNIPROTKB|F1RUA4 | 344 | LOC100514886 "Uncharacterized | 0.938 | 0.880 | 0.371 | 8.3e-51 | |
| UNIPROTKB|Q67ER3 | 328 | RNF113A "Zinc finger protein 1 | 0.727 | 0.716 | 0.423 | 1.3e-50 | |
| UNIPROTKB|E1BF77 | 351 | LOC518027 "Uncharacterized pro | 0.668 | 0.615 | 0.45 | 4.6e-50 | |
| UNIPROTKB|Q5PPN1 | 341 | Rnf113a1 "Ring finger protein | 0.931 | 0.882 | 0.364 | 1.5e-49 | |
| UNIPROTKB|Q67ER4 | 343 | RNF113A "RING finger protein 1 | 0.938 | 0.883 | 0.373 | 2.5e-49 | |
| UNIPROTKB|E2RE92 | 348 | LOC100855580 "Uncharacterized | 0.736 | 0.683 | 0.410 | 3.2e-49 |
| TAIR|locus:2035377 AT1G01350 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1180 (420.4 bits), Expect = 6.7e-120, P = 6.7e-120
Identities = 221/322 (68%), Positives = 258/322 (80%)
Query: 6 SGEAQQAEQVCNFFRKPTKNKNIRKRTIRXXXXX--XXXXXXVLQNLKKPTKPDSKLYFS 63
+ + Q++QVC FF+KPTK+KNIRKRTI +LQNLKK KPDSKLYFS
Sbjct: 20 AAQETQSQQVCTFFKKPTKSKNIRKRTIDADEEDGDSKSESSILQNLKKVAKPDSKLYFS 79
Query: 64 TGPSKRDTSADSNADSEKPIFQFESSKEIQVQHDSKATATLETETDFLRDSRALREKVLK 123
+GPSK T+ S A E+ +F ++SSKEIQVQ+DS ATATLETETDF +D+RA+RE+VLK
Sbjct: 80 SGPSKSSTTT-SGAP-ERSVFHYDSSKEIQVQNDSGATATLETETDFNQDARAIRERVLK 137
Query: 124 RSEEALKG--KASGDEKLYKGIHGYVDHKAGFRREHTVSSEKAGGSHGPLRASAHIRVTA 181
+++EALKG K + DEKLYKGIHGY DHKAGFRRE T+SSEKAGGSHGPLRASAHIRV+A
Sbjct: 138 KADEALKGNKKKASDEKLYKGIHGYTDHKAGFRREQTISSEKAGGSHGPLRASAHIRVSA 197
Query: 182 RFDYQPDICKDYKETGYCGYGDSCKFMHDRGDYKSGWQMXXXXXXXXXXXXXNLALGGGD 241
RFDYQPDICKDYKETGYCGYGDSCKF+HDRGDYK GWQ+ N A+G D
Sbjct: 198 RFDYQPDICKDYKETGYCGYGDSCKFLHDRGDYKPGWQIEKEWEEAEKVRKRNKAMGVED 257
Query: 242 SDEEGVGQSDDDDEDSLPFACFICRKPFVDPVVTKCKHYFCEHCALKHHSKNKKCFVCNE 301
D+E + D+DE++LPFACFICR+PFVDPVVTKCKHYFCEHCALKHH+KNKKCFVCN+
Sbjct: 258 EDDEA-DKDSDEDENALPFACFICREPFVDPVVTKCKHYFCEHCALKHHTKNKKCFVCNQ 316
Query: 302 PTLGIFNTALEIRKRMAEEGKK 323
PT+GIFN A EI+KRMAEE K
Sbjct: 317 PTMGIFNAAHEIKKRMAEERSK 338
|
|
| TAIR|locus:2164320 AT5G06420 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0038772 CG4973 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040825-1 rnf113a "ring finger protein 113A" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RUA4 LOC100514886 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q67ER3 RNF113A "Zinc finger protein 183" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BF77 LOC518027 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5PPN1 Rnf113a1 "Ring finger protein 113A1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q67ER4 RNF113A "RING finger protein 113A" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RE92 LOC100855580 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_Genewise1_v1.C_LG_XIV1660 | hypothetical protein (323 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 323 | |||
| COG5152 | 259 | COG5152, COG5152, Uncharacterized conserved protei | 7e-34 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 2e-10 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 7e-08 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 5e-07 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 5e-07 | |
| pfam00642 | 27 | pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H t | 1e-06 | |
| pfam13920 | 49 | pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI | 1e-05 | |
| smart00356 | 27 | smart00356, ZnF_C3H1, zinc finger | 5e-05 | |
| pfam00097 | 40 | pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING | 4e-04 | |
| pfam13445 | 55 | pfam13445, zf-RING_LisH, RING-type zinc-finger, Li | 6e-04 | |
| TIGR00599 | 397 | TIGR00599, rad18, DNA repair protein rad18 | 0.002 |
| >gnl|CDD|227481 COG5152, COG5152, Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
Score = 124 bits (313), Expect = 7e-34
Identities = 61/139 (43%), Positives = 82/139 (58%), Gaps = 17/139 (12%)
Query: 177 IRVTARFDYQPDICKDYKETGYCGYGDSCKFMHDRGDYKSGWQMEKEWEEAEKARKRNLA 236
R D QPD+CKDYKETGYCGYGDSCKF+HDR D+K+GW++ +EW AE
Sbjct: 131 FRDGEVIDTQPDVCKDYKETGYCGYGDSCKFLHDRSDFKTGWKLNQEW-NAEY------- 182
Query: 237 LGGGDSDEEGVGQSDDDDEDSLPFACFICRKPFVDPVVTKCKHYFCEHCALKHHSKNKKC 296
EE S ++ +PF C IC+K + PVVT+C H FC CA++ + K +C
Sbjct: 183 -------EEAPVISGPGEK--IPFLCGICKKDYESPVVTECGHSFCSLCAIRKYQKGDEC 233
Query: 297 FVCNEPTLGIFNTALEIRK 315
VC + T G F +++K
Sbjct: 234 GVCGKATYGRFWVVSDLQK 252
|
Length = 259 |
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|144294 pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H type (and similar) | Back alignment and domain information |
|---|
| >gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|214632 smart00356, ZnF_C3H1, zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif | Back alignment and domain information |
|---|
| >gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 323 | |||
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 100.0 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 100.0 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.02 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 99.01 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 99.0 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 98.94 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.93 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 98.84 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.84 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.72 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.72 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.71 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.67 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 98.67 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.57 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.52 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 98.51 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.51 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 98.5 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.48 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 98.46 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.46 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 98.38 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.37 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.37 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 98.27 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.21 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 98.07 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 98.07 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 98.04 | |
| PF00642 | 27 | zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si | 98.03 | |
| PHA03096 | 284 | p28-like protein; Provisional | 97.92 | |
| smart00356 | 27 | ZnF_C3H1 zinc finger. | 97.92 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.85 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 97.76 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.76 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.7 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 97.69 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.62 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.52 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.47 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 97.46 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 97.46 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 97.42 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 97.34 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.27 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 97.15 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 96.84 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.47 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 96.43 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 96.36 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 96.35 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.05 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.0 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 95.8 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 95.76 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 95.59 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.57 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 95.41 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 95.34 | |
| KOG4367 | 699 | consensus Predicted Zn-finger protein [Function un | 95.32 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 95.29 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.17 | |
| KOG1677 | 332 | consensus CCCH-type Zn-finger protein [General fun | 95.02 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 94.87 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 94.84 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 94.79 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 94.69 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 94.66 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 94.54 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.46 | |
| KOG3970 | 299 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.21 | |
| KOG2932 | 389 | consensus E3 ubiquitin ligase involved in ubiquiti | 94.01 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.86 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 93.67 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 92.53 | |
| PF14608 | 19 | zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type | 92.36 | |
| KOG2817 | 394 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.15 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 92.04 | |
| KOG3800 | 300 | consensus Predicted E3 ubiquitin ligase containing | 92.02 | |
| KOG4445 | 368 | consensus Uncharacterized conserved protein, conta | 91.52 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 91.35 | |
| PF03854 | 50 | zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc | 91.09 | |
| KOG3113 | 293 | consensus Uncharacterized conserved protein [Funct | 90.41 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 90.39 | |
| KOG1100 | 207 | consensus Predicted E3 ubiquitin ligase [Posttrans | 89.91 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 89.52 | |
| KOG0298 | 1394 | consensus DEAD box-containing helicase-like transc | 89.32 | |
| KOG2930 | 114 | consensus SCF ubiquitin ligase, Rbx1 component [Po | 89.23 | |
| KOG2185 | 486 | consensus Predicted RNA-processing protein, contai | 88.95 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 88.67 | |
| KOG4362 | 684 | consensus Transcriptional regulator BRCA1 [Replica | 88.61 | |
| PF02891 | 50 | zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 | 88.45 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 88.37 | |
| KOG1940 | 276 | consensus Zn-finger protein [General function pred | 88.24 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 88.03 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 88.02 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 87.59 | |
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 87.09 | |
| PF03194 | 254 | LUC7: LUC7 N_terminus; InterPro: IPR004882 This fa | 85.65 | |
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 85.04 | |
| KOG3161 | 861 | consensus Predicted E3 ubiquitin ligase [Posttrans | 84.27 | |
| COG5109 | 396 | Uncharacterized conserved protein, contains RING Z | 84.19 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 83.27 | |
| PF10235 | 90 | Cript: Microtubule-associated protein CRIPT; Inter | 82.51 | |
| KOG2068 | 327 | consensus MOT2 transcription factor [Transcription | 81.58 | |
| KOG3579 | 352 | consensus Predicted E3 ubiquitin ligase [Posttrans | 81.02 | |
| KOG1677 | 332 | consensus CCCH-type Zn-finger protein [General fun | 80.94 |
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.9e-67 Score=493.23 Aligned_cols=255 Identities=45% Similarity=0.793 Sum_probs=215.8
Q ss_pred eeccCCCCCCCCCceeecCCCccC-----CC---CCCCCCCCCceeeeeccccccc--cccCccccccccccchhhhHHH
Q 020671 47 LQNLKKPTKPDSKLYFSTGPSKRD-----TS---ADSNADSEKPIFQFESSKEIQV--QHDSKATATLETETDFLRDSRA 116 (323)
Q Consensus 47 ~~~~~~~~~~~~~~~~~t~~~~~~-----~~---~~~~~~~~~~~~~~~~~~~~~~--~~~~~at~~~e~~t~~~~d~~a 116 (323)
+++..+..+..|||+|++..+-.. .. +..+.+.+.+.|.|.|.+++.+ +.|+|||+++|++|+..+||||
T Consensus 41 s~r~ek~~k~~~p~~q~~k~~~k~~~~~~~~s~~s~~~~~~ed~vv~y~s~~~~~~~g~~dsgat~t~e~~te~~~Daqa 120 (313)
T KOG1813|consen 41 SSRLEKLEKKIKPETQRKKETDKVLTGEEDDSALSICQNPFEDPVVTYCSCDKCALKGHTDSGATATLEEPTEGLRDAQA 120 (313)
T ss_pred hhhhhhhhhhcchHhhhhhhhcccccccccccccccccCcccccceeeccccccccCCccccCceeEeecCcccchhHHH
Confidence 445555556789999997443211 11 1222335678999999888875 4599999999999999999999
Q ss_pred HHHHHHhhhHHHhcCCCCCCCccccccccccccccccccccccccCCCCCCCCCcccCceeecceeeccCCCCccccccc
Q 020671 117 LREKVLKRSEEALKGKASGDEKLYKGIHGYVDHKAGFRREHTVSSEKAGGSHGPLRASAHIRVTARFDYQPDICKDYKET 196 (323)
Q Consensus 117 ~~e~~~~~~~~~~~~~~~~~d~~yrg~~~y~~~~~~~~~~~~~~~~~~~~~~gP~ra~~nir~t~~~DyqPDiCKdYkeT 196 (323)
|+|++++...+.+.|+ .++++|+|+|+|++|.+ ..++..+|...|.+=|||||+|||++++|||||||||||++|
T Consensus 121 ~~er~~k~~~e~~~~k--~~~~lykg~~~ya~~~k---~~~~~~~n~s~g~~rpira~~~~r~~~~~d~qpDicKdykeT 195 (313)
T KOG1813|consen 121 IIERRIKEEREKLRGK--KDTKLYKGINTYADDAK---AQKVVKMNESIGTVRPIRAAMHTRAGERIDYQPDICKDYKET 195 (313)
T ss_pred HhhhhHHHHHHhhcch--hHHHHHHHHHHHHhhhh---hhhhHhhhcccccccccchhhhhcccceeecCchhhhhhHhh
Confidence 9999999555568886 48999999999999987 455555666666444999999999999999999999999999
Q ss_pred cccCCCCccceeecccccccccccchhHHHHHHHHHhhhhcCCCCCCCCCCCCCCCCCCCCCCccccccccCCCCcEEcc
Q 020671 197 GYCGYGDSCKFMHDRGDYKSGWQMEKEWEEAEKARKRNLALGGGDSDEEGVGQSDDDDEDSLPFACFICRKPFVDPVVTK 276 (323)
Q Consensus 197 G~CgfGDsCkFlHdR~dyk~GwqlerEwee~qk~kk~rl~~g~~~~eed~~~~e~~ddee~~p~~C~IC~e~~~~PVvt~ 276 (323)
|||||||||+|||+|+|||+||||+.||++.+. .+.....+.+.+||.|.||++.|.+||+|.
T Consensus 196 gycg~gdSckFlh~r~DyK~GWqi~~e~d~~ke-----------------~~~~~~~D~~~~Pf~c~icr~~f~~pVvt~ 258 (313)
T KOG1813|consen 196 GYCGYGDSCKFLHDRSDYKAGWQIEFEWDSAKE-----------------KKRVKIEDIELLPFKCFICRKYFYRPVVTK 258 (313)
T ss_pred Ccccccchhhhhhhhhhccccceeehhhhcccc-----------------ccceecCCcccCCccccccccccccchhhc
Confidence 999999999999999999999999999998752 223344567889999999999999999999
Q ss_pred CCCcccHHHHHHhccCCCCCCCCCCCCCCchhhHHHHHHHHHHhcCC
Q 020671 277 CKHYFCEHCALKHHSKNKKCFVCNEPTLGIFNTALEIRKRMAEEGKK 323 (323)
Q Consensus 277 CGH~FC~~Ci~~~~~~s~~CP~Cr~~t~gvfn~Ak~L~~kLk~~kq~ 323 (323)
|+|+||..|++..++....|++|.++++|+||++++|+.+|+.++++
T Consensus 259 c~h~fc~~ca~~~~qk~~~c~vC~~~t~g~~~~akeL~~~L~~kks~ 305 (313)
T KOG1813|consen 259 CGHYFCEVCALKPYQKGEKCYVCSQQTHGSFNVAKELLVSLKLKKSD 305 (313)
T ss_pred CCceeehhhhccccccCCcceecccccccccchHHHHHHHHHhhhhh
Confidence 99999999999999999999999999999999999999999987753
|
|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >smart00356 ZnF_C3H1 zinc finger | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >KOG4367 consensus Predicted Zn-finger protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14608 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type | Back alignment and domain information |
|---|
| >KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG3113 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2185 consensus Predicted RNA-processing protein, contains G-patch domain [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] | Back alignment and domain information |
|---|
| >PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG1940 consensus Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF03194 LUC7: LUC7 N_terminus; InterPro: IPR004882 This family consists of several LUC7 protein homologues that are restricted to eukaryotes | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >PF10235 Cript: Microtubule-associated protein CRIPT; InterPro: IPR019367 The CRIPT protein is a cytoskeletal protein involved in microtubule production | Back alignment and domain information |
|---|
| >KOG2068 consensus MOT2 transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 323 | ||||
| 2csy_A | 81 | Solution Structure Of The Ring Domain Of The Zinc F | 6e-17 |
| >pdb|2CSY|A Chain A, Solution Structure Of The Ring Domain Of The Zinc Finger Protein 183-Like 1 Length = 81 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 323 | |||
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 3e-32 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 1e-09 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 3e-09 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 4e-09 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 4e-09 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 1e-08 | |
| 4epo_C | 149 | E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 | 1e-08 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 3e-08 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 3e-08 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 8e-08 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 2e-07 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 2e-07 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 2e-07 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 3e-07 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 4e-07 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 5e-07 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 5e-07 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 6e-07 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 6e-07 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 9e-07 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 1e-06 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 1e-06 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 2e-06 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 2e-06 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 3e-06 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 3e-06 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 7e-06 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 1e-05 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 1e-05 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 2e-05 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 2e-05 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 3e-05 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 3e-05 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 4e-05 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 5e-05 | |
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 2e-04 | |
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 6e-04 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 5e-04 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 8e-04 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 9e-04 |
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
Score = 114 bits (286), Expect = 3e-32
Identities = 37/76 (48%), Positives = 53/76 (69%)
Query: 248 GQSDDDDEDSLPFACFICRKPFVDPVVTKCKHYFCEHCALKHHSKNKKCFVCNEPTLGIF 307
G S +E+ +PF CFICR+ F +PVVTKC+HYFCE CAL+H +C++C++PT GIF
Sbjct: 4 GSSGGSEEEEIPFRCFICRQAFQNPVVTKCRHYFCESCALEHFRATPRCYICDQPTGGIF 63
Query: 308 NTALEIRKRMAEEGKK 323
N A E+ ++ + G
Sbjct: 64 NPAKELMAKLQKSGPS 79
|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Length = 61 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Length = 101 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 | Back alignment and structure |
|---|
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 323 | |||
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.52 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.21 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.2 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.19 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.18 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.18 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.17 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.16 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.16 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 99.16 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.15 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.13 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.13 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 99.12 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.11 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.11 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.1 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 99.09 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.09 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 99.09 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.08 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 99.08 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 99.08 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 99.07 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.06 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 99.05 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 99.04 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 99.03 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 99.03 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.02 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 99.0 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 98.98 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 98.97 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 98.97 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 98.97 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.97 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 98.96 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 98.96 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 98.95 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 98.93 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 98.92 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 98.91 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 98.89 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 98.88 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 98.87 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.86 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.85 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.82 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.8 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.77 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.75 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.74 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.74 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.74 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.72 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 98.69 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 98.69 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.65 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.64 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.56 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.55 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 98.52 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.34 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 98.34 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.24 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 98.16 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 98.11 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 97.62 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 97.5 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 97.2 | |
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 97.06 | |
| 2d9m_A | 69 | Zinc finger CCCH-type domain containing protein 7A | 96.59 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 96.45 | |
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 96.32 | |
| 2cqe_A | 98 | KIAA1064 protein; CCCH zinc-finger, structural gen | 95.98 | |
| 2cqe_A | 98 | KIAA1064 protein; CCCH zinc-finger, structural gen | 95.93 | |
| 2d9n_A | 77 | Cleavage and polyadenylation specificity factor, 3 | 95.68 | |
| 2rhk_C | 72 | Cleavage and polyadenylation specificity factor su | 95.56 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 95.13 | |
| 3d2q_A | 70 | Muscleblind-like protein 1; tandem zinc finger dom | 94.81 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 93.86 | |
| 2fc6_A | 50 | Nuclear, target of EGR1, member 1; structure genom | 93.5 | |
| 2rpp_A | 89 | Muscleblind-like protein 2; zinc finger domain, C3 | 93.4 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 93.06 | |
| 3d2n_A | 83 | Muscleblind-like protein 1; tandem zinc finger dom | 92.61 | |
| 2d9n_A | 77 | Cleavage and polyadenylation specificity factor, 3 | 91.46 | |
| 2e5s_A | 98 | Otthump00000018578; ZF-CCCHX2 domain, muscleblind- | 90.94 | |
| 3d2q_A | 70 | Muscleblind-like protein 1; tandem zinc finger dom | 89.62 | |
| 2rhk_C | 72 | Cleavage and polyadenylation specificity factor su | 87.56 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 87.25 | |
| 2e5s_A | 98 | Otthump00000018578; ZF-CCCHX2 domain, muscleblind- | 86.9 | |
| 3u9g_A | 229 | Zinc finger CCCH-type antiviral protein 1; zinc fi | 85.59 | |
| 3u1l_A | 240 | PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; | 84.33 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 84.19 |
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.52 E-value=7e-15 Score=112.73 Aligned_cols=68 Identities=51% Similarity=1.214 Sum_probs=61.0
Q ss_pred CCCCCccccccccCCCCcEEccCCCcccHHHHHHhccCCCCCCCCCCCCCCchhhHHHHHHHHHHhcC
Q 020671 255 EDSLPFACFICRKPFVDPVVTKCKHYFCEHCALKHHSKNKKCFVCNEPTLGIFNTALEIRKRMAEEGK 322 (323)
Q Consensus 255 ee~~p~~C~IC~e~~~~PVvt~CGH~FC~~Ci~~~~~~s~~CP~Cr~~t~gvfn~Ak~L~~kLk~~kq 322 (323)
+....+.|+||++.+.+|++++|||+||..|+..|+.....||+|+.++..+++....|+.+|++.++
T Consensus 11 ~~~~~~~C~IC~~~~~~p~~~~CgH~fC~~Ci~~~~~~~~~CP~Cr~~~~~~~~~~~~l~~~~~~~~~ 78 (81)
T 2csy_A 11 EEEIPFRCFICRQAFQNPVVTKCRHYFCESCALEHFRATPRCYICDQPTGGIFNPAKELMAKLQKSGP 78 (81)
T ss_dssp CCCCCSBCSSSCSBCCSEEECTTSCEEEHHHHHHHHHHCSBCSSSCCBCCSCCEECHHHHHHHSSSCS
T ss_pred cCCCCCCCcCCCchhcCeeEccCCCHhHHHHHHHHHHCCCcCCCcCccccccCCcHHHHHHHHHhhCc
Confidence 44556799999999999999999999999999999988899999999999999999999888876543
|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A | Back alignment and structure |
|---|
| >2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A | Back alignment and structure |
|---|
| >2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 | Back alignment and structure |
|---|
| >2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 | Back alignment and structure |
|---|
| >2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A | Back alignment and structure |
|---|
| >2fc6_A Nuclear, target of EGR1, member 1; structure genomics, ZF-CCCH domain, member 1(nuclear), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.66.1.1 | Back alignment and structure |
|---|
| >2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A | Back alignment and structure |
|---|
| >2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u9g_A Zinc finger CCCH-type antiviral protein 1; zinc finger protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 323 | ||||
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 2e-09 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 3e-08 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 4e-08 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 1e-07 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 2e-07 | |
| d1t1ha_ | 78 | g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre | 1e-06 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 1e-05 | |
| d2baya1 | 56 | g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { | 6e-05 | |
| d1m9oa_ | 40 | g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475 | 5e-04 | |
| d1rgoa1 | 36 | g.66.1.1 (A:151-186) Butyrate response factor 2 (T | 6e-04 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 8e-04 | |
| d1rgoa2 | 34 | g.66.1.1 (A:187-220) Butyrate response factor 2 (T | 0.001 | |
| d1wgma_ | 98 | g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Hu | 0.001 | |
| d2c2la2 | 80 | g.44.1.2 (A:225-304) STIP1 homology and U box-cont | 0.003 |
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: V(D)J recombination activating protein 1 (RAG1), dimerization domain species: Mouse (Mus musculus) [TaxId: 10090]
Score = 51.8 bits (124), Expect = 2e-09
Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 1/44 (2%)
Query: 260 FACFICRKPFVDPVVTKCKHYFCEHCALKH-HSKNKKCFVCNEP 302
+C IC DPV T CKH FC C L+ C C P
Sbjct: 24 ISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYP 67
|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
| >d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 | Back information, alignment and structure |
|---|
| >d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 34 | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 323 | |||
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.27 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.13 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.12 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.08 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 99.06 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 99.04 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 99.04 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 99.03 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.02 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.95 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 98.87 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.85 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 98.84 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.57 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 98.54 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.35 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 97.92 | |
| d2cqea2 | 29 | Zinc finger CCCH domain-containing protein C19orf7 | 97.73 | |
| d1rgoa2 | 34 | Butyrate response factor 2 (Tis11D) {Human (Homo s | 97.45 | |
| d1m9oa_ | 40 | Tristetraproline (ttp, tis11, nup475) {Mouse (Mus | 97.4 | |
| d1rgoa1 | 36 | Butyrate response factor 2 (Tis11D) {Human (Homo s | 97.32 | |
| d2cqea1 | 56 | Zinc finger CCCH domain-containing protein C19orf7 | 94.86 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 89.75 |
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: V(D)J recombination activating protein 1 (RAG1), dimerization domain species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.27 E-value=9.7e-13 Score=102.23 Aligned_cols=60 Identities=28% Similarity=0.641 Sum_probs=50.1
Q ss_pred CccccccccCCCCcEEccCCCcccHHHHHHhcc-CCCCCCCCCCCCC--CchhhHHHHHHHHH
Q 020671 259 PFACFICRKPFVDPVVTKCKHYFCEHCALKHHS-KNKKCFVCNEPTL--GIFNTALEIRKRMA 318 (323)
Q Consensus 259 p~~C~IC~e~~~~PVvt~CGH~FC~~Ci~~~~~-~s~~CP~Cr~~t~--gvfn~Ak~L~~kLk 318 (323)
.+.|+||++.+.+|++|+|||.||..||.+|+. ....||.||.+.. .+..+++.++..|.
T Consensus 23 ~l~C~IC~~~~~~pv~~~CgH~FC~~Ci~~~~~~~~~~CP~Cr~p~~~~~l~~P~~~~l~~l~ 85 (86)
T d1rmda2 23 SISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPCFPTDLESPVKSFLNILN 85 (86)
T ss_dssp HTBCTTTCSBCSSEEECTTSCEEEHHHHHHHHHHTCSBCTTTCCBCCGGGCBCCCHHHHHHHH
T ss_pred CcCCccCCcchhcceecCCCChhhHHHHHHHHhhCCCcCcccCCCCChhhccCHHHHHHHHhc
Confidence 468999999999999999999999999999986 6678999999754 33456667776663
|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqea1 g.66.1.1 (A:458-513) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|