Citrus Sinensis ID: 020671

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320---
MAESGSGEAQQAEQVCNFFRKPTKNKNIRKRTIREDEDEDSIESSVLQNLKKPTKPDSKLYFSTGPSKRDTSADSNADSEKPIFQFESSKEIQVQHDSKATATLETETDFLRDSRALREKVLKRSEEALKGKASGDEKLYKGIHGYVDHKAGFRREHTVSSEKAGGSHGPLRASAHIRVTARFDYQPDICKDYKETGYCGYGDSCKFMHDRGDYKSGWQMEKEWEEAEKARKRNLALGGGDSDEEGVGQSDDDDEDSLPFACFICRKPFVDPVVTKCKHYFCEHCALKHHSKNKKCFVCNEPTLGIFNTALEIRKRMAEEGKK
ccccccccccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEccccccccHHHHHHHccccccccccccccccccccHHHHHHHHHHHccc
ccccccccccccccEEEEEEcccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccEEEEcccccccccccccccEEEEccccHHHHHHHHHHHHHHHHHHHHccccccccccEccccccHHHHccccccccccccccccccccccccccEEEEEEEcccccHHHcHHHccccccccccHHHccccHHHccccHHHHHHHHHcccccccccccccccccccccccccHHHccccEEEEEcccccccEEEcccccccHHHHHHHHccccccEEccccccccccHHHHHHHHHHHHHcc
maesgsgeaQQAEQVCNFfrkptknknirkrtiredededsiESSVLQnlkkptkpdsklyfstgpskrdtsadsnadsekpifqfesskeiqvqHDSKATATLETETDFLRDSRALREKVLKRSEEALkgkasgdeklykgihgyvdhkagfrrehtvssekaggshgplrasAHIRVTarfdyqpdickdyketgycgygdsckfmhdrgdyksgwQMEKEWEEAEKARKRNlalgggdsdeegvgqsddddedslpfacficrkpfvdpvvtkckhyfcehcalkhhsknkkcfvcneptlgiFNTALEIRKRMAEEGKK
maesgsgeaqqaeqvcnffrkptknknirkrtiredededsiessvlqnlkkptkpdsklyfstgpskrdtsadsnadSEKPIFqfesskeiqvqhdskatatletetdflrdsrALREKVLKrseealkgkasgdeklykGIHGYVDHKAGFRREHTVssekaggshgplraSAHIRVTARFDYQPDICKDYKETGYCGYGDSCKFMHDRGDYKSGWQMEKEWEEAEKARKRNlalgggdsdeegvgQSDDDDEDSLPFACFICRKPFVDPVVTKCKHYFCEHCALkhhsknkkcfvcnEPTLGIFNTALEIRKRMAEEGKK
MAESGSGEAQQAEQVCNFFRKPTKNKNIRKRTIRedededsiessVLQNLKKPTKPDSKLYFSTGPSKRDTSADSNADSEKPIFQFESSKEIQVQHDSKATATLETETDFLRDSRALREKVLKRSEEALKGKASGDEKLYKGIHGYVDHKAGFRREHTVSSEKAGGSHGPLRASAHIRVTARFDYQPDICKDYKETGYCGYGDSCKFMHDRGDYKSGWQMekeweeaekarkrNLALGGGDSDEEGVGQSDDDDEDSLPFACFICRKPFVDPVVTKCKHYFCEHCALKHHSKNKKCFVCNEPTLGIFNTALEIRKRMAEEGKK
******************************************************************************************************************************************LYKGIHGYVDHKAG*********************SAHIRVTARFDYQPDICKDYKETGYCGYGDSCKFMHDRGDYKSGW***************************************LPFACFICRKPFVDPVVTKCKHYFCEHCALKHHSKNKKCFVCNEPTLGIFNTALEI**********
*******************************************************************************************************************************************************************************HIRVTARFDYQPDICKDYKETGYCGYGDSCKFMHDRGD********************************************LPFACFICRKPFVDPVVTKCKHYFCEHCALKHHSKNKKCFVCNEPTLGIFNTALEIR**MA*****
************EQVCNFFRKPTKNKNIRKR***************LQNLKKPTKPDSKLYFSTG*************SEKPIFQFESSK**********TATLETETDFLRDSRALREKVLKRSEEALKGKASGDEKLYKGIHGYVDHKAGFR****************LRASAHIRVTARFDYQPDICKDYKETGYCGYGDSCKFMHDRGDYKSGWQMEKEWEEAEKARKRNLALG****************EDSLPFACFICRKPFVDPVVTKCKHYFCEHCALKHHSKNKKCFVCNEPTLGIFNTALEIRK********
*************QVC***RKP*****************************************************************SSKEIQVQHDSKATATLETETDFLRDSRALREKVLKRSEEALKGKASGDEKLYKGIHGYVDHKAG***************HGPLRASAHIRVTARFDYQPDICKDYKETGYCGYGDSCKFMHDRGDYKSGWQMEKEWEEAEK***********************DDEDSLPFACFICRKPFVDPVVTKCKHYFCEHCALKHHSKNKKCFVCNEPTLGIFNTALEIRKRMAEEG**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAESGSGEAQQAEQVCNFFRKPTKNKNIRKRTIREDEDEDSIESSVLQNLKKPTKPDSKLYFSTGPSKRDTSADSNADSEKPIFQFESSKEIQVQHDSKATATLETETDFLRDSRALREKVLKRSEEALKGKASGDEKLYKGIHGYVDHKAGFRREHTVSSEKAGGSHGPLRASAHIRVTARFDYQPDICKDYKETGYCGYGDSCKFMHDRGDYKSGWQMEKEWEEAEKARKRNLALGGGDSDEEGVGQSDDDDEDSLPFACFICRKPFVDPVVTKCKHYFCEHCALKHHSKNKKCFVCNEPTLGIFNTALEIRKRMAEEGKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query323 2.2.26 [Sep-21-2011]
Q8GX84343 Zinc finger CCCH domain-c yes no 0.975 0.918 0.732 1e-134
Q9FNG6378 Zinc finger CCCH domain-c no no 0.981 0.838 0.726 1e-134
Q6K4V3326 Zinc finger CCCH domain-c yes no 0.925 0.917 0.658 1e-103
Q8IZP6322 RING finger protein 113B yes no 0.922 0.925 0.371 2e-52
O15541343 RING finger protein 113A no no 0.631 0.594 0.463 1e-50
Q67ER4343 RING finger protein 113A no no 0.631 0.594 0.459 2e-50
Q4P400355 Pre-mRNA-splicing factor N/A no 0.755 0.687 0.387 3e-48
Q55G16355 RING finger protein 113 h yes no 0.554 0.504 0.472 9e-46
O17917384 RING finger protein 113 h yes no 0.851 0.716 0.386 3e-45
P0CQ64329 Pre-mRNA-splicing factor yes no 0.857 0.841 0.335 2e-40
>sp|Q8GX84|C3H1_ARATH Zinc finger CCCH domain-containing protein 1 OS=Arabidopsis thaliana GN=At1g01350 PE=2 SV=2 Back     alignment and function desciption
 Score =  478 bits (1231), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 236/322 (73%), Positives = 278/322 (86%), Gaps = 7/322 (2%)

Query: 6   SGEAQQAEQVCNFFRKPTKNKNIRKRTIREDE-DEDS-IESSVLQNLKKPTKPDSKLYFS 63
           + +  Q++QVC FF+KPTK+KNIRKRTI  DE D DS  ESS+LQNLKK  KPDSKLYFS
Sbjct: 20  AAQETQSQQVCTFFKKPTKSKNIRKRTIDADEEDGDSKSESSILQNLKKVAKPDSKLYFS 79

Query: 64  TGPSKRDTSADSNADSEKPIFQFESSKEIQVQHDSKATATLETETDFLRDSRALREKVLK 123
           +GPSK  T+  ++   E+ +F ++SSKEIQVQ+DS ATATLETETDF +D+RA+RE+VLK
Sbjct: 80  SGPSKSSTT--TSGAPERSVFHYDSSKEIQVQNDSGATATLETETDFNQDARAIRERVLK 137

Query: 124 RSEEALKG--KASGDEKLYKGIHGYVDHKAGFRREHTVSSEKAGGSHGPLRASAHIRVTA 181
           +++EALKG  K + DEKLYKGIHGY DHKAGFRRE T+SSEKAGGSHGPLRASAHIRV+A
Sbjct: 138 KADEALKGNKKKASDEKLYKGIHGYTDHKAGFRREQTISSEKAGGSHGPLRASAHIRVSA 197

Query: 182 RFDYQPDICKDYKETGYCGYGDSCKFMHDRGDYKSGWQMEKEWEEAEKARKRNLALGGGD 241
           RFDYQPDICKDYKETGYCGYGDSCKF+HDRGDYK GWQ+EKEWEEAEK RKRN A+ G +
Sbjct: 198 RFDYQPDICKDYKETGYCGYGDSCKFLHDRGDYKPGWQIEKEWEEAEKVRKRNKAM-GVE 256

Query: 242 SDEEGVGQSDDDDEDSLPFACFICRKPFVDPVVTKCKHYFCEHCALKHHSKNKKCFVCNE 301
            +++   +  D+DE++LPFACFICR+PFVDPVVTKCKHYFCEHCALKHH+KNKKCFVCN+
Sbjct: 257 DEDDEADKDSDEDENALPFACFICREPFVDPVVTKCKHYFCEHCALKHHTKNKKCFVCNQ 316

Query: 302 PTLGIFNTALEIRKRMAEEGKK 323
           PT+GIFN A EI+KRMAEE  K
Sbjct: 317 PTMGIFNAAHEIKKRMAEERSK 338

Arabidopsis thaliana (taxid: 3702)
>sp|Q9FNG6|C3H51_ARATH Zinc finger CCCH domain-containing protein 51 OS=Arabidopsis thaliana GN=At5g06420 PE=2 SV=1 Back     alignment and function description
>sp|Q6K4V3|C3H15_ORYSJ Zinc finger CCCH domain-containing protein 15 OS=Oryza sativa subsp. japonica GN=Os02g0301000 PE=2 SV=1 Back     alignment and function description
>sp|Q8IZP6|R113B_HUMAN RING finger protein 113B OS=Homo sapiens GN=RNF113B PE=1 SV=3 Back     alignment and function description
>sp|O15541|R113A_HUMAN RING finger protein 113A OS=Homo sapiens GN=RNF113A PE=1 SV=1 Back     alignment and function description
>sp|Q67ER4|R113A_BOVIN RING finger protein 113A OS=Bos taurus GN=RNF113A PE=2 SV=1 Back     alignment and function description
>sp|Q4P400|CWC24_USTMA Pre-mRNA-splicing factor CWC24 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CWC24 PE=3 SV=1 Back     alignment and function description
>sp|Q55G16|RN113_DICDI RING finger protein 113 homolog OS=Dictyostelium discoideum GN=rnf113 PE=4 SV=1 Back     alignment and function description
>sp|O17917|RN113_CAEEL RING finger protein 113 homolog OS=Caenorhabditis elegans GN=rnf-113 PE=2 SV=2 Back     alignment and function description
>sp|P0CQ64|CWC24_CRYNJ Pre-mRNA-splicing factor CWC24 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CWC24 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query323
449463408322 PREDICTED: zinc finger CCCH domain-conta 0.978 0.981 0.774 1e-140
255562324325 RING finger protein 113A, putative [Rici 0.981 0.975 0.770 1e-140
224130524323 predicted protein [Populus trichocarpa] 0.990 0.990 0.776 1e-138
359489721331 PREDICTED: zinc finger CCCH domain-conta 0.993 0.969 0.777 1e-138
297848380342 zinc finger family protein [Arabidopsis 0.972 0.918 0.732 1e-134
186478011343 zinc finger CCCH domain-containing prote 0.975 0.918 0.732 1e-132
15240037378 zinc finger CCCH domain-containing prote 0.981 0.838 0.726 1e-132
26451788343 unknown protein [Arabidopsis thaliana] 0.975 0.918 0.732 1e-132
22531136378 putative protein [Arabidopsis thaliana] 0.981 0.838 0.723 1e-131
357511311387 Zinc finger CCCH domain-containing prote 0.984 0.821 0.731 1e-131
>gi|449463408|ref|XP_004149426.1| PREDICTED: zinc finger CCCH domain-containing protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  503 bits (1294), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 247/319 (77%), Positives = 284/319 (89%), Gaps = 3/319 (0%)

Query: 4   SGSGEAQQAEQVCNFFRKPTKNKNIRKRTIREDEDEDS-IESSVLQNLKKPTKPDSKLYF 62
           + +G+ Q +EQVC+FFRKPTKNKNIRKRT+ EDE+EDS  E+S L N KK  K +SKLYF
Sbjct: 2   TDTGDTQPSEQVCSFFRKPTKNKNIRKRTVDEDEEEDSKAETSFLLNQKKAPKTESKLYF 61

Query: 63  STGPSKRDTSADSNADSEKPIFQFESSKEIQVQHDSKATATLETETDFLRDSRALREKVL 122
           S+GPSK  +S +SN +  KPIFQFESSKEIQV HDS+ATATLETETDF RD+RA+RE+VL
Sbjct: 62  SSGPSKNSSSNESNVEPNKPIFQFESSKEIQVHHDSRATATLETETDFSRDARAIRERVL 121

Query: 123 KRSEEALKGK--ASGDEKLYKGIHGYVDHKAGFRREHTVSSEKAGGSHGPLRASAHIRVT 180
           K++EEALKGK  +SG EKLYKG++ YVD+KAGFRREHT+SSEKAGG+HGPLRASAHIR +
Sbjct: 122 KQAEEALKGKGKSSGGEKLYKGVNAYVDYKAGFRREHTISSEKAGGAHGPLRASAHIRAS 181

Query: 181 ARFDYQPDICKDYKETGYCGYGDSCKFMHDRGDYKSGWQMEKEWEEAEKARKRNLALGGG 240
           ARFDYQPDICKDYKETGYCGYGD+CKFMHDRGDYKSGWQ+EKEWEE EKARKR LA+   
Sbjct: 182 ARFDYQPDICKDYKETGYCGYGDACKFMHDRGDYKSGWQLEKEWEEVEKARKRKLAMKSD 241

Query: 241 DSDEEGVGQSDDDDEDSLPFACFICRKPFVDPVVTKCKHYFCEHCALKHHSKNKKCFVCN 300
           D DE+   QSD+D+ED+LPFACFICR+PFVDPVVTKCKHYFCEHCALKHH+KNKKCFVCN
Sbjct: 242 DGDEDTSEQSDEDEEDALPFACFICREPFVDPVVTKCKHYFCEHCALKHHAKNKKCFVCN 301

Query: 301 EPTLGIFNTALEIRKRMAE 319
           +PTLGIFNTA EIRKRMA+
Sbjct: 302 QPTLGIFNTAHEIRKRMAQ 320

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255562324|ref|XP_002522169.1| RING finger protein 113A, putative [Ricinus communis] gi|223538607|gb|EEF40210.1| RING finger protein 113A, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224130524|ref|XP_002320858.1| predicted protein [Populus trichocarpa] gi|222861631|gb|EEE99173.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359489721|ref|XP_002277034.2| PREDICTED: zinc finger CCCH domain-containing protein 1-like [Vitis vinifera] gi|297745423|emb|CBI40503.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297848380|ref|XP_002892071.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297337913|gb|EFH68330.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|186478011|ref|NP_171642.2| zinc finger CCCH domain-containing protein 1 [Arabidopsis thaliana] gi|229621709|sp|Q8GX84.2|C3H1_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 1; Short=AtC3H1 gi|225897850|dbj|BAH30257.1| hypothetical protein [Arabidopsis thaliana] gi|332189154|gb|AEE27275.1| zinc finger CCCH domain-containing protein 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15240037|ref|NP_196260.1| zinc finger CCCH domain-containing protein 51 [Arabidopsis thaliana] gi|30681442|ref|NP_850780.1| zinc finger CCCH domain-containing protein 51 [Arabidopsis thaliana] gi|75334125|sp|Q9FNG6.1|C3H51_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 51; Short=AtC3H51 gi|9758422|dbj|BAB08964.1| unnamed protein product [Arabidopsis thaliana] gi|21618279|gb|AAM67329.1| unknown [Arabidopsis thaliana] gi|332003629|gb|AED91012.1| zinc finger CCCH domain-containing protein 51 [Arabidopsis thaliana] gi|332003630|gb|AED91013.1| zinc finger CCCH domain-containing protein 51 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|26451788|dbj|BAC42988.1| unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|22531136|gb|AAM97072.1| putative protein [Arabidopsis thaliana] gi|23198042|gb|AAN15548.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357511311|ref|XP_003625944.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] gi|355500959|gb|AES82162.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query323
TAIR|locus:2035377343 AT1G01350 [Arabidopsis thalian 0.975 0.918 0.686 6.7e-120
TAIR|locus:2164320378 AT5G06420 [Arabidopsis thalian 0.981 0.838 0.671 2.3e-119
FB|FBgn0038772357 CG4973 [Drosophila melanogaste 0.792 0.717 0.425 9.6e-57
ZFIN|ZDB-GENE-040825-1321 rnf113a "ring finger protein 1 0.900 0.906 0.385 3.4e-54
UNIPROTKB|F1RUA4344 LOC100514886 "Uncharacterized 0.938 0.880 0.371 8.3e-51
UNIPROTKB|Q67ER3328 RNF113A "Zinc finger protein 1 0.727 0.716 0.423 1.3e-50
UNIPROTKB|E1BF77351 LOC518027 "Uncharacterized pro 0.668 0.615 0.45 4.6e-50
UNIPROTKB|Q5PPN1341 Rnf113a1 "Ring finger protein 0.931 0.882 0.364 1.5e-49
UNIPROTKB|Q67ER4343 RNF113A "RING finger protein 1 0.938 0.883 0.373 2.5e-49
UNIPROTKB|E2RE92348 LOC100855580 "Uncharacterized 0.736 0.683 0.410 3.2e-49
TAIR|locus:2035377 AT1G01350 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1180 (420.4 bits), Expect = 6.7e-120, P = 6.7e-120
 Identities = 221/322 (68%), Positives = 258/322 (80%)

Query:     6 SGEAQQAEQVCNFFRKPTKNKNIRKRTIRXXXXX--XXXXXXVLQNLKKPTKPDSKLYFS 63
             + +  Q++QVC FF+KPTK+KNIRKRTI              +LQNLKK  KPDSKLYFS
Sbjct:    20 AAQETQSQQVCTFFKKPTKSKNIRKRTIDADEEDGDSKSESSILQNLKKVAKPDSKLYFS 79

Query:    64 TGPSKRDTSADSNADSEKPIFQFESSKEIQVQHDSKATATLETETDFLRDSRALREKVLK 123
             +GPSK  T+  S A  E+ +F ++SSKEIQVQ+DS ATATLETETDF +D+RA+RE+VLK
Sbjct:    80 SGPSKSSTTT-SGAP-ERSVFHYDSSKEIQVQNDSGATATLETETDFNQDARAIRERVLK 137

Query:   124 RSEEALKG--KASGDEKLYKGIHGYVDHKAGFRREHTVSSEKAGGSHGPLRASAHIRVTA 181
             +++EALKG  K + DEKLYKGIHGY DHKAGFRRE T+SSEKAGGSHGPLRASAHIRV+A
Sbjct:   138 KADEALKGNKKKASDEKLYKGIHGYTDHKAGFRREQTISSEKAGGSHGPLRASAHIRVSA 197

Query:   182 RFDYQPDICKDYKETGYCGYGDSCKFMHDRGDYKSGWQMXXXXXXXXXXXXXNLALGGGD 241
             RFDYQPDICKDYKETGYCGYGDSCKF+HDRGDYK GWQ+             N A+G  D
Sbjct:   198 RFDYQPDICKDYKETGYCGYGDSCKFLHDRGDYKPGWQIEKEWEEAEKVRKRNKAMGVED 257

Query:   242 SDEEGVGQSDDDDEDSLPFACFICRKPFVDPVVTKCKHYFCEHCALKHHSKNKKCFVCNE 301
              D+E   +  D+DE++LPFACFICR+PFVDPVVTKCKHYFCEHCALKHH+KNKKCFVCN+
Sbjct:   258 EDDEA-DKDSDEDENALPFACFICREPFVDPVVTKCKHYFCEHCALKHHTKNKKCFVCNQ 316

Query:   302 PTLGIFNTALEIRKRMAEEGKK 323
             PT+GIFN A EI+KRMAEE  K
Sbjct:   317 PTMGIFNAAHEIKKRMAEERSK 338
GO:0003676 "nucleic acid binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
TAIR|locus:2164320 AT5G06420 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0038772 CG4973 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040825-1 rnf113a "ring finger protein 113A" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1RUA4 LOC100514886 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q67ER3 RNF113A "Zinc finger protein 183" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BF77 LOC518027 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q5PPN1 Rnf113a1 "Ring finger protein 113A1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q67ER4 RNF113A "RING finger protein 113A" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RE92 LOC100855580 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8IZP6R113B_HUMANNo assigned EC number0.37190.92260.9254yesno
P0CQ64CWC24_CRYNJNo assigned EC number0.33550.85750.8419yesno
Q6K4V3C3H15_ORYSJNo assigned EC number0.65830.92560.9171yesno
Q9FNG6C3H51_ARATHNo assigned EC number0.72640.98140.8386nono
Q8GX84C3H1_ARATHNo assigned EC number0.73290.97520.9183yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_LG_XIV1660
hypothetical protein (323 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query323
COG5152259 COG5152, COG5152, Uncharacterized conserved protei 7e-34
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 2e-10
cd0016245 cd00162, RING, RING-finger (Really Interesting New 7e-08
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 5e-07
smart0018440 smart00184, RING, Ring finger 5e-07
pfam0064227 pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H t 1e-06
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 1e-05
smart0035627 smart00356, ZnF_C3H1, zinc finger 5e-05
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 4e-04
pfam1344555 pfam13445, zf-RING_LisH, RING-type zinc-finger, Li 6e-04
TIGR00599 397 TIGR00599, rad18, DNA repair protein rad18 0.002
>gnl|CDD|227481 COG5152, COG5152, Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information 
 Score =  124 bits (313), Expect = 7e-34
 Identities = 61/139 (43%), Positives = 82/139 (58%), Gaps = 17/139 (12%)

Query: 177 IRVTARFDYQPDICKDYKETGYCGYGDSCKFMHDRGDYKSGWQMEKEWEEAEKARKRNLA 236
            R     D QPD+CKDYKETGYCGYGDSCKF+HDR D+K+GW++ +EW  AE        
Sbjct: 131 FRDGEVIDTQPDVCKDYKETGYCGYGDSCKFLHDRSDFKTGWKLNQEW-NAEY------- 182

Query: 237 LGGGDSDEEGVGQSDDDDEDSLPFACFICRKPFVDPVVTKCKHYFCEHCALKHHSKNKKC 296
                  EE    S   ++  +PF C IC+K +  PVVT+C H FC  CA++ + K  +C
Sbjct: 183 -------EEAPVISGPGEK--IPFLCGICKKDYESPVVTECGHSFCSLCAIRKYQKGDEC 233

Query: 297 FVCNEPTLGIFNTALEIRK 315
            VC + T G F    +++K
Sbjct: 234 GVCGKATYGRFWVVSDLQK 252

Length = 259
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|144294 pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H type (and similar) Back     alignment and domain information
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|214632 smart00356, ZnF_C3H1, zinc finger Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif Back     alignment and domain information
>gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 323
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 100.0
COG5152259 Uncharacterized conserved protein, contains RING a 100.0
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 99.02
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 99.01
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.0
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.94
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.93
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.84
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.84
PHA02929238 N1R/p28-like protein; Provisional 98.72
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.72
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.71
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.67
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.67
PF1463444 zf-RING_5: zinc-RING finger domain 98.57
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.52
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.51
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.51
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.5
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.48
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.46
PHA02926242 zinc finger-like protein; Provisional 98.46
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.38
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.37
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 98.37
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 98.27
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.21
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.07
COG5222427 Uncharacterized conserved protein, contains RING Z 98.07
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.04
PF0064227 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si 98.03
PHA03096284 p28-like protein; Provisional 97.92
smart0035627 ZnF_C3H1 zinc finger. 97.92
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.85
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.76
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 97.76
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.7
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.69
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 97.62
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 97.52
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.47
KOG2660 331 consensus Locus-specific chromosome binding protei 97.46
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 97.46
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 97.42
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 97.34
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 97.27
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 97.15
KOG0297 391 consensus TNF receptor-associated factor [Signal t 96.84
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 96.47
KOG1002 791 consensus Nucleotide excision repair protein RAD16 96.43
KOG0825 1134 consensus PHD Zn-finger protein [General function 96.36
PF04641260 Rtf2: Rtf2 RING-finger 96.35
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 96.05
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 96.0
COG5236 493 Uncharacterized conserved protein, contains RING Z 95.8
KOG3039303 consensus Uncharacterized conserved protein [Funct 95.76
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 95.59
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 95.57
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 95.41
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 95.34
KOG4367 699 consensus Predicted Zn-finger protein [Function un 95.32
KOG4739 233 consensus Uncharacterized protein involved in syna 95.29
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 95.17
KOG1677332 consensus CCCH-type Zn-finger protein [General fun 95.02
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 94.87
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 94.84
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 94.79
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 94.69
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 94.66
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 94.54
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 94.46
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 94.21
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 94.01
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 93.86
KOG149384 consensus Anaphase-promoting complex (APC), subuni 93.67
KOG3002 299 consensus Zn finger protein [General function pred 92.53
PF1460819 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type 92.36
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 92.15
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 92.04
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 92.02
KOG4445 368 consensus Uncharacterized conserved protein, conta 91.52
COG52191525 Uncharacterized conserved protein, contains RING Z 91.35
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 91.09
KOG3113 293 consensus Uncharacterized conserved protein [Funct 90.41
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 90.39
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 89.91
KOG3039 303 consensus Uncharacterized conserved protein [Funct 89.52
KOG0298 1394 consensus DEAD box-containing helicase-like transc 89.32
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 89.23
KOG2185 486 consensus Predicted RNA-processing protein, contai 88.95
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 88.67
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 88.61
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 88.45
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 88.37
KOG1940276 consensus Zn-finger protein [General function pred 88.24
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 88.03
COG5175 480 MOT2 Transcriptional repressor [Transcription] 88.02
KOG1941518 consensus Acetylcholine receptor-associated protei 87.59
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 87.09
PF03194254 LUC7: LUC7 N_terminus; InterPro: IPR004882 This fa 85.65
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 85.04
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 84.27
COG5109396 Uncharacterized conserved protein, contains RING Z 84.19
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 83.27
PF1023590 Cript: Microtubule-associated protein CRIPT; Inter 82.51
KOG2068327 consensus MOT2 transcription factor [Transcription 81.58
KOG3579352 consensus Predicted E3 ubiquitin ligase [Posttrans 81.02
KOG1677332 consensus CCCH-type Zn-finger protein [General fun 80.94
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=2.9e-67  Score=493.23  Aligned_cols=255  Identities=45%  Similarity=0.793  Sum_probs=215.8

Q ss_pred             eeccCCCCCCCCCceeecCCCccC-----CC---CCCCCCCCCceeeeeccccccc--cccCccccccccccchhhhHHH
Q 020671           47 LQNLKKPTKPDSKLYFSTGPSKRD-----TS---ADSNADSEKPIFQFESSKEIQV--QHDSKATATLETETDFLRDSRA  116 (323)
Q Consensus        47 ~~~~~~~~~~~~~~~~~t~~~~~~-----~~---~~~~~~~~~~~~~~~~~~~~~~--~~~~~at~~~e~~t~~~~d~~a  116 (323)
                      +++..+..+..|||+|++..+-..     ..   +..+.+.+.+.|.|.|.+++.+  +.|+|||+++|++|+..+||||
T Consensus        41 s~r~ek~~k~~~p~~q~~k~~~k~~~~~~~~s~~s~~~~~~ed~vv~y~s~~~~~~~g~~dsgat~t~e~~te~~~Daqa  120 (313)
T KOG1813|consen   41 SSRLEKLEKKIKPETQRKKETDKVLTGEEDDSALSICQNPFEDPVVTYCSCDKCALKGHTDSGATATLEEPTEGLRDAQA  120 (313)
T ss_pred             hhhhhhhhhhcchHhhhhhhhcccccccccccccccccCcccccceeeccccccccCCccccCceeEeecCcccchhHHH
Confidence            445555556789999997443211     11   1222335678999999888875  4599999999999999999999


Q ss_pred             HHHHHHhhhHHHhcCCCCCCCccccccccccccccccccccccccCCCCCCCCCcccCceeecceeeccCCCCccccccc
Q 020671          117 LREKVLKRSEEALKGKASGDEKLYKGIHGYVDHKAGFRREHTVSSEKAGGSHGPLRASAHIRVTARFDYQPDICKDYKET  196 (323)
Q Consensus       117 ~~e~~~~~~~~~~~~~~~~~d~~yrg~~~y~~~~~~~~~~~~~~~~~~~~~~gP~ra~~nir~t~~~DyqPDiCKdYkeT  196 (323)
                      |+|++++...+.+.|+  .++++|+|+|+|++|.+   ..++..+|...|.+=|||||+|||++++|||||||||||++|
T Consensus       121 ~~er~~k~~~e~~~~k--~~~~lykg~~~ya~~~k---~~~~~~~n~s~g~~rpira~~~~r~~~~~d~qpDicKdykeT  195 (313)
T KOG1813|consen  121 IIERRIKEEREKLRGK--KDTKLYKGINTYADDAK---AQKVVKMNESIGTVRPIRAAMHTRAGERIDYQPDICKDYKET  195 (313)
T ss_pred             HhhhhHHHHHHhhcch--hHHHHHHHHHHHHhhhh---hhhhHhhhcccccccccchhhhhcccceeecCchhhhhhHhh
Confidence            9999999555568886  48999999999999987   455555666666444999999999999999999999999999


Q ss_pred             cccCCCCccceeecccccccccccchhHHHHHHHHHhhhhcCCCCCCCCCCCCCCCCCCCCCCccccccccCCCCcEEcc
Q 020671          197 GYCGYGDSCKFMHDRGDYKSGWQMEKEWEEAEKARKRNLALGGGDSDEEGVGQSDDDDEDSLPFACFICRKPFVDPVVTK  276 (323)
Q Consensus       197 G~CgfGDsCkFlHdR~dyk~GwqlerEwee~qk~kk~rl~~g~~~~eed~~~~e~~ddee~~p~~C~IC~e~~~~PVvt~  276 (323)
                      |||||||||+|||+|+|||+||||+.||++.+.                 .+.....+.+.+||.|.||++.|.+||+|.
T Consensus       196 gycg~gdSckFlh~r~DyK~GWqi~~e~d~~ke-----------------~~~~~~~D~~~~Pf~c~icr~~f~~pVvt~  258 (313)
T KOG1813|consen  196 GYCGYGDSCKFLHDRSDYKAGWQIEFEWDSAKE-----------------KKRVKIEDIELLPFKCFICRKYFYRPVVTK  258 (313)
T ss_pred             Ccccccchhhhhhhhhhccccceeehhhhcccc-----------------ccceecCCcccCCccccccccccccchhhc
Confidence            999999999999999999999999999998752                 223344567889999999999999999999


Q ss_pred             CCCcccHHHHHHhccCCCCCCCCCCCCCCchhhHHHHHHHHHHhcCC
Q 020671          277 CKHYFCEHCALKHHSKNKKCFVCNEPTLGIFNTALEIRKRMAEEGKK  323 (323)
Q Consensus       277 CGH~FC~~Ci~~~~~~s~~CP~Cr~~t~gvfn~Ak~L~~kLk~~kq~  323 (323)
                      |+|+||..|++..++....|++|.++++|+||++++|+.+|+.++++
T Consensus       259 c~h~fc~~ca~~~~qk~~~c~vC~~~t~g~~~~akeL~~~L~~kks~  305 (313)
T KOG1813|consen  259 CGHYFCEVCALKPYQKGEKCYVCSQQTHGSFNVAKELLVSLKLKKSD  305 (313)
T ss_pred             CCceeehhhhccccccCCcceecccccccccchHHHHHHHHHhhhhh
Confidence            99999999999999999999999999999999999999999987753

>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>smart00356 ZnF_C3H1 zinc finger Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PF14608 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG3113 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2185 consensus Predicted RNA-processing protein, contains G-patch domain [RNA processing and modification] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF03194 LUC7: LUC7 N_terminus; InterPro: IPR004882 This family consists of several LUC7 protein homologues that are restricted to eukaryotes Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PF10235 Cript: Microtubule-associated protein CRIPT; InterPro: IPR019367 The CRIPT protein is a cytoskeletal protein involved in microtubule production Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query323
2csy_A81 Solution Structure Of The Ring Domain Of The Zinc F 6e-17
>pdb|2CSY|A Chain A, Solution Structure Of The Ring Domain Of The Zinc Finger Protein 183-Like 1 Length = 81 Back     alignment and structure 
Iteration: 1

 Score = 84.7 bits (208), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 48/64 (75%)
Query: 258 LPFACFICRKPFVDPVVTKCKHYFCEHCALKHHSKNKKCFVCNEPTLGIFNTALEIRKRM 317
           +PF CFICR+ F +PVVTKC+HYFCE CAL+H     +C++C++PT GIFN A E+  ++
Sbjct: 14  IPFRCFICRQAFQNPVVTKCRHYFCESCALEHFRATPRCYICDQPTGGIFNPAKELMAKL 73
Query: 318 AEEG 321
            + G
Sbjct: 74  QKSG 77

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query323
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 3e-32
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 1e-09
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 3e-09
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 4e-09
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 4e-09
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 1e-08
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 1e-08
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 3e-08
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 3e-08
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 8e-08
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 2e-07
2ysl_A73 Tripartite motif-containing protein 31; ring-type 2e-07
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 2e-07
2ecw_A85 Tripartite motif-containing protein 30; metal bind 3e-07
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 4e-07
2ysj_A63 Tripartite motif-containing protein 31; ring-type 5e-07
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 5e-07
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 6e-07
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 6e-07
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 9e-07
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 1e-06
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 1e-06
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 2e-06
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 2e-06
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 3e-06
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 3e-06
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 7e-06
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 1e-05
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 1e-05
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 2e-05
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 2e-05
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 3e-05
1z6u_A150 NP95-like ring finger protein isoform B; structura 3e-05
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 4e-05
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 5e-05
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 2e-04
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 6e-04
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 5e-04
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 8e-04
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 9e-04
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
 Score =  114 bits (286), Expect = 3e-32
 Identities = 37/76 (48%), Positives = 53/76 (69%)

Query: 248 GQSDDDDEDSLPFACFICRKPFVDPVVTKCKHYFCEHCALKHHSKNKKCFVCNEPTLGIF 307
           G S   +E+ +PF CFICR+ F +PVVTKC+HYFCE CAL+H     +C++C++PT GIF
Sbjct: 4   GSSGGSEEEEIPFRCFICRQAFQNPVVTKCRHYFCESCALEHFRATPRCYICDQPTGGIF 63

Query: 308 NTALEIRKRMAEEGKK 323
           N A E+  ++ + G  
Sbjct: 64  NPAKELMAKLQKSGPS 79
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Length = 61 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Length = 101 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query323
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.52
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.21
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.2
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.19
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.18
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.18
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.17
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.16
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.16
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.16
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.15
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.13
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.13
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.12
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.11
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.11
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.1
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.09
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.09
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.09
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.08
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.08
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.08
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.07
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.06
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.05
2ect_A78 Ring finger protein 126; metal binding protein, st 99.04
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.03
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.03
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.02
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.0
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.98
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.97
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.97
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.97
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.97
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.96
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.96
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.95
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.93
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.92
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.91
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.89
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.88
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.87
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.86
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.85
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.82
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.8
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.77
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.75
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.74
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.74
2ea5_A68 Cell growth regulator with ring finger domain prot 98.74
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.72
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.69
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.69
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.65
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.64
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.56
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.55
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.52
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.34
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.34
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.24
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.16
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.11
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.62
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.5
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 97.2
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 97.06
2d9m_A69 Zinc finger CCCH-type domain containing protein 7A 96.59
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 96.45
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 96.32
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 95.98
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 95.93
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 95.68
2rhk_C72 Cleavage and polyadenylation specificity factor su 95.56
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 95.13
3d2q_A70 Muscleblind-like protein 1; tandem zinc finger dom 94.81
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 93.86
2fc6_A50 Nuclear, target of EGR1, member 1; structure genom 93.5
2rpp_A89 Muscleblind-like protein 2; zinc finger domain, C3 93.4
3nw0_A238 Non-structural maintenance of chromosomes element 93.06
3d2n_A83 Muscleblind-like protein 1; tandem zinc finger dom 92.61
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 91.46
2e5s_A98 Otthump00000018578; ZF-CCCHX2 domain, muscleblind- 90.94
3d2q_A70 Muscleblind-like protein 1; tandem zinc finger dom 89.62
2rhk_C72 Cleavage and polyadenylation specificity factor su 87.56
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 87.25
2e5s_A98 Otthump00000018578; ZF-CCCHX2 domain, muscleblind- 86.9
3u9g_A229 Zinc finger CCCH-type antiviral protein 1; zinc fi 85.59
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 84.33
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 84.19
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.52  E-value=7e-15  Score=112.73  Aligned_cols=68  Identities=51%  Similarity=1.214  Sum_probs=61.0

Q ss_pred             CCCCCccccccccCCCCcEEccCCCcccHHHHHHhccCCCCCCCCCCCCCCchhhHHHHHHHHHHhcC
Q 020671          255 EDSLPFACFICRKPFVDPVVTKCKHYFCEHCALKHHSKNKKCFVCNEPTLGIFNTALEIRKRMAEEGK  322 (323)
Q Consensus       255 ee~~p~~C~IC~e~~~~PVvt~CGH~FC~~Ci~~~~~~s~~CP~Cr~~t~gvfn~Ak~L~~kLk~~kq  322 (323)
                      +....+.|+||++.+.+|++++|||+||..|+..|+.....||+|+.++..+++....|+.+|++.++
T Consensus        11 ~~~~~~~C~IC~~~~~~p~~~~CgH~fC~~Ci~~~~~~~~~CP~Cr~~~~~~~~~~~~l~~~~~~~~~   78 (81)
T 2csy_A           11 EEEIPFRCFICRQAFQNPVVTKCRHYFCESCALEHFRATPRCYICDQPTGGIFNPAKELMAKLQKSGP   78 (81)
T ss_dssp             CCCCCSBCSSSCSBCCSEEECTTSCEEEHHHHHHHHHHCSBCSSSCCBCCSCCEECHHHHHHHSSSCS
T ss_pred             cCCCCCCCcCCCchhcCeeEccCCCHhHHHHHHHHHHCCCcCCCcCccccccCCcHHHHHHHHHhhCc
Confidence            44556799999999999999999999999999999988899999999999999999999888876543
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Back     alignment and structure
>2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A Back     alignment and structure
>2fc6_A Nuclear, target of EGR1, member 1; structure genomics, ZF-CCCH domain, member 1(nuclear), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.66.1.1 Back     alignment and structure
>2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A Back     alignment and structure
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3u9g_A Zinc finger CCCH-type antiviral protein 1; zinc finger protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 323
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 2e-09
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 3e-08
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 4e-08
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 1e-07
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 2e-07
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 1e-06
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 1e-05
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 6e-05
d1m9oa_40 g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475 5e-04
d1rgoa136 g.66.1.1 (A:151-186) Butyrate response factor 2 (T 6e-04
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 8e-04
d1rgoa234 g.66.1.1 (A:187-220) Butyrate response factor 2 (T 0.001
d1wgma_98 g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Hu 0.001
d2c2la280 g.44.1.2 (A:225-304) STIP1 homology and U box-cont 0.003
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: V(D)J recombination activating protein 1 (RAG1), dimerization domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 51.8 bits (124), Expect = 2e-09
 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 1/44 (2%)

Query: 260 FACFICRKPFVDPVVTKCKHYFCEHCALKH-HSKNKKCFVCNEP 302
            +C IC     DPV T CKH FC  C L+        C  C  P
Sbjct: 24  ISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYP 67
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 34 Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query323
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.27
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.13
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.12
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.08
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.06
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.04
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.04
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.03
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.02
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.95
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.87
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.85
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.84
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.57
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.54
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.35
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.92
d2cqea229 Zinc finger CCCH domain-containing protein C19orf7 97.73
d1rgoa234 Butyrate response factor 2 (Tis11D) {Human (Homo s 97.45
d1m9oa_40 Tristetraproline (ttp, tis11, nup475) {Mouse (Mus 97.4
d1rgoa136 Butyrate response factor 2 (Tis11D) {Human (Homo s 97.32
d2cqea156 Zinc finger CCCH domain-containing protein C19orf7 94.86
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 89.75
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: V(D)J recombination activating protein 1 (RAG1), dimerization domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.27  E-value=9.7e-13  Score=102.23  Aligned_cols=60  Identities=28%  Similarity=0.641  Sum_probs=50.1

Q ss_pred             CccccccccCCCCcEEccCCCcccHHHHHHhcc-CCCCCCCCCCCCC--CchhhHHHHHHHHH
Q 020671          259 PFACFICRKPFVDPVVTKCKHYFCEHCALKHHS-KNKKCFVCNEPTL--GIFNTALEIRKRMA  318 (323)
Q Consensus       259 p~~C~IC~e~~~~PVvt~CGH~FC~~Ci~~~~~-~s~~CP~Cr~~t~--gvfn~Ak~L~~kLk  318 (323)
                      .+.|+||++.+.+|++|+|||.||..||.+|+. ....||.||.+..  .+..+++.++..|.
T Consensus        23 ~l~C~IC~~~~~~pv~~~CgH~FC~~Ci~~~~~~~~~~CP~Cr~p~~~~~l~~P~~~~l~~l~   85 (86)
T d1rmda2          23 SISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPCFPTDLESPVKSFLNILN   85 (86)
T ss_dssp             HTBCTTTCSBCSSEEECTTSCEEEHHHHHHHHHHTCSBCTTTCCBCCGGGCBCCCHHHHHHHH
T ss_pred             CcCCccCCcchhcceecCCCChhhHHHHHHHHhhCCCcCcccCCCCChhhccCHHHHHHHHhc
Confidence            468999999999999999999999999999986 6678999999754  33456667776663
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqea1 g.66.1.1 (A:458-513) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure