Citrus Sinensis ID: 020688
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 322 | ||||||
| 225452169 | 423 | PREDICTED: kelch repeat-containing prote | 0.801 | 0.609 | 0.691 | 1e-105 | |
| 296090252 | 431 | unnamed protein product [Vitis vinifera] | 0.801 | 0.598 | 0.691 | 1e-105 | |
| 449449581 | 418 | PREDICTED: kelch repeat-containing prote | 0.798 | 0.614 | 0.650 | 1e-103 | |
| 449479719 | 418 | PREDICTED: LOW QUALITY PROTEIN: kelch re | 0.798 | 0.614 | 0.647 | 1e-102 | |
| 225443351 | 426 | PREDICTED: kelch repeat-containing prote | 0.798 | 0.603 | 0.687 | 1e-101 | |
| 255536987 | 430 | conserved hypothetical protein [Ricinus | 0.841 | 0.630 | 0.675 | 2e-99 | |
| 255561818 | 425 | conserved hypothetical protein [Ricinus | 0.757 | 0.574 | 0.681 | 7e-97 | |
| 449512779 | 383 | PREDICTED: kelch repeat-containing prote | 0.779 | 0.655 | 0.691 | 7e-96 | |
| 449453359 | 427 | PREDICTED: kelch repeat-containing prote | 0.779 | 0.587 | 0.691 | 2e-95 | |
| 224113255 | 424 | predicted protein [Populus trichocarpa] | 0.770 | 0.584 | 0.673 | 2e-95 |
| >gi|225452169|ref|XP_002270625.1| PREDICTED: kelch repeat-containing protein At3g27220 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 389 bits (998), Expect = e-105, Method: Compositional matrix adjust.
Identities = 186/269 (69%), Positives = 218/269 (81%), Gaps = 11/269 (4%)
Query: 9 KHTYTKTGCWFLCVLGLLGAALIADFMWASSSSSFSSSSAHLSVASNWALEKSGVVVIPH 68
KH +K +G LGA L+AD++WAS+S A+LS+ASNWAL KS VVIP
Sbjct: 7 KHYTSKKLVLLASFVGFLGAILVADYLWASASF------AYLSIASNWALTKSSTVVIP- 59
Query: 69 VNATKIDRQ-RESVAVIDKKGQDAERFLSATFADLPAPDLEWEQMPSAPVPRLDGAAIQI 127
T D + ++ V V DKK + + R LSATFADLPAP+L+WE+M APVPRLDGA+IQI
Sbjct: 60 ---TNFDEKLQQRVDVKDKKNRTSGRILSATFADLPAPELKWEEMQPAPVPRLDGASIQI 116
Query: 128 KNLFYVFAGYGSLDYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGVVSDGRYIYIVSGQ 187
KNL YVFAGYG+L+YVHSHVD+YN TDN W RFDMPK+MAHSHLG+ +DGRYIYIVSGQ
Sbjct: 117 KNLLYVFAGYGTLNYVHSHVDIYNITDNAWGGRFDMPKEMAHSHLGMATDGRYIYIVSGQ 176
Query: 188 YGPQCRGPTSRTFVLDSETRKWDSIPPLPSPRYSPATQLWRGRLHVMGGSKENRHTPGLE 247
YGPQCRGPT+R FVLD+ET+KW +P LP+PRY+PATQLWRGRLHVMGG KENRHTPGLE
Sbjct: 177 YGPQCRGPTARCFVLDTETKKWQDLPTLPAPRYAPATQLWRGRLHVMGGGKENRHTPGLE 236
Query: 248 HWSIAVKDGKALEKAWRTEIPIPRGGPHR 276
HWS+AVK+GKALEK WR+EIPIPRGGPHR
Sbjct: 237 HWSLAVKNGKALEKEWRSEIPIPRGGPHR 265
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|296090252|emb|CBI40071.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449449581|ref|XP_004142543.1| PREDICTED: kelch repeat-containing protein At3g27220-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449479719|ref|XP_004155687.1| PREDICTED: LOW QUALITY PROTEIN: kelch repeat-containing protein At3g27220-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|225443351|ref|XP_002265018.1| PREDICTED: kelch repeat-containing protein At3g27220 [Vitis vinifera] gi|297735771|emb|CBI18458.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255536987|ref|XP_002509560.1| conserved hypothetical protein [Ricinus communis] gi|223549459|gb|EEF50947.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255561818|ref|XP_002521918.1| conserved hypothetical protein [Ricinus communis] gi|223538843|gb|EEF40442.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449512779|ref|XP_004164137.1| PREDICTED: kelch repeat-containing protein At3g27220-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449453359|ref|XP_004144425.1| PREDICTED: kelch repeat-containing protein At3g27220-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224113255|ref|XP_002316438.1| predicted protein [Populus trichocarpa] gi|222865478|gb|EEF02609.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 322 | ||||||
| TAIR|locus:2033944 | 415 | AT1G51540 [Arabidopsis thalian | 0.748 | 0.580 | 0.628 | 3.4e-84 | |
| TAIR|locus:2086528 | 426 | AT3G27220 "AT3G27220" [Arabido | 0.810 | 0.612 | 0.575 | 1.2e-81 | |
| UNIPROTKB|B4L0G9 | 617 | dbo "Kelch-like protein diablo | 0.375 | 0.196 | 0.298 | 2.6e-06 | |
| UNIPROTKB|B4J045 | 624 | dbo "Kelch-like protein diablo | 0.375 | 0.193 | 0.298 | 2.7e-06 | |
| UNIPROTKB|B4LIG6 | 624 | dbo "Kelch-like protein diablo | 0.375 | 0.193 | 0.298 | 2.7e-06 | |
| MGI|MGI:2442630 | 350 | Klhdc8a "kelch domain containi | 0.444 | 0.408 | 0.273 | 4.9e-06 | |
| UNIPROTKB|B0WWP2 | 582 | dbo "Kelch-like protein diablo | 0.375 | 0.207 | 0.298 | 5.3e-06 | |
| UNIPROTKB|Q7QGL0 | 582 | dbo "Kelch-like protein diablo | 0.375 | 0.207 | 0.298 | 5.3e-06 | |
| UNIPROTKB|Q16RL8 | 589 | dbo "Kelch-like protein diablo | 0.375 | 0.205 | 0.298 | 5.4e-06 | |
| FB|FBgn0040230 | 623 | dbo "diablo" [Drosophila melan | 0.375 | 0.194 | 0.298 | 7.5e-06 |
| TAIR|locus:2033944 AT1G51540 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 843 (301.8 bits), Expect = 3.4e-84, P = 3.4e-84
Identities = 161/256 (62%), Positives = 189/256 (73%)
Query: 21 CVLGLLGAALIADFMWXXXXXXXXXXXXXXXXXXNWALEKSGVVVIPHVNATKIDRQRES 80
C+ LL LIADF+W +L S VI V + D ++
Sbjct: 15 CI-ALLATGLIADFLWATSHRFSSAAISAGL-----SLPSSLTTVI--VPGQEKDTKK-- 64
Query: 81 VAVIDKKGQDAERFLSATFADLPAPDLEWEQMPSAPVPRLDGAAIQIKNLFYVFAGYGSL 140
KK ER LS TF DLPAP+L+WE+M ++PVPRLDGAAIQI++L YVFAGYG++
Sbjct: 65 -----KKDSVKERKLSNTFQDLPAPELKWEKMAASPVPRLDGAAIQIRDLLYVFAGYGTI 119
Query: 141 DYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGVVSDGRYIYIVSGQYGPQCRGPTSRTF 200
D VHSHVD+YNFTDN W RF+MPKDMAHSHLG+V+DGRYIYIV+GQ+GPQCRGPT++TF
Sbjct: 120 DLVHSHVDIYNFTDNSWGGRFNMPKDMAHSHLGMVTDGRYIYIVTGQFGPQCRGPTAKTF 179
Query: 201 VLDSETRKWDSIPPLPSPRYSPATQLWRGRLHVMGGSKENRHTPGLEHWSIAVKDGKALE 260
VLD++T W PLP PRY+PATQLWRGRLHVMGGSKENR TPGLEHWSIAVKDGK+LE
Sbjct: 180 VLDTDTNTWKDFVPLPVPRYAPATQLWRGRLHVMGGSKENRFTPGLEHWSIAVKDGKSLE 239
Query: 261 KAWRTEIPIPRGGPHR 276
WR+EIPIPRGGPHR
Sbjct: 240 NEWRSEIPIPRGGPHR 255
|
|
| TAIR|locus:2086528 AT3G27220 "AT3G27220" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4L0G9 dbo "Kelch-like protein diablo" [Drosophila mojavensis (taxid:7230)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4J045 dbo "Kelch-like protein diablo" [Drosophila grimshawi (taxid:7222)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4LIG6 dbo "Kelch-like protein diablo" [Drosophila virilis (taxid:7244)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2442630 Klhdc8a "kelch domain containing 8A" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B0WWP2 dbo "Kelch-like protein diablo" [Culex quinquefasciatus (taxid:7176)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7QGL0 dbo "Kelch-like protein diablo" [Anopheles gambiae (taxid:7165)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q16RL8 dbo "Kelch-like protein diablo" [Aedes aegypti (taxid:7159)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0040230 dbo "diablo" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00020557001 | SubName- Full=Chromosome chr14 scaffold_21, whole genome shotgun sequence; (423 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 322 | |||
| pfam13418 | 49 | pfam13418, Kelch_4, Galactose oxidase, central dom | 2e-08 | |
| PHA03098 | 534 | PHA03098, PHA03098, kelch-like protein; Provisiona | 9e-08 | |
| PHA03098 | 534 | PHA03098, PHA03098, kelch-like protein; Provisiona | 1e-06 | |
| pfam13964 | 50 | pfam13964, Kelch_6, Kelch motif | 4e-06 | |
| pfam13415 | 48 | pfam13415, Kelch_3, Galactose oxidase, central dom | 3e-05 | |
| PHA03098 | 534 | PHA03098, PHA03098, kelch-like protein; Provisiona | 8e-05 | |
| PHA03098 | 534 | PHA03098, PHA03098, kelch-like protein; Provisiona | 1e-04 | |
| TIGR03548 | 323 | TIGR03548, mutarot_permut, cyclically-permuted mut | 2e-04 | |
| pfam01344 | 46 | pfam01344, Kelch_1, Kelch motif | 5e-04 | |
| smart00612 | 47 | smart00612, Kelch, Kelch domain | 0.004 |
| >gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain | Back alignment and domain information |
|---|
Score = 49.6 bits (119), Expect = 2e-08
Identities = 13/48 (27%), Positives = 19/48 (39%), Gaps = 1/48 (2%)
Query: 118 PRLDGAAIQI-KNLFYVFAGYGSLDYVHSHVDVYNFTDNKWVDRFDMP 164
PR + I Y+F G V S V V++ + N W +P
Sbjct: 1 PRAYHTSTSIGDGRLYLFGGENEDGSVLSDVWVFDLSTNTWTRLPSLP 48
|
Length = 49 |
| >gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif | Back alignment and domain information |
|---|
| >gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain | Back alignment and domain information |
|---|
| >gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|211835 TIGR03548, mutarot_permut, cyclically-permuted mutarotase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif | Back alignment and domain information |
|---|
| >gnl|CDD|128874 smart00612, Kelch, Kelch domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 322 | |||
| KOG4441 | 571 | consensus Proteins containing BTB/POZ and Kelch do | 100.0 | |
| KOG4441 | 571 | consensus Proteins containing BTB/POZ and Kelch do | 100.0 | |
| PHA02713 | 557 | hypothetical protein; Provisional | 100.0 | |
| PHA02713 | 557 | hypothetical protein; Provisional | 100.0 | |
| PHA03098 | 534 | kelch-like protein; Provisional | 99.97 | |
| PHA02790 | 480 | Kelch-like protein; Provisional | 99.97 | |
| PLN02153 | 341 | epithiospecifier protein | 99.97 | |
| PLN02153 | 341 | epithiospecifier protein | 99.96 | |
| TIGR03548 | 323 | mutarot_permut cyclically-permuted mutatrotase fam | 99.96 | |
| TIGR03547 | 346 | muta_rot_YjhT mutatrotase, YjhT family. Members of | 99.96 | |
| TIGR03547 | 346 | muta_rot_YjhT mutatrotase, YjhT family. Members of | 99.96 | |
| TIGR03548 | 323 | mutarot_permut cyclically-permuted mutatrotase fam | 99.96 | |
| PLN02193 | 470 | nitrile-specifier protein | 99.96 | |
| PLN02193 | 470 | nitrile-specifier protein | 99.95 | |
| KOG4693 | 392 | consensus Uncharacterized conserved protein, conta | 99.95 | |
| PHA03098 | 534 | kelch-like protein; Provisional | 99.95 | |
| PRK14131 | 376 | N-acetylneuraminic acid mutarotase; Provisional | 99.95 | |
| PHA02790 | 480 | Kelch-like protein; Provisional | 99.95 | |
| PRK14131 | 376 | N-acetylneuraminic acid mutarotase; Provisional | 99.94 | |
| KOG4693 | 392 | consensus Uncharacterized conserved protein, conta | 99.92 | |
| KOG0379 | 482 | consensus Kelch repeat-containing proteins [Genera | 99.91 | |
| KOG1230 | 521 | consensus Protein containing repeated kelch motifs | 99.9 | |
| KOG1230 | 521 | consensus Protein containing repeated kelch motifs | 99.89 | |
| KOG0379 | 482 | consensus Kelch repeat-containing proteins [Genera | 99.89 | |
| KOG4152 | 830 | consensus Host cell transcription factor HCFC1 [Ce | 99.8 | |
| KOG4152 | 830 | consensus Host cell transcription factor HCFC1 [Ce | 99.79 | |
| COG3055 | 381 | Uncharacterized protein conserved in bacteria [Fun | 99.5 | |
| KOG2437 | 723 | consensus Muskelin [Signal transduction mechanisms | 99.44 | |
| COG3055 | 381 | Uncharacterized protein conserved in bacteria [Fun | 99.42 | |
| PF13964 | 50 | Kelch_6: Kelch motif | 99.34 | |
| PF13964 | 50 | Kelch_6: Kelch motif | 99.33 | |
| PF01344 | 47 | Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is | 99.17 | |
| PF01344 | 47 | Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is | 99.11 | |
| PF07646 | 49 | Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is | 99.06 | |
| PF13418 | 49 | Kelch_4: Galactose oxidase, central domain; PDB: 2 | 99.03 | |
| PF13415 | 49 | Kelch_3: Galactose oxidase, central domain | 99.01 | |
| PF13415 | 49 | Kelch_3: Galactose oxidase, central domain | 98.95 | |
| PF07646 | 49 | Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is | 98.95 | |
| KOG2437 | 723 | consensus Muskelin [Signal transduction mechanisms | 98.88 | |
| PF13418 | 49 | Kelch_4: Galactose oxidase, central domain; PDB: 2 | 98.87 | |
| smart00612 | 47 | Kelch Kelch domain. | 98.86 | |
| smart00612 | 47 | Kelch Kelch domain. | 98.8 | |
| PLN02772 | 398 | guanylate kinase | 98.78 | |
| PLN02772 | 398 | guanylate kinase | 98.65 | |
| PF13854 | 42 | Kelch_5: Kelch motif | 98.63 | |
| PF13854 | 42 | Kelch_5: Kelch motif | 98.33 | |
| PF03089 | 337 | RAG2: Recombination activating protein 2; InterPro | 98.07 | |
| TIGR01640 | 230 | F_box_assoc_1 F-box protein interaction domain. Th | 98.06 | |
| PF07250 | 243 | Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP | 97.97 | |
| PF07250 | 243 | Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP | 97.67 | |
| TIGR01640 | 230 | F_box_assoc_1 F-box protein interaction domain. Th | 97.31 | |
| PF03089 | 337 | RAG2: Recombination activating protein 2; InterPro | 97.3 | |
| PF07893 | 342 | DUF1668: Protein of unknown function (DUF1668); In | 96.81 | |
| PF12768 | 281 | Rax2: Cortical protein marker for cell polarity | 96.4 | |
| PF07893 | 342 | DUF1668: Protein of unknown function (DUF1668); In | 96.34 | |
| PF12768 | 281 | Rax2: Cortical protein marker for cell polarity | 95.53 | |
| PRK11138 | 394 | outer membrane biogenesis protein BamB; Provisiona | 95.52 | |
| PRK00178 | 430 | tolB translocation protein TolB; Provisional | 95.11 | |
| PF13360 | 238 | PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A | 95.08 | |
| PRK11138 | 394 | outer membrane biogenesis protein BamB; Provisiona | 94.64 | |
| TIGR02800 | 417 | propeller_TolB tol-pal system beta propeller repea | 94.55 | |
| PRK04792 | 448 | tolB translocation protein TolB; Provisional | 94.1 | |
| PRK04043 | 419 | tolB translocation protein TolB; Provisional | 93.42 | |
| KOG0649 | 325 | consensus WD40 repeat protein [General function pr | 92.65 | |
| TIGR03300 | 377 | assembly_YfgL outer membrane assembly lipoprotein | 92.51 | |
| PF05096 | 264 | Glu_cyclase_2: Glutamine cyclotransferase; InterPr | 92.46 | |
| TIGR03300 | 377 | assembly_YfgL outer membrane assembly lipoprotein | 92.31 | |
| PF13360 | 238 | PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A | 91.7 | |
| smart00284 | 255 | OLF Olfactomedin-like domains. | 91.12 | |
| PRK04922 | 433 | tolB translocation protein TolB; Provisional | 91.05 | |
| PF08268 | 129 | FBA_3: F-box associated domain; InterPro: IPR01318 | 90.63 | |
| PF02191 | 250 | OLF: Olfactomedin-like domain; InterPro: IPR003112 | 90.61 | |
| PRK02889 | 427 | tolB translocation protein TolB; Provisional | 90.6 | |
| TIGR02800 | 417 | propeller_TolB tol-pal system beta propeller repea | 89.8 | |
| PF08268 | 129 | FBA_3: F-box associated domain; InterPro: IPR01318 | 89.67 | |
| PLN03215 | 373 | ascorbic acid mannose pathway regulator 1; Provisi | 88.2 | |
| KOG2055 | 514 | consensus WD40 repeat protein [General function pr | 87.41 | |
| TIGR03075 | 527 | PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan | 86.77 | |
| PRK03629 | 429 | tolB translocation protein TolB; Provisional | 86.63 | |
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 85.24 | |
| cd00094 | 194 | HX Hemopexin-like repeats.; Hemopexin is a heme-bi | 84.93 | |
| PRK04792 | 448 | tolB translocation protein TolB; Provisional | 83.63 | |
| PF05096 | 264 | Glu_cyclase_2: Glutamine cyclotransferase; InterPr | 83.22 | |
| KOG2055 | 514 | consensus WD40 repeat protein [General function pr | 82.52 | |
| PRK05137 | 435 | tolB translocation protein TolB; Provisional | 82.09 |
| >KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.2e-34 Score=280.52 Aligned_cols=234 Identities=17% Similarity=0.242 Sum_probs=188.4
Q ss_pred cccccccceeccCceeecCCcccchhhhhhhhhhhh--cccCCChhhhhhhhhhccCCCCCCEEEcCCCCCCcccceEEE
Q 020688 49 HLSVASNWALEKSGVVVIPHVNATKIDRQRESVAVI--DKKGQDAERFLSATFADLPAPDLEWEQMPSAPVPRLDGAAIQ 126 (322)
Q Consensus 49 ~~~~~s~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~W~~~~~~p~~R~~~~~~~ 126 (322)
.......+++.++.|..+..+...+....-.....+ ...+.+.+....+.++.||+.+++|..+++|+.+|..+++++
T Consensus 299 ~~~~ve~yd~~~~~w~~~a~m~~~r~~~~~~~~~~~lYv~GG~~~~~~~l~~ve~YD~~~~~W~~~a~M~~~R~~~~v~~ 378 (571)
T KOG4441|consen 299 SLRSVECYDPKTNEWSSLAPMPSPRCRVGVAVLNGKLYVVGGYDSGSDRLSSVERYDPRTNQWTPVAPMNTKRSDFGVAV 378 (571)
T ss_pred ccceeEEecCCcCcEeecCCCCcccccccEEEECCEEEEEccccCCCcccceEEEecCCCCceeccCCccCccccceeEE
Confidence 345666778878878877666422221111111111 123333133344556788888999999999999999999999
Q ss_pred ECCEEEEEeecCCCCCccceEEEEECCCCceeeCCCCCCCCCceeeEEEEeCCEEEEEecccCCCCCCCCceEEEEECCC
Q 020688 127 IKNLFYVFAGYGSLDYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGVVSDGRYIYIVSGQYGPQCRGPTSRTFVLDSET 206 (322)
Q Consensus 127 ~~~~lyv~GG~~~~~~~~~~v~~yd~~t~~W~~~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~yD~~t 206 (322)
++++||++||+++... ++++++|||.+++|+.+++|+. +|+.+++++++++||++||.++... .++++++|||.+
T Consensus 379 l~g~iYavGG~dg~~~-l~svE~YDp~~~~W~~va~m~~--~r~~~gv~~~~g~iYi~GG~~~~~~--~l~sve~YDP~t 453 (571)
T KOG4441|consen 379 LDGKLYAVGGFDGEKS-LNSVECYDPVTNKWTPVAPMLT--RRSGHGVAVLGGKLYIIGGGDGSSN--CLNSVECYDPET 453 (571)
T ss_pred ECCEEEEEeccccccc-cccEEEecCCCCcccccCCCCc--ceeeeEEEEECCEEEEEcCcCCCcc--ccceEEEEcCCC
Confidence 9999999999997766 7789999999999999999998 8999999999999999999988772 289999999999
Q ss_pred CcEEecCCCCCCCCCCeEEEECCEEEEEccCCCCCCCCCcceeEeEEecccccccccccccCC--CCCcceEEEEeCCEE
Q 020688 207 RKWDSIPPLPSPRYSPATQLWRGRLHVMGGSKENRHTPGLEHWSIAVKDGKALEKAWRTEIPI--PRGGPHRFAGFPHVI 284 (322)
Q Consensus 207 ~~W~~~~~~p~~r~~~~~~~~~~~Lyi~GG~~~~~~~~~~~~~~i~~yd~~~~~~~W~~~~p~--pr~~~~~~~v~~~~i 284 (322)
++|+.+++|+.+|.++++++.+++||++||+++..... .+++|||. +++|+...++ +|.. +++++++++|
T Consensus 454 ~~W~~~~~M~~~R~~~g~a~~~~~iYvvGG~~~~~~~~-----~VE~ydp~--~~~W~~v~~m~~~rs~-~g~~~~~~~l 525 (571)
T KOG4441|consen 454 NTWTLIAPMNTRRSGFGVAVLNGKIYVVGGFDGTSALS-----SVERYDPE--TNQWTMVAPMTSPRSA-VGVVVLGGKL 525 (571)
T ss_pred CceeecCCcccccccceEEEECCEEEEECCccCCCccc-----eEEEEcCC--CCceeEcccCcccccc-ccEEEECCEE
Confidence 99999999999999999999999999999998732222 48999987 9999987544 6888 7999999999
Q ss_pred EEEccccCCCC
Q 020688 285 YLSLVSSVEDL 295 (322)
Q Consensus 285 yi~GG~~~e~~ 295 (322)
|++||.+...+
T Consensus 526 y~vGG~~~~~~ 536 (571)
T KOG4441|consen 526 YAVGGFDGNNN 536 (571)
T ss_pred EEEecccCccc
Confidence 99999775444
|
|
| >KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] | Back alignment and domain information |
|---|
| >PHA02713 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA02713 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA03098 kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02790 Kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >PLN02153 epithiospecifier protein | Back alignment and domain information |
|---|
| >PLN02153 epithiospecifier protein | Back alignment and domain information |
|---|
| >TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein | Back alignment and domain information |
|---|
| >TIGR03547 muta_rot_YjhT mutatrotase, YjhT family | Back alignment and domain information |
|---|
| >TIGR03547 muta_rot_YjhT mutatrotase, YjhT family | Back alignment and domain information |
|---|
| >TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein | Back alignment and domain information |
|---|
| >PLN02193 nitrile-specifier protein | Back alignment and domain information |
|---|
| >PLN02193 nitrile-specifier protein | Back alignment and domain information |
|---|
| >KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PHA03098 kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK14131 N-acetylneuraminic acid mutarotase; Provisional | Back alignment and domain information |
|---|
| >PHA02790 Kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK14131 N-acetylneuraminic acid mutarotase; Provisional | Back alignment and domain information |
|---|
| >KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] | Back alignment and domain information |
|---|
| >KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] | Back alignment and domain information |
|---|
| >COG3055 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG2437 consensus Muskelin [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3055 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF13964 Kelch_6: Kelch motif | Back alignment and domain information |
|---|
| >PF13964 Kelch_6: Kelch motif | Back alignment and domain information |
|---|
| >PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] | Back alignment and domain information |
|---|
| >PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] | Back alignment and domain information |
|---|
| >PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] | Back alignment and domain information |
|---|
| >PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B | Back alignment and domain information |
|---|
| >PF13415 Kelch_3: Galactose oxidase, central domain | Back alignment and domain information |
|---|
| >PF13415 Kelch_3: Galactose oxidase, central domain | Back alignment and domain information |
|---|
| >PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] | Back alignment and domain information |
|---|
| >KOG2437 consensus Muskelin [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B | Back alignment and domain information |
|---|
| >smart00612 Kelch Kelch domain | Back alignment and domain information |
|---|
| >smart00612 Kelch Kelch domain | Back alignment and domain information |
|---|
| >PLN02772 guanylate kinase | Back alignment and domain information |
|---|
| >PLN02772 guanylate kinase | Back alignment and domain information |
|---|
| >PF13854 Kelch_5: Kelch motif | Back alignment and domain information |
|---|
| >PF13854 Kelch_5: Kelch motif | Back alignment and domain information |
|---|
| >PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination | Back alignment and domain information |
|---|
| >TIGR01640 F_box_assoc_1 F-box protein interaction domain | Back alignment and domain information |
|---|
| >PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes | Back alignment and domain information |
|---|
| >PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes | Back alignment and domain information |
|---|
| >TIGR01640 F_box_assoc_1 F-box protein interaction domain | Back alignment and domain information |
|---|
| >PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination | Back alignment and domain information |
|---|
| >PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function | Back alignment and domain information |
|---|
| >PF12768 Rax2: Cortical protein marker for cell polarity | Back alignment and domain information |
|---|
| >PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function | Back alignment and domain information |
|---|
| >PF12768 Rax2: Cortical protein marker for cell polarity | Back alignment and domain information |
|---|
| >PRK11138 outer membrane biogenesis protein BamB; Provisional | Back alignment and domain information |
|---|
| >PRK00178 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A | Back alignment and domain information |
|---|
| >PRK11138 outer membrane biogenesis protein BamB; Provisional | Back alignment and domain information |
|---|
| >TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB | Back alignment and domain information |
|---|
| >PRK04792 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK04043 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG0649 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL | Back alignment and domain information |
|---|
| >PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 | Back alignment and domain information |
|---|
| >TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL | Back alignment and domain information |
|---|
| >PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A | Back alignment and domain information |
|---|
| >smart00284 OLF Olfactomedin-like domains | Back alignment and domain information |
|---|
| >PRK04922 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants | Back alignment and domain information |
|---|
| >PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] | Back alignment and domain information |
|---|
| >PRK02889 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB | Back alignment and domain information |
|---|
| >PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants | Back alignment and domain information |
|---|
| >PLN03215 ascorbic acid mannose pathway regulator 1; Provisional | Back alignment and domain information |
|---|
| >KOG2055 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family | Back alignment and domain information |
|---|
| >PRK03629 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >cd00094 HX Hemopexin-like repeats | Back alignment and domain information |
|---|
| >PRK04792 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 | Back alignment and domain information |
|---|
| >KOG2055 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05137 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 322 | ||||
| 2woz_A | 318 | The Novel Beta-Propeller Of The Btb-Kelch Protein K | 5e-06 | ||
| 2xn4_A | 302 | Crystal Structure Of The Kelch Domain Of Human Klhl | 2e-04 | ||
| 2vpj_A | 301 | Crystal Structure Of The Kelch Domain Of Human Klhl | 6e-04 |
| >pdb|2WOZ|A Chain A, The Novel Beta-Propeller Of The Btb-Kelch Protein Krp1 Provides The Binding Site For Lasp-1 That Is Necessary For Pseudopodia Extension Length = 318 | Back alignment and structure |
|
| >pdb|2XN4|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl2 (mayven) Length = 302 | Back alignment and structure |
| >pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 322 | |||
| 2uvk_A | 357 | YJHT; unknown function, hypothetical protein, sial | 3e-22 | |
| 2uvk_A | 357 | YJHT; unknown function, hypothetical protein, sial | 6e-14 | |
| 2uvk_A | 357 | YJHT; unknown function, hypothetical protein, sial | 1e-11 | |
| 1zgk_A | 308 | Kelch-like ECH-associated protein 1; beta-propelle | 2e-19 | |
| 1zgk_A | 308 | Kelch-like ECH-associated protein 1; beta-propelle | 1e-17 | |
| 1zgk_A | 308 | Kelch-like ECH-associated protein 1; beta-propelle | 1e-13 | |
| 1zgk_A | 308 | Kelch-like ECH-associated protein 1; beta-propelle | 2e-13 | |
| 1zgk_A | 308 | Kelch-like ECH-associated protein 1; beta-propelle | 1e-05 | |
| 1zgk_A | 308 | Kelch-like ECH-associated protein 1; beta-propelle | 2e-05 | |
| 2vpj_A | 301 | Kelch-like protein 12; adaptor protein, WNT signal | 3e-19 | |
| 2vpj_A | 301 | Kelch-like protein 12; adaptor protein, WNT signal | 3e-17 | |
| 2vpj_A | 301 | Kelch-like protein 12; adaptor protein, WNT signal | 7e-13 | |
| 2vpj_A | 301 | Kelch-like protein 12; adaptor protein, WNT signal | 5e-11 | |
| 2vpj_A | 301 | Kelch-like protein 12; adaptor protein, WNT signal | 2e-05 | |
| 2vpj_A | 301 | Kelch-like protein 12; adaptor protein, WNT signal | 1e-04 | |
| 2xn4_A | 302 | Kelch-like protein 2; structural protein, cytoskel | 3e-18 | |
| 2xn4_A | 302 | Kelch-like protein 2; structural protein, cytoskel | 9e-17 | |
| 2xn4_A | 302 | Kelch-like protein 2; structural protein, cytoskel | 2e-11 | |
| 2xn4_A | 302 | Kelch-like protein 2; structural protein, cytoskel | 5e-05 | |
| 2xn4_A | 302 | Kelch-like protein 2; structural protein, cytoskel | 1e-04 | |
| 4asc_A | 315 | Kelch repeat and BTB domain-containing protein 5; | 2e-17 | |
| 4asc_A | 315 | Kelch repeat and BTB domain-containing protein 5; | 2e-16 | |
| 4asc_A | 315 | Kelch repeat and BTB domain-containing protein 5; | 5e-15 | |
| 4asc_A | 315 | Kelch repeat and BTB domain-containing protein 5; | 1e-04 | |
| 2woz_A | 318 | Kelch repeat and BTB domain-containing protein 10; | 2e-17 | |
| 2woz_A | 318 | Kelch repeat and BTB domain-containing protein 10; | 1e-16 | |
| 2woz_A | 318 | Kelch repeat and BTB domain-containing protein 10; | 1e-15 | |
| 2woz_A | 318 | Kelch repeat and BTB domain-containing protein 10; | 2e-04 | |
| 3ii7_A | 306 | Kelch-like protein 7; protein-binding, kelch-repea | 3e-17 | |
| 3ii7_A | 306 | Kelch-like protein 7; protein-binding, kelch-repea | 3e-16 | |
| 3ii7_A | 306 | Kelch-like protein 7; protein-binding, kelch-repea | 3e-13 | |
| 3ii7_A | 306 | Kelch-like protein 7; protein-binding, kelch-repea | 8e-13 | |
| 3ii7_A | 306 | Kelch-like protein 7; protein-binding, kelch-repea | 2e-05 | |
| 2zwa_A | 695 | Leucine carboxyl methyltransferase 2; HET: SAH CIT | 2e-08 | |
| 2zwa_A | 695 | Leucine carboxyl methyltransferase 2; HET: SAH CIT | 3e-08 | |
| 2zwa_A | 695 | Leucine carboxyl methyltransferase 2; HET: SAH CIT | 3e-07 |
| >2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 | Back alignment and structure |
|---|
Score = 94.6 bits (235), Expect = 3e-22
Identities = 30/154 (19%), Positives = 46/154 (29%), Gaps = 7/154 (4%)
Query: 111 QMPSAPVPRLDGAAIQIKNLFYVFAGYGSLDYVHSHVDVYNFTDNKWVDRFDMPKDMAHS 170
+P PVP G + Y+ G + D KW P
Sbjct: 2 VLPETPVPFKSGTGAIDNDTVYIGLGSAG---TAWYKLDTQAKDKKWTALAAFPGGPRDQ 58
Query: 171 HLGVVSDGRYIYIVSGQYGPQCRGPTSRT--FVLDSETRKWDSI-PPLPSPRYSPATQLW 227
DG +Y+ G + +T W + P T +
Sbjct: 59 ATSAFIDGN-LYVFGGIGKNSEGLTQVFNDVHKYNPKTNSWVKLMSHAPMGMAGHVTFVH 117
Query: 228 RGRLHVMGGSKENRHTPGLEHWSIAVKDGKALEK 261
G+ +V GG +N E + A KD A++K
Sbjct: 118 NGKAYVTGGVNQNIFNGYFEDLNEAGKDSTAIDK 151
|
| >2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 | Back alignment and structure |
|---|
| >2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 | Back alignment and structure |
|---|
| >1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 | Back alignment and structure |
|---|
| >1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 | Back alignment and structure |
|---|
| >1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 | Back alignment and structure |
|---|
| >1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 | Back alignment and structure |
|---|
| >1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 | Back alignment and structure |
|---|
| >1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 | Back alignment and structure |
|---|
| >2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 | Back alignment and structure |
|---|
| >2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 | Back alignment and structure |
|---|
| >2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 | Back alignment and structure |
|---|
| >2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 | Back alignment and structure |
|---|
| >2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 | Back alignment and structure |
|---|
| >4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 | Back alignment and structure |
|---|
| >4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 | Back alignment and structure |
|---|
| >4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 | Back alignment and structure |
|---|
| >4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 | Back alignment and structure |
|---|
| >2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 | Back alignment and structure |
|---|
| >2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 | Back alignment and structure |
|---|
| >2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 | Back alignment and structure |
|---|
| >2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 | Back alignment and structure |
|---|
| >3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 | Back alignment and structure |
|---|
| >3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 | Back alignment and structure |
|---|
| >3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 | Back alignment and structure |
|---|
| >3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 | Back alignment and structure |
|---|
| >3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 | Back alignment and structure |
|---|
| >2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 | Back alignment and structure |
|---|
| >2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 | Back alignment and structure |
|---|
| >2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 322 | |||
| 1zgk_A | 308 | Kelch-like ECH-associated protein 1; beta-propelle | 100.0 | |
| 4asc_A | 315 | Kelch repeat and BTB domain-containing protein 5; | 100.0 | |
| 3ii7_A | 306 | Kelch-like protein 7; protein-binding, kelch-repea | 100.0 | |
| 2xn4_A | 302 | Kelch-like protein 2; structural protein, cytoskel | 100.0 | |
| 2woz_A | 318 | Kelch repeat and BTB domain-containing protein 10; | 100.0 | |
| 2vpj_A | 301 | Kelch-like protein 12; adaptor protein, WNT signal | 100.0 | |
| 3ii7_A | 306 | Kelch-like protein 7; protein-binding, kelch-repea | 100.0 | |
| 1zgk_A | 308 | Kelch-like ECH-associated protein 1; beta-propelle | 100.0 | |
| 4asc_A | 315 | Kelch repeat and BTB domain-containing protein 5; | 99.98 | |
| 2xn4_A | 302 | Kelch-like protein 2; structural protein, cytoskel | 99.98 | |
| 2vpj_A | 301 | Kelch-like protein 12; adaptor protein, WNT signal | 99.98 | |
| 2woz_A | 318 | Kelch repeat and BTB domain-containing protein 10; | 99.97 | |
| 2uvk_A | 357 | YJHT; unknown function, hypothetical protein, sial | 99.97 | |
| 2uvk_A | 357 | YJHT; unknown function, hypothetical protein, sial | 99.96 | |
| 2zwa_A | 695 | Leucine carboxyl methyltransferase 2; HET: SAH CIT | 99.95 | |
| 2zwa_A | 695 | Leucine carboxyl methyltransferase 2; HET: SAH CIT | 99.93 | |
| 1k3i_A | 656 | Galactose oxidase precursor; blade beta propeller, | 99.93 | |
| 1k3i_A | 656 | Galactose oxidase precursor; blade beta propeller, | 99.89 | |
| 3mbr_X | 243 | Glutamine cyclotransferase; beta-propeller; 1.44A | 97.41 | |
| 3nol_A | 262 | Glutamine cyclotransferase; beta-propeller, glutam | 97.27 | |
| 3nok_A | 268 | Glutaminyl cyclase; beta-propeller, cyclotransfera | 96.77 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 96.55 | |
| 2iwa_A | 266 | Glutamine cyclotransferase; pyroglutamate, acyltra | 96.51 | |
| 3mbr_X | 243 | Glutamine cyclotransferase; beta-propeller; 1.44A | 96.07 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 95.91 | |
| 3q7m_A | 376 | Lipoprotein YFGL, BAMB; beta-propeller, BAM comple | 94.94 | |
| 3nol_A | 262 | Glutamine cyclotransferase; beta-propeller, glutam | 94.85 | |
| 3q7m_A | 376 | Lipoprotein YFGL, BAMB; beta-propeller, BAM comple | 94.67 | |
| 2iwa_A | 266 | Glutamine cyclotransferase; pyroglutamate, acyltra | 92.52 | |
| 3nok_A | 268 | Glutaminyl cyclase; beta-propeller, cyclotransfera | 91.11 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 91.11 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 89.76 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 89.62 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 89.09 | |
| 1kv9_A | 668 | Type II quinohemoprotein alcohol dehydrogenase; el | 88.64 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 88.6 | |
| 1kb0_A | 677 | Quinohemoprotein alcohol dehydrogenase; beta-prope | 88.25 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 88.14 | |
| 2ad6_A | 571 | Methanol dehydrogenase subunit 1; PQQ configuratio | 87.16 | |
| 1yiq_A | 689 | Quinohemoprotein alcohol dehydrogenase; electron t | 86.81 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 85.55 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 84.68 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 84.2 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 83.66 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 83.53 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 82.61 | |
| 3c5m_A | 396 | Oligogalacturonate lyase; blade-shaped beta-propel | 82.06 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 81.04 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 80.08 |
| >1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.4e-33 Score=257.99 Aligned_cols=192 Identities=16% Similarity=0.185 Sum_probs=165.2
Q ss_pred hhhhccCCCCCCEEEcCCCCCCcccceEEEECCEEEEEeecCCCCCccceEEEEECCCCceeeCCCCCCCCCceeeEEEE
Q 020688 97 ATFADLPAPDLEWEQMPSAPVPRLDGAAIQIKNLFYVFAGYGSLDYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGVVS 176 (322)
Q Consensus 97 ~~~~~~~~~~~~W~~~~~~p~~R~~~~~~~~~~~lyv~GG~~~~~~~~~~v~~yd~~t~~W~~~~~~~~p~~r~~~~~~~ 176 (322)
..++.||+.+++|++++++|.+|..|++++++++|||+||.+... .++++++||+.+++|+.++++|. +|..|++++
T Consensus 90 ~~~~~~d~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~-~~~~~~~yd~~~~~W~~~~~~p~--~r~~~~~~~ 166 (308)
T 1zgk_A 90 SALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCI-HHNSVERYEPERDEWHLVAPMLT--RRIGVGVAV 166 (308)
T ss_dssp CCEEEEETTTTEEEECCCCSSCCBTCEEEEETTEEEEECCEETTE-ECCCEEEEETTTTEEEECCCCSS--CCBSCEEEE
T ss_pred ceEEEECCCCCeEeECCCCCcCccccEEEEECCEEEEEcCCCCCc-ccccEEEECCCCCeEeECCCCCc--cccceEEEE
Confidence 446678888999999999999999999999999999999986644 46789999999999999999987 899999999
Q ss_pred eCCEEEEEecccCCCCCCCCceEEEEECCCCcEEecCCCCCCCCCCeEEEECCEEEEEccCCCCCCCCCcceeEeEEecc
Q 020688 177 DGRYIYIVSGQYGPQCRGPTSRTFVLDSETRKWDSIPPLPSPRYSPATQLWRGRLHVMGGSKENRHTPGLEHWSIAVKDG 256 (322)
Q Consensus 177 ~~~~iyv~GG~~~~~~~~~~~~~~~yD~~t~~W~~~~~~p~~r~~~~~~~~~~~Lyi~GG~~~~~~~~~~~~~~i~~yd~ 256 (322)
++++|||+||.++... .+++++||+.+++|+.++++|.+|..+++++++++|||+||.++....+ ++++||+
T Consensus 167 ~~~~iyv~GG~~~~~~---~~~~~~yd~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~-----~v~~yd~ 238 (308)
T 1zgk_A 167 LNRLLYAVGGFDGTNR---LNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLN-----SVERYDV 238 (308)
T ss_dssp ETTEEEEECCBCSSCB---CCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCBCSSSBCC-----CEEEEET
T ss_pred ECCEEEEEeCCCCCCc---CceEEEEeCCCCeEeeCCCCCCccccceEEEECCEEEEEeCCCCCCccc-----eEEEEeC
Confidence 9999999999987664 7899999999999999999999999999999999999999987654333 5668887
Q ss_pred cccccccccc--cCCCCCcceEEEEeCCEEEEEccccCCC--CceEEeec
Q 020688 257 KALEKAWRTE--IPIPRGGPHRFAGFPHVIYLSLVSSVED--LNFYVIQV 302 (322)
Q Consensus 257 ~~~~~~W~~~--~p~pr~~~~~~~v~~~~iyi~GG~~~e~--~~~~~~q~ 302 (322)
. +++|+.. +|.+|.+ |++++++++||++||.+... .+++.+.+
T Consensus 239 ~--~~~W~~~~~~p~~r~~-~~~~~~~~~i~v~GG~~~~~~~~~v~~yd~ 285 (308)
T 1zgk_A 239 E--TETWTFVAPMKHRRSA-LGITVHQGRIYVLGGYDGHTFLDSVECYDP 285 (308)
T ss_dssp T--TTEEEECCCCSSCCBS-CEEEEETTEEEEECCBCSSCBCCEEEEEET
T ss_pred C--CCcEEECCCCCCCccc-eEEEEECCEEEEEcCcCCCcccceEEEEcC
Confidence 6 9999986 4556888 79999999999999976443 34445444
|
| >4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} | Back alignment and structure |
|---|
| >3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} | Back alignment and structure |
|---|
| >2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} | Back alignment and structure |
|---|
| >1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A | Back alignment and structure |
|---|
| >4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} | Back alignment and structure |
|---|
| >2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} | Back alignment and structure |
|---|
| >2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} | Back alignment and structure |
|---|
| >2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* | Back alignment and structure |
|---|
| >2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* | Back alignment and structure |
|---|
| >1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A | Back alignment and structure |
|---|
| >1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A | Back alignment and structure |
|---|
| >3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A | Back alignment and structure |
|---|
| >3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
| >2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* | Back alignment and structure |
|---|
| >3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
| >3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A | Back alignment and structure |
|---|
| >3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A | Back alignment and structure |
|---|
| >3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A | Back alignment and structure |
|---|
| >2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* | Back alignment and structure |
|---|
| >3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* | Back alignment and structure |
|---|
| >1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A | Back alignment and structure |
|---|
| >3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 322 | ||||
| d1zgka1 | 288 | b.68.11.1 (A:322-609) Kelch-like ECH-associated pr | 1e-06 | |
| d1zgka1 | 288 | b.68.11.1 (A:322-609) Kelch-like ECH-associated pr | 3e-05 | |
| d1zgka1 | 288 | b.68.11.1 (A:322-609) Kelch-like ECH-associated pr | 2e-04 | |
| d1zgka1 | 288 | b.68.11.1 (A:322-609) Kelch-like ECH-associated pr | 2e-04 | |
| d1zgka1 | 288 | b.68.11.1 (A:322-609) Kelch-like ECH-associated pr | 8e-04 | |
| d1k3ia3 | 387 | b.69.1.1 (A:151-537) Galactose oxidase, central do | 7e-06 | |
| d1k3ia3 | 387 | b.69.1.1 (A:151-537) Galactose oxidase, central do | 1e-04 |
| >d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
class: All beta proteins fold: 6-bladed beta-propeller superfamily: Kelch motif family: Kelch motif domain: Kelch-like ECH-associated protein 1, KEAP1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 46.8 bits (109), Expect = 1e-06
Identities = 16/72 (22%), Positives = 23/72 (31%), Gaps = 4/72 (5%)
Query: 178 GRYIYIVSGQYGPQCRGPTSRTFVLDSETRKWDSIPPLPSPRYSPATQLWRGRLHVMGGS 237
GR IY G + R S + W + L PR A + G L+ +GG
Sbjct: 4 GRLIYTAGGYF----RQSLSYLEAYNPSNGTWLRLADLQVPRSGLAGCVVGGLLYAVGGR 59
Query: 238 KENRHTPGLEHW 249
+
Sbjct: 60 NNSPDGNTDSSA 71
|
| >d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 | Back information, alignment and structure |
|---|
| >d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 322 | |||
| d1zgka1 | 288 | Kelch-like ECH-associated protein 1, KEAP1 {Human | 99.96 | |
| d1zgka1 | 288 | Kelch-like ECH-associated protein 1, KEAP1 {Human | 99.91 | |
| d1k3ia3 | 387 | Galactose oxidase, central domain {Fungi (Fusarium | 99.9 | |
| d1k3ia3 | 387 | Galactose oxidase, central domain {Fungi (Fusarium | 99.81 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 93.35 | |
| d1pexa_ | 192 | Collagenase-3 (MMP-13), C-terminal domain {Human ( | 93.28 | |
| d1q7fa_ | 279 | Brain tumor cg10719-pa {Fruit fly (Drosophila mela | 91.67 | |
| d1su3a2 | 195 | Collagenase (MMP1), C-terminal domain {Human (Homo | 89.22 | |
| d1kv9a2 | 560 | Quinoprotein alcohol dehydrogenase, N-terminal dom | 89.05 | |
| d1kb0a2 | 573 | Quinoprotein alcohol dehydrogenase, N-terminal dom | 87.89 | |
| d1itva_ | 195 | Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: | 87.66 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 84.91 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 83.06 | |
| d1qhua1 | 192 | Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: | 82.22 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 81.69 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 80.92 |
| >d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: 6-bladed beta-propeller superfamily: Kelch motif family: Kelch motif domain: Kelch-like ECH-associated protein 1, KEAP1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.96 E-value=5.4e-28 Score=215.08 Aligned_cols=197 Identities=18% Similarity=0.258 Sum_probs=160.1
Q ss_pred hhccCCCCCCEEEcCCCCCCcccceEEEECCEEEEEeecCCC---CCccceEEEEECCCCceeeCCCCCCCCCceeeEEE
Q 020688 99 FADLPAPDLEWEQMPSAPVPRLDGAAIQIKNLFYVFAGYGSL---DYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGVV 175 (322)
Q Consensus 99 ~~~~~~~~~~W~~~~~~p~~R~~~~~~~~~~~lyv~GG~~~~---~~~~~~v~~yd~~t~~W~~~~~~~~p~~r~~~~~~ 175 (322)
+..||+.+++|++++++|.||.+|++++++++|||+||.... ....+++++||+.+++|+.+++|+. +|..|+++
T Consensus 21 ~~~yd~~t~~W~~~~~~p~~R~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~yd~~~~~w~~~~~~p~--~r~~~~~~ 98 (288)
T d1zgka1 21 LEAYNPSNGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSV--PRNRIGVG 98 (288)
T ss_dssp EEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCEEEETTEEEECCCEEEEETTTTEEEECCCCSS--CCBTCEEE
T ss_pred EEEEECCCCeEEECCCCCCccceeEEEEECCEEEEEeCcccCCCCccccchhhhcccccccccccccccc--eecceecc
Confidence 456788899999999999999999999999999999997321 2346789999999999999999988 89999999
Q ss_pred EeCCEEEEEecccCCCCCCCCceEEEEECCCCcEEecCCCCCCCCCCeEEEECCEEEEEccCCCCCCCCCccee------
Q 020688 176 SDGRYIYIVSGQYGPQCRGPTSRTFVLDSETRKWDSIPPLPSPRYSPATQLWRGRLHVMGGSKENRHTPGLEHW------ 249 (322)
Q Consensus 176 ~~~~~iyv~GG~~~~~~~~~~~~~~~yD~~t~~W~~~~~~p~~r~~~~~~~~~~~Lyi~GG~~~~~~~~~~~~~------ 249 (322)
+++++||++||..+... .++++.||+.++.|...+.++.+|.+++++..++++|++||.+........+.|
T Consensus 99 ~~~~~i~~~gg~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~GG~~~~~~~~~~~~~d~~~~~ 175 (288)
T d1zgka1 99 VIDGHIYAVGGSHGCIH---HNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNE 175 (288)
T ss_dssp EETTEEEEECCEETTEE---CCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCBCSSCBCCCEEEEETTTTE
T ss_pred ccceeeEEecceecccc---cceeeeeccccCccccccccccccccceeeeeeecceEecCcccccccceEEEeeccccc
Confidence 99999999999877665 788999999999999999999999999999999999999997543322222222
Q ss_pred ------------------------------------EeEEecccccccccccc--cCCCCCcceEEEEeCCEEEEEcccc
Q 020688 250 ------------------------------------SIAVKDGKALEKAWRTE--IPIPRGGPHRFAGFPHVIYLSLVSS 291 (322)
Q Consensus 250 ------------------------------------~i~~yd~~~~~~~W~~~--~p~pr~~~~~~~v~~~~iyi~GG~~ 291 (322)
+...||.. +++|+.. .|.||.+ |++++++++|||+||.+
T Consensus 176 ~~~~~~~~~~~~~~~~~~~~~~i~i~GG~~~~~~~~~~~~~~~~--~~~~~~~~~~p~~r~~-~~~~~~~~~l~v~GG~~ 252 (288)
T d1zgka1 176 WRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVE--TETWTFVAPMKHRRSA-LGITVHQGRIYVLGGYD 252 (288)
T ss_dssp EEECCCCSSCCBSCEEEEETTEEEEECCBCSSSBCCCEEEEETT--TTEEEECCCCSSCCBS-CEEEEETTEEEEECCBC
T ss_pred cccccccccccccccccceeeeEEEecCccccccccceeeeeec--ceeeecccCccCcccc-eEEEEECCEEEEEecCC
Confidence 23456654 7777764 4567888 79999999999999975
Q ss_pred CCCC--ceEEeecc
Q 020688 292 VEDL--NFYVIQVP 303 (322)
Q Consensus 292 ~e~~--~~~~~q~~ 303 (322)
...+ +++++-+.
T Consensus 253 ~~~~~~~v~~yd~~ 266 (288)
T d1zgka1 253 GHTFLDSVECYDPD 266 (288)
T ss_dssp SSCBCCEEEEEETT
T ss_pred CCeecceEEEEECC
Confidence 4433 34555444
|
| >d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} | Back information, alignment and structure |
|---|
| >d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|