Citrus Sinensis ID: 020810

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-
MASPPTKDAPADKKAEGSTPKSEATSGSVRDSSSSPSGASAASAFPGVGGAAPNPFDFSAMSGLLNDPSIKELAEQIAKDPAFNSMAEQLQKTLHGANAEESIPQFDTTQYYSTMQQVMQNPQFMTMAERLGNALMQDPSMSHMMESLTNPTKKDQIEERMAKIKEDPSLKPILDEIESGGPSAMMKYWNDKDVLQKLGEAMGLAVGGDATTSADNAGADEAEEVGNEDESIVHHTASVGDAEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGANVDALDKNKNTALHYAAGYGRKECVALLLENGAAV
cccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccHHHHHHHHHccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHcHHHHHHHHHHcccccHHHHHHccHHccccccccccHHHHHHHHHHccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHcccccHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHccccc
cccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccHcHHHHHHHHHccHHHHHHHHHHHHHHHcccHHcccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccHHHHHHHcccccHHHHHHHHHHHHHHccccccHHHHHHcccHHHHHHHHcccccccccHHHHHcccccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccc
maspptkdapadkkaegstpkseatsgsvrdsssspsgasaasafpgvggaapnpfdfsamsgllndpsIKELAEQIAKDPAFNSMAEQLQKTLhganaeesipqfdttQYYSTMQQVMQNPQFMTMAERLGnalmqdpsmshmmesltnptkkdQIEERMAKikedpslkpildeiesggpsammKYWNDKDVLQKLGEAMglavggdattsadnagadeaeevgnedesivhhtasvgdaEGLKNALaagadkdeedsegrTALHFACGYGEVKCAQILLEAganvdaldknknTALHYAAGYGRKECVALLLENGAAV
maspptkdapadkkaegstpkseatsgsvrdsssspsGASAASAFPGVGGAAPNPFDFSAMSGLLNDPSIKELAEQIAKDPAFNSMAEQLQKTLHGANAEESIPQFDTTQYYSTMQQVMQNPQFMTMAERLGNALMQDPSMSHMMESLTNPTKKDQIEERMAkikedpslkpiLDEIESGGPSAMMKYWNDKDVLQKLGEAMGLAVGGDATTSADNAGADEAEEVGNEDESIVHHTASVGDAEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGANVDALDKNKNTALHYAAGYGRKECVALLLENGAAV
MASPPTKDAPADKKAEGSTPKSEatsgsvrdsssspsgasaasafpgvggaapNPFDFSAMSGLLNDPSIKELAEQIAKDPAFNSMAEQLQKTLHGANAEESIPQFDTTQYYSTMQQVMQNPQFMTMAERLGNALMQDPSMSHMMESLTNPTKKDQIEERMAKIKEDPSLKPILDEIESGGPSAMMKYWNDKDVLQKLGEAMGLAVGGDATTSADNAGADEAEEVGNEDESIVHHTASVGDAEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGANVDALDKNKNTALHYAAGYGRKECVALLLENGAAV
******************************************************************************************************************************************************************************************KYWNDKDVLQKLGEAMGLA**********************************************************TALHFACGYGEVKCAQILLEAGANVDALDKNKNTALHYAAGYGRKECVALLLE*****
**************************************************AAPNPFDFSAMSGLLNDPSIKELAEQIAKDPAFNSMAEQLQKTLHGANAEESIPQFDTTQYYSTMQQVMQNPQFMTMAERLGNALMQDPSMSHMMESLTNPTKKDQIEERMAKIKEDPSLKPILDEIESGGPSAMMKYWNDKDVLQKLGEAMGLAVGGDATTSADNAGADEAEEVGNEDESIVHHTASVGDAEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGANVDALDKNKNTALHYAAGYGRKECVALLLENGAAV
********************************************FPGVGGAAPNPFDFSAMSGLLNDPSIKELAEQIAKDPAFNSMAEQLQKTLHGANAEESIPQFDTTQYYSTMQQVMQNPQFMTMAERLGNALMQDPSMSHMMESLTNPTKKDQIEERMAKIKEDPSLKPILDEIESGGPSAMMKYWNDKDVLQKLGEAMGLAVGGDATTSADNAGADEAEEVGNEDESIVHHTASVGDAEGLKNALA************RTALHFACGYGEVKCAQILLEAGANVDALDKNKNTALHYAAGYGRKECVALLLENGAAV
**************************************************AAPNPFDFSAMSGLLNDPSIKELAEQIAKDPAFNSMAEQLQKTLHGANAEESIPQFDTTQYYSTMQQVMQNPQFMTMAERLGNALMQDPSMSHMMESLTNPTKKDQIEERMAKIKEDPSLKPILDEIESGGPSAMMKYWNDKDVLQKLGEAMGLAVGGDATTSADNAGADEAEEVGNEDESIVHHTASVGDAEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGANVDALDKNKNTALHYAAGYGRKECVALLLENG***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASPPTKDAPADKKAEGSTPKSEATSGSVRDSSSSPSGASAASAFPGVGGAAPNPFDFSAMSGLLNDPSIKELAEQIAKDPAFNSMAEQLQKTLHGANAEESIPQFDTTQYYSTMQQVMQNPQFMTMAERLGNALMQDPSMSHMMESLTNPTKKDQIEERMAKIKEDPSLKPILDEIESGGPSAMMKYWNDKDVLQKLGEAMGLAVGGDATTSADNAGADEAEEVGNEDESIVHHTASVGDAEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGANVDALDKNKNTALHYAAGYGRKECVALLLENGAAV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query321 2.2.26 [Sep-21-2011]
Q9SAR5342 Ankyrin repeat domain-con no no 0.894 0.839 0.648 1e-102
Q91ZT9 288 Ankyrin repeat and SOCS b yes no 0.274 0.305 0.449 2e-11
Q5R6D7 288 Ankyrin repeat and SOCS b yes no 0.274 0.305 0.449 2e-11
Q08E43 288 Ankyrin repeat and SOCS b yes no 0.274 0.305 0.449 2e-11
Q9H765 288 Ankyrin repeat and SOCS b yes no 0.274 0.305 0.449 2e-11
Q4R544 288 Ankyrin repeat and SOCS b N/A no 0.274 0.305 0.438 5e-11
Q811D2 1581 Ankyrin repeat domain-con no no 0.286 0.058 0.373 7e-11
Q54KA7 986 Ankyrin repeat, PH and SE yes no 0.267 0.087 0.425 7e-10
Q6NSI1 321 Putative ankyrin repeat d no no 0.352 0.352 0.342 1e-09
Q502K3 1071 Serine/threonine-protein no no 0.168 0.050 0.434 2e-09
>sp|Q9SAR5|AKR2_ARATH Ankyrin repeat domain-containing protein 2 OS=Arabidopsis thaliana GN=AKR2 PE=1 SV=2 Back     alignment and function desciption
 Score =  373 bits (957), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 190/293 (64%), Positives = 230/293 (78%), Gaps = 6/293 (2%)

Query: 31  DSSSSPSGASAASAFPGVGGAAPNPFDFSAMSGLLNDPSIKELAEQIAKDPAFNSMAEQL 90
           + SS P  AS +S    + G   N FDFS M+ +LNDPSI+E+AEQIAKDPAFN +AEQL
Sbjct: 22  NKSSKPESASGSSTSSAMPGLNFNAFDFSNMASILNDPSIREMAEQIAKDPAFNQLAEQL 81

Query: 91  QKTLHGANAEESIPQFDTTQYYSTMQQVMQNPQFMTMAERLGNALMQDPSMSHMMESLTN 150
           Q+++  A  E   P FD  QY +TMQQVM NP+F TMAE+LG AL+QDP MS  +++ +N
Sbjct: 82  QRSIPNAGQEGGFPNFDPQQYVNTMQQVMHNPEFKTMAEKLGTALVQDPQMSPFLDAFSN 141

Query: 151 PTKKDQIEERMAKIKEDPSLKPILDEIESGGPSAMMKYWNDKDVLQKLGEAMGLAVGG-- 208
           P   +   ERMA++KEDP LKPILDEI++GGPSAMMKYWND +VL+KLGEAMG+ V G  
Sbjct: 142 PETAEHFTERMARMKEDPELKPILDEIDAGGPSAMMKYWNDPEVLKKLGEAMGMPVAGLP 201

Query: 209 DATTSADNAGADEAEEVGNEDESIVHHTASVGDAEGLKNALAAGADKDEEDSEGRTALHF 268
           D T SA+   A+E EE     ESIVH TAS+GD EGLK ALA+G +KDEEDSEGRTALHF
Sbjct: 202 DQTVSAEPEVAEEGEEE----ESIVHQTASLGDVEGLKAALASGGNKDEEDSEGRTALHF 257

Query: 269 ACGYGEVKCAQILLEAGANVDALDKNKNTALHYAAGYGRKECVALLLENGAAV 321
           ACGYGE+KCAQ+L++AGA+V+A+DKNKNT LHYAAGYGRKECV+LLLENGAAV
Sbjct: 258 ACGYGELKCAQVLIDAGASVNAVDKNKNTPLHYAAGYGRKECVSLLLENGAAV 310
Seems to be involved in the regulation of hydrogen peroxide levels during biotic and abiotic stresses by optimizing the ascorbate peroxidase 3 (APX3) hydrogen peroxide-degrading activity. This regulation might be monitored by GRF6.
Arabidopsis thaliana (taxid: 3702)
>sp|Q91ZT9|ASB8_MOUSE Ankyrin repeat and SOCS box protein 8 OS=Mus musculus GN=Asb8 PE=2 SV=1 Back     alignment and function description
>sp|Q5R6D7|ASB8_PONAB Ankyrin repeat and SOCS box protein 8 OS=Pongo abelii GN=ASB8 PE=2 SV=1 Back     alignment and function description
>sp|Q08E43|ASB8_BOVIN Ankyrin repeat and SOCS box protein 8 OS=Bos taurus GN=ASB8 PE=2 SV=1 Back     alignment and function description
>sp|Q9H765|ASB8_HUMAN Ankyrin repeat and SOCS box protein 8 OS=Homo sapiens GN=ASB8 PE=2 SV=1 Back     alignment and function description
>sp|Q4R544|ASB8_MACFA Ankyrin repeat and SOCS box protein 8 OS=Macaca fascicularis GN=ASB8 PE=2 SV=1 Back     alignment and function description
>sp|Q811D2|ANR26_MOUSE Ankyrin repeat domain-containing protein 26 OS=Mus musculus GN=Ankrd26 PE=1 SV=2 Back     alignment and function description
>sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 Back     alignment and function description
>sp|Q6NSI1|AR26L_HUMAN Putative ankyrin repeat domain-containing protein 26-like protein OS=Homo sapiens GN=ANKRD26P1 PE=5 SV=2 Back     alignment and function description
>sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query321
359474945358 PREDICTED: ankyrin repeat domain-contain 0.990 0.888 0.799 1e-141
37625031354 putative ankyrin-repeat protein [Vitis a 0.862 0.782 0.849 1e-140
255546638345 ankyrin repeat domain protein, putative 0.962 0.895 0.775 1e-138
327344119371 putative PDF1-interacting protein 2, par 0.903 0.781 0.820 1e-137
449444443359 PREDICTED: ankyrin repeat domain-contain 0.981 0.877 0.740 1e-137
224132484308 predicted protein [Populus trichocarpa] 0.859 0.896 0.826 1e-137
224132478366 predicted protein [Populus trichocarpa] 0.838 0.734 0.851 1e-135
359806300352 uncharacterized protein LOC100784610 [Gl 0.996 0.909 0.747 1e-135
359806322350 uncharacterized protein LOC100797622 [Gl 0.978 0.897 0.741 1e-135
118485011366 unknown [Populus trichocarpa] 0.838 0.734 0.847 1e-135
>gi|359474945|ref|XP_002283498.2| PREDICTED: ankyrin repeat domain-containing protein 2-like [Vitis vinifera] gi|297744439|emb|CBI37701.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  507 bits (1306), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 263/329 (79%), Positives = 279/329 (84%), Gaps = 11/329 (3%)

Query: 1   MASPPTKDAPADKKAEGSTPKSEATSGSVRDSSSSPSGASAASAFPGVGGAAPNPFDFSA 60
           MAS   KD PAD+K  GS   S++ S S    S     A+AAS  PG G  A NPFDFSA
Sbjct: 1   MASNSDKDTPADEKT-GSAENSKSDSSSGESHSEQRRAAAAAS-VPGAGLPA-NPFDFSA 57

Query: 61  MSGLLNDPSIKELAEQIAKDPAFNSMAEQLQKTLHGANAEESIPQFDTTQYYSTMQQVMQ 120
           M+GLLNDPSIKELAEQIAKDPAFN MAEQLQKT HGA  EESIPQFDT QYYSTMQQVMQ
Sbjct: 58  MTGLLNDPSIKELAEQIAKDPAFNQMAEQLQKTFHGAAVEESIPQFDTQQYYSTMQQVMQ 117

Query: 121 NPQFMTMAERLGNALMQDPSMSHMMESLTNPTKKDQIEERMAKIKEDPSLKPILDEIESG 180
           NPQFMTMAERLGNALMQDPSMS M+E+L NPT KDQ+EERMA+IKEDPSLKPILDEIE+G
Sbjct: 118 NPQFMTMAERLGNALMQDPSMSSMLENLANPTHKDQLEERMARIKEDPSLKPILDEIETG 177

Query: 181 GPSAMMKYWNDKDVLQKLGEAMGLAVGGDATTSADNAGADEAEEVGNEDESIVHH----- 235
           GP+AMM+YWNDKDVLQKLGEAMGLAV GDA  SADN+G DEAEE+ NEDESI HH     
Sbjct: 178 GPAAMMRYWNDKDVLQKLGEAMGLAVSGDAAASADNSGLDEAEELANEDESIAHHHSESI 237

Query: 236 ---TASVGDAEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGANVDALD 292
              TASVGD EGLKNALA+GADKDEEDSEGRTALHFACGYGEVKCAQIL+EAGA VDALD
Sbjct: 238 VHDTASVGDVEGLKNALASGADKDEEDSEGRTALHFACGYGEVKCAQILVEAGATVDALD 297

Query: 293 KNKNTALHYAAGYGRKECVALLLENGAAV 321
           KNKNTALHYAAGYGRKECVALLLENGAAV
Sbjct: 298 KNKNTALHYAAGYGRKECVALLLENGAAV 326

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|37625031|gb|AAQ96339.1| putative ankyrin-repeat protein [Vitis aestivalis] Back     alignment and taxonomy information
>gi|255546638|ref|XP_002514378.1| ankyrin repeat domain protein, putative [Ricinus communis] gi|223546475|gb|EEF47974.1| ankyrin repeat domain protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|327344119|gb|AEA50964.1| putative PDF1-interacting protein 2, partial [Gossypium barbadense] Back     alignment and taxonomy information
>gi|449444443|ref|XP_004139984.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Cucumis sativus] gi|449475676|ref|XP_004154520.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224132484|ref|XP_002328292.1| predicted protein [Populus trichocarpa] gi|222837807|gb|EEE76172.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224132478|ref|XP_002328290.1| predicted protein [Populus trichocarpa] gi|222837805|gb|EEE76170.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359806300|ref|NP_001241477.1| uncharacterized protein LOC100784610 [Glycine max] gi|255646471|gb|ACU23714.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|359806322|ref|NP_001241225.1| uncharacterized protein LOC100797622 [Glycine max] gi|255639193|gb|ACU19895.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|118485011|gb|ABK94370.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query321
TAIR|locus:2827572344 AKR2B "ankyrin repeat-containi 0.822 0.767 0.720 1.1e-101
TAIR|locus:2063804240 AT2G03430 "AT2G03430" [Arabido 0.327 0.437 0.403 1.6e-14
UNIPROTKB|Q746T3141 GSU3435 "Ankyrin repeat protei 0.258 0.588 0.421 2.8e-12
TIGR_CMR|GSU_3435141 GSU_3435 "ankyrin repeat prote 0.258 0.588 0.421 2.8e-12
UNIPROTKB|Q08E43 288 ASB8 "Ankyrin repeat and SOCS 0.274 0.305 0.449 5.1e-12
UNIPROTKB|E2QST3 288 ASB8 "Uncharacterized protein" 0.274 0.305 0.449 5.1e-12
UNIPROTKB|Q9H765 288 ASB8 "Ankyrin repeat and SOCS 0.274 0.305 0.449 5.1e-12
UNIPROTKB|I3LRC3 288 ASB8 "Uncharacterized protein" 0.274 0.305 0.449 5.1e-12
RGD|1309246 288 Asb8 "ankyrin repeat and SOCS 0.274 0.305 0.449 5.1e-12
MGI|MGI:1925791 288 Asb8 "ankyrin repeat and SOCS 0.274 0.305 0.449 5.1e-12
TAIR|locus:2827572 AKR2B "ankyrin repeat-containing 2B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1008 (359.9 bits), Expect = 1.1e-101, P = 1.1e-101
 Identities = 193/268 (72%), Positives = 226/268 (84%)

Query:    54 NPFDFSAMSGLLNDPSIKELAEQIAKDPAFNSMAEQLQKTLHGANAEESIPQFDTTQYYS 113
             N FDFS M+G+LNDPSIKELAEQIAKDP+FN +AEQLQ+++   + E  +P FD  QY  
Sbjct:    49 NAFDFSGMAGILNDPSIKELAEQIAKDPSFNQLAEQLQRSVPTGSHEGGLPNFDPQQYMQ 108

Query:   114 TMQQVMQNPQFMTMAERLGNALMQDPSMSHMMESLTNPTKKDQIEERMAKIKEDPSLKPI 173
             TMQQVM+NP+F TMAERLGNAL+QDP MS  +E+L NP   +Q  ERMA++KEDP LKPI
Sbjct:   109 TMQQVMENPEFRTMAERLGNALVQDPQMSPFLEALGNPAASEQFAERMAQMKEDPELKPI 168

Query:   174 LDEIESGGPSAMMKYWNDKDVLQKLGEAMGLAVGGDATTSADNAGADEAEEVGNEDESIV 233
             L EI++GGPSAMMKYWNDKDVL KLGEAMG+AVG D T +A+    +EAEE G E+ESIV
Sbjct:   169 LAEIDAGGPSAMMKYWNDKDVLAKLGEAMGIAVGADQTVAAE---PEEAEE-GEEEESIV 224

Query:   234 HHTASVGDAEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGANVDALDK 293
             H TAS+GD EGLK ALA+G +KDEEDSEGRTALHFACGYGEV+CAQ+LL+AGAN +A+DK
Sbjct:   225 HQTASLGDVEGLKAALASGGNKDEEDSEGRTALHFACGYGEVRCAQVLLDAGANANAIDK 284

Query:   294 NKNTALHYAAGYGRKECVALLLENGAAV 321
             NKNT LHYAAGYGRKECV+LLLENGAAV
Sbjct:   285 NKNTPLHYAAGYGRKECVSLLLENGAAV 312
GO:0005737 "cytoplasm" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2063804 AT2G03430 "AT2G03430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q746T3 GSU3435 "Ankyrin repeat protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_3435 GSU_3435 "ankyrin repeat protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|Q08E43 ASB8 "Ankyrin repeat and SOCS box protein 8" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QST3 ASB8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H765 ASB8 "Ankyrin repeat and SOCS box protein 8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LRC3 ASB8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1309246 Asb8 "ankyrin repeat and SOCS box-containing 8" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1925791 Asb8 "ankyrin repeat and SOCS box-containing 8" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query321
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-26
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 6e-22
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 7e-22
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-20
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 6e-14
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 1e-13
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-13
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 8e-12
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 2e-10
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 7e-10
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 8e-10
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 2e-09
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 2e-09
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 7e-09
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 2e-08
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 3e-08
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 3e-08
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-08
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 3e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 3e-07
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 4e-07
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 6e-07
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 9e-07
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-06
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 4e-06
pfam0002333 pfam00023, Ank, Ankyrin repeat 6e-06
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 3e-05
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 3e-05
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 4e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 6e-05
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 1e-04
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 1e-04
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-04
smart0024830 smart00248, ANK, ankyrin repeats 1e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 2e-04
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 3e-04
smart0024830 smart00248, ANK, ankyrin repeats 3e-04
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 4e-04
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 5e-04
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 6e-04
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 0.001
PHA02946 446 PHA02946, PHA02946, ankyin-like protein; Provision 0.001
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 0.002
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.002
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 0.002
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 0.002
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.003
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information 
 Score =  101 bits (254), Expect = 1e-26
 Identities = 41/95 (43%), Positives = 59/95 (62%)

Query: 227 NEDESIVHHTASVGDAEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGA 286
            +  + +H  AS G  E +K  L  GAD + +D++GRT LH A   G ++  ++LLE GA
Sbjct: 5   EDGRTPLHLAASNGHLEVVKLLLENGADVNAKDNDGRTPLHLAAKNGHLEIVKLLLEKGA 64

Query: 287 NVDALDKNKNTALHYAAGYGRKECVALLLENGAAV 321
           +V+A DK+ NT LH AA  G  + V LLL++GA V
Sbjct: 65  DVNARDKDGNTPLHLAARNGNLDVVKLLLKHGADV 99

The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 321
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.88
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.84
PHA02875 413 ankyrin repeat protein; Provisional 99.8
PHA02743166 Viral ankyrin protein; Provisional 99.8
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.8
KOG0508 615 consensus Ankyrin repeat protein [General function 99.78
PHA02859209 ankyrin repeat protein; Provisional 99.78
PHA02791 284 ankyrin-like protein; Provisional 99.77
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.77
PHA02791284 ankyrin-like protein; Provisional 99.77
PHA02736154 Viral ankyrin protein; Provisional 99.76
PHA02741169 hypothetical protein; Provisional 99.76
PHA02874 434 ankyrin repeat protein; Provisional 99.75
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.75
PHA02875 413 ankyrin repeat protein; Provisional 99.75
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.74
PHA02878 477 ankyrin repeat protein; Provisional 99.74
PHA02741169 hypothetical protein; Provisional 99.74
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.72
PHA02859209 ankyrin repeat protein; Provisional 99.71
PHA02795 437 ankyrin-like protein; Provisional 99.71
PHA02878 477 ankyrin repeat protein; Provisional 99.71
PHA03100 480 ankyrin repeat protein; Provisional 99.71
PHA02874 434 ankyrin repeat protein; Provisional 99.71
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.7
PHA02884 300 ankyrin repeat protein; Provisional 99.7
PHA03095 471 ankyrin-like protein; Provisional 99.69
PHA02798 489 ankyrin-like protein; Provisional 99.69
PHA03100 480 ankyrin repeat protein; Provisional 99.69
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.69
PHA02743166 Viral ankyrin protein; Provisional 99.68
PHA02946 446 ankyin-like protein; Provisional 99.68
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.68
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.68
PHA02884 300 ankyrin repeat protein; Provisional 99.67
KOG0514452 consensus Ankyrin repeat protein [General function 99.67
PHA03095 471 ankyrin-like protein; Provisional 99.67
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.66
KOG0510 929 consensus Ankyrin repeat protein [General function 99.65
PHA02876 682 ankyrin repeat protein; Provisional 99.64
PHA02946 446 ankyin-like protein; Provisional 99.64
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.63
PHA02917 661 ankyrin-like protein; Provisional 99.63
PHA02730 672 ankyrin-like protein; Provisional 99.62
KOG0510 929 consensus Ankyrin repeat protein [General function 99.62
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.62
PHA02876 682 ankyrin repeat protein; Provisional 99.62
PHA02989 494 ankyrin repeat protein; Provisional 99.61
PHA02736154 Viral ankyrin protein; Provisional 99.61
PHA02989 494 ankyrin repeat protein; Provisional 99.61
PHA02798 489 ankyrin-like protein; Provisional 99.6
KOG0508 615 consensus Ankyrin repeat protein [General function 99.6
PHA02795 437 ankyrin-like protein; Provisional 99.59
PHA02730 672 ankyrin-like protein; Provisional 99.58
PHA02917 661 ankyrin-like protein; Provisional 99.56
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.56
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.56
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.55
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.53
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.51
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.51
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.51
KOG0514452 consensus Ankyrin repeat protein [General function 99.5
KOG0515 752 consensus p53-interacting protein 53BP/ASPP, conta 99.5
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.5
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.48
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.48
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.46
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.46
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.46
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.44
PHA02792 631 ankyrin-like protein; Provisional 99.43
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.43
PHA02792 631 ankyrin-like protein; Provisional 99.4
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.4
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.39
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.34
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.34
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.33
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.29
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.27
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.23
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.21
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.2
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.1
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.08
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 99.07
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.99
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.98
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.95
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 98.88
PF1360630 Ank_3: Ankyrin repeat 98.81
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 98.81
KOG0522 560 consensus Ankyrin repeat protein [General function 98.75
PF1360630 Ank_3: Ankyrin repeat 98.75
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.71
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.69
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.63
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.58
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.51
KOG0511 516 consensus Ankyrin repeat protein [General function 98.44
KOG0511 516 consensus Ankyrin repeat protein [General function 98.38
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.31
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.3
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.3
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.28
KOG0520 975 consensus Uncharacterized conserved protein, conta 98.23
KOG0522 560 consensus Ankyrin repeat protein [General function 98.14
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.1
KOG2384 223 consensus Major histocompatibility complex protein 98.04
KOG2384 223 consensus Major histocompatibility complex protein 98.01
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.53
KOG0520 975 consensus Uncharacterized conserved protein, conta 97.51
KOG2505 591 consensus Ankyrin repeat protein [General function 97.27
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.16
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.87
smart0072741 STI1 Heat shock chaperonin-binding motif. 96.63
KOG2505591 consensus Ankyrin repeat protein [General function 96.14
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 96.06
smart0072741 STI1 Heat shock chaperonin-binding motif. 95.99
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 94.1
KOG0553304 consensus TPR repeat-containing protein [General f 93.11
KOG0010 493 consensus Ubiquitin-like protein [Posttranslationa 87.7
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 85.82
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 85.02
KOG0553304 consensus TPR repeat-containing protein [General f 82.39
PF0928059 XPC-binding: XPC-binding domain; InterPro: IPR0153 82.12
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 80.82
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.88  E-value=1.6e-22  Score=166.70  Aligned_cols=99  Identities=30%  Similarity=0.387  Sum_probs=62.6

Q ss_pred             hhcCCCCchHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCcHHHHHHHCCCHHHHHHHHHcCCCCCCccCCCCcHHHHH
Q 020810          223 EEVGNEDESIVHHTASVGDAEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGANVDALDKNKNTALHYA  302 (321)
Q Consensus       223 ~~~d~~g~t~Lh~Aa~~g~~~~v~~Ll~~g~~~~~~d~~g~TpLh~A~~~g~~~~v~~Ll~~ga~~~~~d~~g~TpLh~A  302 (321)
                      +..+..|.|+||||+..|.++++.+|+++|+.++.+|..|.||||.|+..|.++++++|+..|+.+|.+|..|+||||.|
T Consensus       100 na~tn~G~T~LHyAagK~r~eIaqlLle~ga~i~~kD~~~qtplHRAAavGklkvie~Li~~~a~~n~qDk~G~TpL~~a  179 (226)
T KOG4412|consen  100 NATTNGGQTCLHYAAGKGRLEIAQLLLEKGALIRIKDKQGQTPLHRAAAVGKLKVIEYLISQGAPLNTQDKYGFTPLHHA  179 (226)
T ss_pred             ceecCCCcceehhhhcCChhhHHHHHHhcCCCCcccccccCchhHHHHhccchhhHHHHHhcCCCCCcccccCccHHHHH
Confidence            44455566666666666666666666666666666666666666666666666666666666666666666666666666


Q ss_pred             HHCCcHHHHHHHHHCCCCC
Q 020810          303 AGYGRKECVALLLENGAAV  321 (321)
Q Consensus       303 ~~~g~~~iv~~Ll~~GAdv  321 (321)
                      ...|+.++..+|+++||++
T Consensus       180 l~e~~~d~a~lLV~~gAd~  198 (226)
T KOG4412|consen  180 LAEGHPDVAVLLVRAGADT  198 (226)
T ss_pred             HhccCchHHHHHHHhccce
Confidence            5556666666666666653

>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00727 STI1 Heat shock chaperonin-binding motif Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>smart00727 STI1 Heat shock chaperonin-binding motif Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09280 XPC-binding: XPC-binding domain; InterPro: IPR015360 Members of this entry adopt a structure consisting of four alpha helices, arranged in an array Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query321
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 3e-13
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 7e-13
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-12
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 1e-12
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 3e-12
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 4e-11
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-10
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 2e-10
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 3e-10
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 3e-10
2xeh_A157 Structural Determinants For Improved Thermal Stabil 4e-10
2xee_A157 Structural Determinants For Improved Thermal Stabil 4e-10
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 4e-10
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 5e-10
3deo_A183 Structural Basis For Specific Substrate Recognition 5e-10
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 6e-10
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 6e-10
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 8e-10
3ui2_A 244 Crystal Structure Of The Cpsrp54 Tail Bound To Cpsr 1e-09
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 1e-09
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 1e-09
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 2e-09
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 3e-09
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 5e-09
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 1e-08
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 1e-08
3utm_A 351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 1e-08
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 2e-08
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 2e-08
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 2e-08
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 2e-08
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 2e-08
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 4e-08
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 5e-08
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 5e-08
3d9h_A 285 Crystal Structure Of The Splice Variant Of Human As 6e-08
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 7e-08
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 7e-08
3zkj_A 261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 8e-08
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 8e-08
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 9e-08
1uoh_A226 Human Gankyrin Length = 226 9e-08
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 9e-08
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 1e-07
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 1e-07
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 2e-07
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 3e-07
3aaa_C123 Crystal Structure Of Actin Capping Protein In Compl 1e-06
1myo_A118 Solution Structure Of Myotrophin, Nmr, 44 Structure 2e-06
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 2e-06
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 2e-06
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 3e-06
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 4e-06
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 5e-06
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 5e-06
3uxg_A172 Crystal Structure Of Rfxank Length = 172 5e-06
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 6e-06
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 6e-06
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 7e-06
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 7e-06
2fo1_E373 Crystal Structure Of The Csl-Notch-Mastermind Terna 1e-05
1s70_B 299 Complex Between Protein Ser/thr Phosphatase-1 (delt 2e-05
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 2e-05
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 2e-05
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 3e-05
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 3e-05
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 4e-05
3so8_A162 Crystal Structure Of Ankra Length = 162 4e-05
4a63_B 239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 4e-05
1ycs_B 239 P53-53bp2 Complex Length = 239 4e-05
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 4e-05
2xen_A91 Structural Determinants For Improved Thermal Stabil 1e-04
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 1e-04
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 2e-04
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 2e-04
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 2e-04
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 2e-04
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 2e-04
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 3e-04
4g8k_A 337 Intact Sensor Domain Of Human Rnase L In The Inacti 4e-04
1wdy_A 285 Crystal Structure Of Ribonuclease Length = 285 8e-04
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 8e-04
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure 
Iteration: 1

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 54/89 (60%)
Query: 233 VHHTASVGDAEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGANVDALD 292
           +H  A  G  E +K  L AGAD + +D  GRT LH A   G ++  ++LLEAGA+V+A D
Sbjct: 6   LHLAARNGHLEVVKLLLEAGADVNAKDKNGRTPLHLAARNGHLEVVKLLLEAGADVNAKD 65
Query: 293 KNKNTALHYAAGYGRKECVALLLENGAAV 321
           KN  T LH AA  G  E V LLLE GA V
Sbjct: 66  KNGRTPLHLAARNGHLEVVKLLLEAGADV 94
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|3DEO|A Chain A, Structural Basis For Specific Substrate Recognition By The Chloroplast Signal Recognition Particle Protein Cpsrp43 Length = 183 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3UI2|A Chain A, Crystal Structure Of The Cpsrp54 Tail Bound To Cpsrp43 Length = 244 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 Back     alignment and structure
>pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query321
3deo_A183 Signal recognition particle 43 kDa protein; chloro 9e-28
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-22
3deo_A 183 Signal recognition particle 43 kDa protein; chloro 1e-13
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-08
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-27
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-24
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-24
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-23
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-21
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-20
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-18
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-06
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 2e-26
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-22
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 2e-20
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-15
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 5e-12
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 9e-09
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-26
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-23
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-23
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-22
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-20
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 6e-17
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 8e-07
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 7e-26
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-19
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 8e-18
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-05
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-25
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-24
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-24
3v31_A 167 Ankyrin repeat family A protein 2; structural geno 2e-19
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-10
3v31_A 167 Ankyrin repeat family A protein 2; structural geno 9e-05
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-25
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-17
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-11
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-07
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-25
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 9e-22
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-21
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 8e-06
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-24
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-23
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-22
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-22
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-21
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-19
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-18
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-13
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-10
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-08
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-24
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-24
3v30_A 172 DNA-binding protein rfxank; structural genomics co 2e-17
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-12
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-24
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-24
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-23
3f6q_A 179 Integrin-linked protein kinase; ILK, integrin-link 5e-18
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 8e-11
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 4e-24
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-22
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 1e-19
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 4e-18
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-17
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-14
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 1e-12
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-04
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 5e-24
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-22
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-21
3hra_A 201 Ankyrin repeat family protein; structural protein; 5e-24
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-19
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-18
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-17
3hra_A 201 Ankyrin repeat family protein; structural protein; 8e-05
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 6e-24
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-23
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 7e-19
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-04
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-24
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-23
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-22
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-16
1ihb_A 162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-05
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 8e-24
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-23
2f8y_A 223 Notch homolog 1, translocation-associated (drosoph 7e-21
2f8y_A 223 Notch homolog 1, translocation-associated (drosoph 9e-10
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 8e-08
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 8e-24
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-19
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 7e-05
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-23
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-20
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-15
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 8e-07
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-23
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-23
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-23
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-23
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-23
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-22
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-22
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-22
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-21
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-19
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-11
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-23
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-21
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-19
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 8e-15
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-23
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-23
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-09
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-23
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-22
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-21
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-18
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-16
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-15
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-08
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-23
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-23
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-20
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-15
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-04
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-23
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-20
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-23
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 4e-22
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 4e-20
3twr_A 165 Tankyrase-2; ankyrin repeat, protein-protein inter 8e-06
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-23
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-21
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-19
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-16
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-13
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-10
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-23
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 6e-23
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-21
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 2e-21
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-07
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-23
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 7e-22
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-19
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-13
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-23
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-19
1awc_B153 Protein (GA binding protein beta 1); complex (tran 9e-16
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-23
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-22
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-22
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-19
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-18
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-15
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 9e-15
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-07
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-23
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-22
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 8e-22
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-21
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-19
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-18
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-07
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-04
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 5e-23
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-22
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-21
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 2e-21
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 8e-21
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 2e-20
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-08
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 1e-07
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-23
2dzn_A 228 Probable 26S proteasome regulatory subunit P28; an 2e-19
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-19
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 7e-19
2dzn_A 228 Probable 26S proteasome regulatory subunit P28; an 3e-17
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-14
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-23
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-22
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 8e-21
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-18
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-18
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-16
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 6e-23
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-18
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-15
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 8e-12
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-22
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-22
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-21
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-20
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-22
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-22
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-21
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-19
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-16
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-13
3aji_A 231 26S proteasome non-ATPase regulatory subunit 10; g 7e-21
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 8e-16
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-14
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-14
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-13
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-06
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 8e-21
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 1e-20
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 4e-20
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 2e-19
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 6e-19
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 3e-17
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 6e-16
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-14
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 5e-13
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 1e-07
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-20
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-19
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-18
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-16
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-16
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-13
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-07
2rfa_A 232 Transient receptor potential cation channel subfa 3e-20
2rfa_A232 Transient receptor potential cation channel subfa 1e-17
2rfa_A232 Transient receptor potential cation channel subfa 7e-17
2rfa_A 232 Transient receptor potential cation channel subfa 8e-17
2rfa_A232 Transient receptor potential cation channel subfa 1e-07
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-20
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-16
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-10
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-19
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 6e-15
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-04
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-18
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 8e-18
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-16
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-09
3t8k_A 186 Uncharacterized protein; structural genomics, PSI- 9e-08
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-17
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-14
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 5e-04
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 3e-16
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-14
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-11
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-10
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-16
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-12
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-10
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-09
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 7e-04
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 5e-16
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 1e-10
2etb_A256 Transient receptor potential cation channel subfam 5e-16
2etb_A256 Transient receptor potential cation channel subfam 2e-15
2etb_A 256 Transient receptor potential cation channel subfam 7e-14
2etb_A256 Transient receptor potential cation channel subfam 4e-13
2etb_A256 Transient receptor potential cation channel subfam 1e-07
2pnn_A273 Transient receptor potential cation channel subfa 7e-16
2pnn_A 273 Transient receptor potential cation channel subfa 1e-15
2pnn_A273 Transient receptor potential cation channel subfa 3e-13
2pnn_A273 Transient receptor potential cation channel subfa 9e-10
2pnn_A273 Transient receptor potential cation channel subfa 9e-10
2pnn_A 273 Transient receptor potential cation channel subfa 4e-09
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-15
3jxi_A 260 Vanilloid receptor-related osmotically activated p 2e-14
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-14
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-12
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-05
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-12
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-11
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
 Score =  105 bits (265), Expect = 9e-28
 Identities = 44/105 (41%), Positives = 53/105 (50%), Gaps = 6/105 (5%)

Query: 216 NAGADEAEEVGNEDESIVHHTASVGDAEGLKNALAAGADKDEEDSEGRTALHFACGYGEV 275
              AD    V +E E+     A   D + L   L    D D  D  GRTAL F  G G  
Sbjct: 35  YIAAD----VVSEYETPWWTAARKADEQALS-QLLEDRDVDAVDENGRTALLFVAGLGSD 89

Query: 276 KCAQILLEAGANVDALD-KNKNTALHYAAGYGRKECVALLLENGA 319
           KC ++L EAGA++D  D +   TALH AAGY R E V  L+E GA
Sbjct: 90  KCVRLLAEAGADLDHRDMRGGLTALHMAAGYVRPEVVEALVELGA 134
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query321
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.92
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.91
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.9
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.88
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.88
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.88
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.88
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.87
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.87
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.87
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.87
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.87
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.87
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.86
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.86
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.86
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.86
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.86
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.86
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.85
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.85
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.85
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.85
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.84
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.84
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.84
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.84
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.84
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.84
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.84
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.84
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.84
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.83
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.83
2rfa_A232 Transient receptor potential cation channel subfa 99.83
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.83
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.83
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.83
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.83
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.83
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.83
2rfa_A232 Transient receptor potential cation channel subfa 99.83
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.82
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.82
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.82
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.82
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.82
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.82
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.82
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.82
3hra_A201 Ankyrin repeat family protein; structural protein; 99.82
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.82
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.82
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.82
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.82
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.82
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.81
2pnn_A273 Transient receptor potential cation channel subfa 99.81
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.81
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.81
3hra_A201 Ankyrin repeat family protein; structural protein; 99.81
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.81
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.81
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.81
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.81
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.81
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.81
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.81
2etb_A256 Transient receptor potential cation channel subfam 99.81
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.81
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.81
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.8
2etb_A256 Transient receptor potential cation channel subfam 99.8
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.8
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.8
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.8
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.8
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.8
2pnn_A273 Transient receptor potential cation channel subfa 99.8
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.8
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.8
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 99.8
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.79
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.79
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.79
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 99.79
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.79
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.79
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.79
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.78
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.78
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.78
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.78
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.77
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.77
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.77
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.77
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.76
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.76
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.76
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.75
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.75
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.73
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.72
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.71
4g8k_A 337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.7
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.67
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.67
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.66
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.63
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.62
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.59
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.58
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.41
2llw_A71 Heat shock protein STI1; DP domain, alpha helix, c 97.64
2lnm_A62 Protein TIC 40, chloroplastic; translocon, import, 97.5
2llw_A71 Heat shock protein STI1; DP domain, alpha helix, c 97.1
2lnm_A62 Protein TIC 40, chloroplastic; translocon, import, 97.03
2llv_A71 Heat shock protein STI1; DP domain, alpha helix, c 96.69
2qsf_X171 RAD23, UV excision repair protein RAD23; alpha-bet 94.18
2qsf_X171 RAD23, UV excision repair protein RAD23; alpha-bet 90.29
2llv_A71 Heat shock protein STI1; DP domain, alpha helix, c 86.49
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=99.92  E-value=1.2e-24  Score=183.31  Aligned_cols=125  Identities=31%  Similarity=0.450  Sum_probs=108.7

Q ss_pred             CChHHHHHHhCChhHHHHHHHHhccccCCcccchhhhcCCchhhhcCCCCchHHHHHHHcCCHHHHHHHHHcCCCCCCCC
Q 020810          180 GGPSAMMKYWNDKDVLQKLGEAMGLAVGGDATTSADNAGADEAEEVGNEDESIVHHTASVGDAEGLKNALAAGADKDEED  259 (321)
Q Consensus       180 g~~~~~~~~~~~~~~~~~l~~~~~~~~~~d~~~~~~~~~~~~~~~~d~~g~t~Lh~Aa~~g~~~~v~~Ll~~g~~~~~~d  259 (321)
                      .++...+...+..++++.+.+                .+.+ ++.+|..|+||||+||..|+.++|++|+++|++++.+|
T Consensus        38 ~t~l~~a~~~~~~~~~~~ll~----------------~gad-~~~~d~~g~TpLh~A~~~g~~~~v~~Ll~~gadvn~~d  100 (169)
T 4gpm_A           38 RTPLHHAAENGHKEVVKLLIS----------------KGAD-VNAKDSDGRTPLHHAAENGHKEVVKLLISKGADVNAKD  100 (169)
T ss_dssp             CCHHHHHHHTTCHHHHHHHHH----------------TTCC-TTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCC
T ss_pred             CCHHHHHHHcCCHHHHHHHHh----------------cccc-hhhhccCCCCHHHHHHHcCCHHHHHHHHHCcCCCCCCC
Confidence            356677777777777766643                2333 46678899999999999999999999999999999999


Q ss_pred             CCCCcHHHHHHHCCCHHHHHHHHHcCCCCCCccCCCCcHHHHHHHCCcHHHHHHHHHCCCCC
Q 020810          260 SEGRTALHFACGYGEVKCAQILLEAGANVDALDKNKNTALHYAAGYGRKECVALLLENGAAV  321 (321)
Q Consensus       260 ~~g~TpLh~A~~~g~~~~v~~Ll~~ga~~~~~d~~g~TpLh~A~~~g~~~iv~~Ll~~GAdv  321 (321)
                      ..|+||||+|+..|+.++|++|+++|++++.+|..|+||||+|+..|+.++|++|+++||+|
T Consensus       101 ~~G~TpLh~A~~~g~~~~v~~Ll~~gad~~~~d~~G~TpL~~A~~~g~~~iv~~Ll~~GA~i  162 (169)
T 4gpm_A          101 SDGRTPLHHAAENGHKEVVKLLISKGADVNTSDSDGRTPLDLAREHGNEEVVKLLEKQGGWL  162 (169)
T ss_dssp             TTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHTC----
T ss_pred             CCCCCHHHHHHHcCCHHHHHHHHHcCCCccccCCCCCCHHHHHHHcCCHHHHHHHHHCCCCc
Confidence            99999999999999999999999999999999999999999999999999999999999986
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2llw_A Heat shock protein STI1; DP domain, alpha helix, chaperone; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lnm_A Protein TIC 40, chloroplastic; translocon, import, TIC40-NP, protein transport; NMR {Arabidopsis thaliana} Back     alignment and structure
>2llw_A Heat shock protein STI1; DP domain, alpha helix, chaperone; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lnm_A Protein TIC 40, chloroplastic; translocon, import, TIC40-NP, protein transport; NMR {Arabidopsis thaliana} Back     alignment and structure
>2llv_A Heat shock protein STI1; DP domain, alpha helix, chaperone; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2llv_A Heat shock protein STI1; DP domain, alpha helix, chaperone; NMR {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 321
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-21
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-17
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-16
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-12
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-12
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-11
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-11
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-10
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-09
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-19
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-11
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-10
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 7e-07
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-18
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-09
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-09
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 7e-09
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-07
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 6e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-15
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 6e-12
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-09
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 4e-05
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-15
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-09
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 5e-09
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 7e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-15
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-13
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-13
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-14
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-10
d1sw6a_ 301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-09
d1sw6a_ 301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 6e-08
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 4e-04
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 7e-14
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-09
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-08
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-13
d1ot8a_ 209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-08
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-06
d1ot8a_ 209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 4e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 7e-12
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-04
d1k1aa_ 228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-11
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-11
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-05
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.001
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 9e-11
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-08
d1iknd_ 221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 6e-08
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-10
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 7e-06
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 7e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-09
d1awcb_ 153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 3e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 0.003
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 7e-09
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 5e-07
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 3e-06
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 5e-05
d1ihba_ 156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-04
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-06
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 92.0 bits (227), Expect = 2e-21
 Identities = 32/88 (36%), Positives = 43/88 (48%)

Query: 234 HHTASVGDAEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGANVDALDK 293
           H  + +G    +KN L  GA  +  + +  T LH A   G  + A+ LL+  A V+A  K
Sbjct: 5   HVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAK 64

Query: 294 NKNTALHYAAGYGRKECVALLLENGAAV 321
           +  T LH AA  G    V LLLEN A  
Sbjct: 65  DDQTPLHCAARIGHTNMVKLLLENNANP 92
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query321
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.87
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.86
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.84
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.83
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.81
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.79
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.79
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.79
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.77
d2fo1e1 277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.77
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.77
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.76
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.76
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.76
d1oy3d_ 255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.75
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.75
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.74
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.73
d1n11a_ 408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.73
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.73
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.73
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.73
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.72
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.72
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.72
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.69
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.69
d2fo1e1 277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.68
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.67
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.67
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.67
d1s70b_ 291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.65
d1k1aa_ 228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.6
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.47
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.43
d2f4mb158 XPC-binding domain of Rad23 homolog B (Hhr23b) {Hu 81.42
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: 53BP2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.87  E-value=2e-22  Score=160.29  Aligned_cols=108  Identities=25%  Similarity=0.323  Sum_probs=69.6

Q ss_pred             cccchhhhcCCchhhhcCCCCchHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCcHHHHHHHCCCHHHHHHHHHcCCCC
Q 020810          209 DATTSADNAGADEAEEVGNEDESIVHHTASVGDAEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGANV  288 (321)
Q Consensus       209 d~~~~~~~~~~~~~~~~d~~g~t~Lh~Aa~~g~~~~v~~Ll~~g~~~~~~d~~g~TpLh~A~~~g~~~~v~~Ll~~ga~~  288 (321)
                      +.+..++..|.+ ++.+|.+|+||||+||..|+.+++++|++.|++++.+|.+|+||||+|+.+|+.++|++|+++|+++
T Consensus        15 ~~v~~Ll~~g~d-~n~~d~~g~t~Lh~A~~~~~~~~~~~ll~~g~~~~~~d~~g~tpLh~A~~~g~~~~v~~Ll~~ga~v   93 (130)
T d1ycsb1          15 DLVQRIIYEVDD-PSLPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAV   93 (130)
T ss_dssp             HHHHHHTSTTSS-CCCCCTTSCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCT
T ss_pred             HHHHHHHHcCCC-ccccccccccccccccccccccccccccccccccccccccCcccccccchhhHHHHHHHHHHcCCCc
Confidence            445555555554 3555666677777777777777777777767677666667777777777777777777777777766


Q ss_pred             CCccC-CCCcHHHHH--HHCCcHHHHHHHHHC
Q 020810          289 DALDK-NKNTALHYA--AGYGRKECVALLLEN  317 (321)
Q Consensus       289 ~~~d~-~g~TpLh~A--~~~g~~~iv~~Ll~~  317 (321)
                      +..+. .++||++++  +..|+.+||++|+..
T Consensus        94 ~~~~~~~~~~~~~~~~a~~~g~~eiv~~L~~~  125 (130)
T d1ycsb1          94 FAMTYSDMQTAADKCEEMEEGYTQCSQFLYGV  125 (130)
T ss_dssp             TCCCSSSCCCHHHHCCSSSTTCCCHHHHHHHH
T ss_pred             ccccCCCCCCHHHHHHHHHcChHHHHHHHHhH
Confidence            65553 466665544  345666677766653
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f4mb1 a.189.1.1 (B:275-332) XPC-binding domain of Rad23 homolog B (Hhr23b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure