Citrus Sinensis ID: 020813
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 321 | ||||||
| 255564468 | 384 | translation initiation factor eif-2b gam | 0.990 | 0.828 | 0.808 | 1e-154 | |
| 224103999 | 458 | predicted protein [Populus trichocarpa] | 0.981 | 0.687 | 0.782 | 1e-149 | |
| 296088193 | 638 | unnamed protein product [Vitis vinifera] | 0.990 | 0.498 | 0.796 | 1e-145 | |
| 359494464 | 463 | PREDICTED: translation initiation factor | 0.990 | 0.686 | 0.796 | 1e-145 | |
| 296082668 | 461 | unnamed protein product [Vitis vinifera] | 0.990 | 0.689 | 0.796 | 1e-145 | |
| 359497208 | 384 | PREDICTED: translation initiation factor | 0.990 | 0.828 | 0.796 | 1e-145 | |
| 356525249 | 459 | PREDICTED: translation initiation factor | 0.984 | 0.688 | 0.764 | 1e-143 | |
| 449452670 | 461 | PREDICTED: translation initiation factor | 0.990 | 0.689 | 0.750 | 1e-140 | |
| 357518837 | 565 | Translation initiation factor eIF-2B sub | 0.975 | 0.553 | 0.746 | 1e-139 | |
| 356512489 | 468 | PREDICTED: translation initiation factor | 0.993 | 0.681 | 0.729 | 1e-138 |
| >gi|255564468|ref|XP_002523230.1| translation initiation factor eif-2b gamma subunit, putative [Ricinus communis] gi|223537526|gb|EEF39151.1| translation initiation factor eif-2b gamma subunit, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 551 bits (1420), Expect = e-154, Method: Compositional matrix adjust.
Identities = 266/329 (80%), Positives = 293/329 (89%), Gaps = 11/329 (3%)
Query: 1 MICSVPVSGLSEAGSSGAKDKTKKPGRYNIIGMDPTKQFLLHIATGAELEKDTRIRKSIL 60
M+CS PV G +E+GSS AKDK KKP RYNIIG+D +KQFLLHIATGAE+EKD I+K+IL
Sbjct: 59 MLCSAPVGGPAESGSSSAKDKIKKPRRYNIIGLDHSKQFLLHIATGAEVEKDILIQKNIL 118
Query: 61 RAVGQMDIRADLMDAHMYAFNRSVLQEVLDQKDKFQSLKQDVLPYLVRSQLKSEILINGA 120
RAVGQM+IR+DLMDAHMYAF RSVLQEVL++KD+FQSLKQDVLPYLVRSQL+SE+L+NG
Sbjct: 119 RAVGQMEIRSDLMDAHMYAFKRSVLQEVLNEKDRFQSLKQDVLPYLVRSQLRSEVLLNGV 178
Query: 121 PQGQQAKENGNDKVSYR--------ILANASTPSFHELYALGPNGSAPVRRTHKCCVYIA 172
PQ A+ENGNDKVS + IL NAS PSFHE YALG + S+ +RRTHKCC YIA
Sbjct: 179 PQ---AEENGNDKVSSQNNQAMVSQILINASMPSFHEPYALGHHDSSTLRRTHKCCAYIA 235
Query: 173 SNSKYCVRLNSIQAFMDINRDVIGEANHLSGYNFSAQNNIIHPSAELGSKTTVGPHCMLG 232
SNSKYC RLNSIQAF DINRDVIGEANHLSGY+FSA NNIIHPSA+LGSKTTVGPHCMLG
Sbjct: 236 SNSKYCARLNSIQAFSDINRDVIGEANHLSGYSFSAHNNIIHPSAQLGSKTTVGPHCMLG 295
Query: 233 EGSQMGDKCSVKRSVIGRHCRIGSNVKVVNSVVMNHVTIGDGCSIQGSVICSNAQLQERV 292
EGSQMGDKCSVKRSVIGRHCRIGSNVKVVNSV+MNHVT+GDGCSIQGSVICSN QLQERV
Sbjct: 296 EGSQMGDKCSVKRSVIGRHCRIGSNVKVVNSVIMNHVTVGDGCSIQGSVICSNVQLQERV 355
Query: 293 ALKDCQVGQGYVVSAGCEYKGESLARKEK 321
LKDCQVG G+VV+AGCEYKGESLARKEK
Sbjct: 356 VLKDCQVGAGFVVTAGCEYKGESLARKEK 384
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224103999|ref|XP_002313277.1| predicted protein [Populus trichocarpa] gi|222849685|gb|EEE87232.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|296088193|emb|CBI35709.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359494464|ref|XP_002266884.2| PREDICTED: translation initiation factor eIF-2B subunit gamma [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296082668|emb|CBI21673.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359497208|ref|XP_002264945.2| PREDICTED: translation initiation factor eIF-2B subunit gamma-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356525249|ref|XP_003531239.1| PREDICTED: translation initiation factor eIF-2B subunit gamma-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449452670|ref|XP_004144082.1| PREDICTED: translation initiation factor eIF-2B subunit gamma-like [Cucumis sativus] gi|449493530|ref|XP_004159334.1| PREDICTED: translation initiation factor eIF-2B subunit gamma-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357518837|ref|XP_003629707.1| Translation initiation factor eIF-2B subunit gamma [Medicago truncatula] gi|355523729|gb|AET04183.1| Translation initiation factor eIF-2B subunit gamma [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356512489|ref|XP_003524951.1| PREDICTED: translation initiation factor eIF-2B subunit gamma-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 321 | ||||||
| TAIR|locus:1009023495 | 456 | AT5G19485 [Arabidopsis thalian | 0.978 | 0.688 | 0.674 | 2.2e-112 | |
| UNIPROTKB|Q4R6T3 | 452 | EIF2B3 "Translation initiation | 0.915 | 0.650 | 0.300 | 2.6e-31 | |
| UNIPROTKB|I3LN50 | 382 | EIF2B3 "Uncharacterized protei | 0.872 | 0.732 | 0.301 | 6.9e-31 | |
| DICTYBASE|DDB_G0290693 | 440 | eif2b3 "eukaryotic translation | 0.853 | 0.622 | 0.282 | 4.9e-30 | |
| UNIPROTKB|F1P4Z9 | 437 | EIF2B3 "Uncharacterized protei | 0.853 | 0.627 | 0.300 | 1e-29 | |
| RGD|620821 | 452 | Eif2b3 "eukaryotic translation | 0.915 | 0.650 | 0.287 | 1.3e-29 | |
| UNIPROTKB|P70541 | 452 | Eif2b3 "Translation initiation | 0.915 | 0.650 | 0.287 | 1.3e-29 | |
| UNIPROTKB|Q9NR50 | 452 | EIF2B3 "Translation initiation | 0.915 | 0.650 | 0.291 | 1.6e-29 | |
| UNIPROTKB|E2RBJ1 | 452 | EIF2B3 "Uncharacterized protei | 0.915 | 0.650 | 0.278 | 1.2e-28 | |
| UNIPROTKB|A5PJI7 | 452 | EIF2B3 "Translation initiation | 0.872 | 0.619 | 0.284 | 3.9e-28 |
| TAIR|locus:1009023495 AT5G19485 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1109 (395.4 bits), Expect = 2.2e-112, P = 2.2e-112
Identities = 220/326 (67%), Positives = 258/326 (79%)
Query: 1 MICSVPVSGLSEAGSSGAKDKTKKPGRYNIIGMDPTKQFLLHIATGAELEKDTRIRKSIL 60
M+C+ PVSG SE+G SG KDKTKKP +IIG+D KQFLL+IA G E++KDTR++KSIL
Sbjct: 136 MLCAQPVSGPSESGGSGGKDKTKKPACDDIIGLDSLKQFLLYIAKGTEIKKDTRVKKSIL 195
Query: 61 RAVGQMDIRADLMDAHMYAFNRSVLQEVLDQKDKFQSLKQDVLPYLVRSQLKSEILI--- 117
A G+M+IR+DLMD+H+YAF R+VLQEVLDQK F+SLKQDVLPYLVR+QL+S++
Sbjct: 196 CAAGKMEIRSDLMDSHIYAFKRAVLQEVLDQKPAFRSLKQDVLPYLVRTQLRSDVFSDQS 255
Query: 118 ----NGAPQGQQAKENGNDKVSYRILANASTPSFHELYALGPNGSAPVRRTHKCCVYIAS 173
NG G+ +N N+ V +IL+NAS PSFH++Y G R+THKCCVYIA
Sbjct: 256 NVEENGNGNGKNNMQN-NEVVLSQILSNASMPSFHQVYESGLG----TRKTHKCCVYIAD 310
Query: 174 NSKYCVRLNSIQAFMDINRDVIGEANHLSGYNFSAQNNIIHPSAELGSKTTVGPHCMLGE 233
SKY VRLNSIQAFMD+NRDVIGE+NHLSGY+FSA +NI+HPSAELGSKTTVGPHCMLGE
Sbjct: 311 ESKYFVRLNSIQAFMDVNRDVIGESNHLSGYSFSAHHNIVHPSAELGSKTTVGPHCMLGE 370
Query: 234 GSQMGDKCSVKRSVIGRHCRIGSXXXXXXXXXXXXXTIGDGCSIQGSVICSNAQLQERVA 293
GSQ+GDKCSVKRSVIGRHCRIGS TIGDGCSIQGSVICSNAQLQERV
Sbjct: 371 GSQVGDKCSVKRSVIGRHCRIGSNVKIVNSVVMDHATIGDGCSIQGSVICSNAQLQERVT 430
Query: 294 LKDCQVGQGYVVSAGCEYKGESLARK 319
L+DCQV GYVV AG E+KGE+ ARK
Sbjct: 431 LRDCQVEAGYVVCAGSEHKGETFARK 456
|
|
| UNIPROTKB|Q4R6T3 EIF2B3 "Translation initiation factor eIF-2B subunit gamma" [Macaca fascicularis (taxid:9541)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LN50 EIF2B3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0290693 eif2b3 "eukaryotic translation initiation factor 2B, subunit 3 gamma" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P4Z9 EIF2B3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|620821 Eif2b3 "eukaryotic translation initiation factor 2B, subunit 3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P70541 Eif2b3 "Translation initiation factor eIF-2B subunit gamma" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9NR50 EIF2B3 "Translation initiation factor eIF-2B subunit gamma" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RBJ1 EIF2B3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A5PJI7 EIF2B3 "Translation initiation factor eIF-2B subunit gamma" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 321 | |||
| cd04652 | 81 | cd04652, LbH_eIF2B_gamma_C, eIF-2B gamma subunit, | 2e-34 | |
| cd03356 | 79 | cd03356, LbH_G1P_AT_C_like, Left-handed parallel b | 2e-21 | |
| cd05787 | 79 | cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit | 3e-20 | |
| COG1208 | 358 | COG1208, GCD1, Nucleoside-diphosphate-sugar pyroph | 2e-15 | |
| cd04198 | 214 | cd04198, eIF-2B_gamma_N, The N-terminal domain of | 5e-15 | |
| COG1208 | 358 | COG1208, GCD1, Nucleoside-diphosphate-sugar pyroph | 3e-14 | |
| PRK00892 | 343 | PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] gluco | 1e-11 | |
| cd04651 | 104 | cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenyly | 1e-10 | |
| TIGR02091 | 361 | TIGR02091, glgC, glucose-1-phosphate adenylyltrans | 2e-10 | |
| cd02507 | 216 | cd02507, eIF-2B_gamma_N_like, The N-terminal of eI | 9e-10 | |
| cd03356 | 79 | cd03356, LbH_G1P_AT_C_like, Left-handed parallel b | 2e-09 | |
| TIGR01173 | 451 | TIGR01173, glmU, UDP-N-acetylglucosamine diphospho | 3e-09 | |
| cd03352 | 205 | cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyl | 3e-09 | |
| COG0448 | 393 | COG0448, GlgC, ADP-glucose pyrophosphorylase [Carb | 4e-09 | |
| TIGR03570 | 193 | TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sia | 4e-09 | |
| cd03360 | 197 | cd03360, LbH_AT_putative, Putative Acyltransferase | 5e-09 | |
| PRK05289 | 262 | PRK05289, PRK05289, UDP-N-acetylglucosamine acyltr | 2e-08 | |
| PRK05293 | 380 | PRK05293, glgC, glucose-1-phosphate adenylyltransf | 3e-08 | |
| COG1044 | 338 | COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | 4e-08 | |
| cd03351 | 254 | cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamin | 5e-08 | |
| PRK14360 | 450 | PRK14360, glmU, bifunctional N-acetylglucosamine-1 | 1e-06 | |
| PRK12461 | 255 | PRK12461, PRK12461, UDP-N-acetylglucosamine acyltr | 1e-06 | |
| TIGR01852 | 254 | TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protei | 1e-06 | |
| COG1208 | 358 | COG1208, GCD1, Nucleoside-diphosphate-sugar pyroph | 2e-06 | |
| COG1044 | 338 | COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | 2e-06 | |
| PRK14355 | 459 | PRK14355, glmU, bifunctional N-acetylglucosamine-1 | 2e-06 | |
| cd04651 | 104 | cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenyly | 3e-06 | |
| PRK14354 | 458 | PRK14354, glmU, bifunctional N-acetylglucosamine-1 | 3e-06 | |
| PRK00844 | 407 | PRK00844, glgC, glucose-1-phosphate adenylyltransf | 3e-06 | |
| TIGR01853 | 324 | TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristo | 3e-06 | |
| PRK02862 | 429 | PRK02862, glgC, glucose-1-phosphate adenylyltransf | 5e-06 | |
| COG1044 | 338 | COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | 8e-06 | |
| cd03353 | 193 | cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosph | 1e-05 | |
| cd03358 | 119 | cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed p | 1e-05 | |
| TIGR01853 | 324 | TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristo | 2e-05 | |
| COG1207 | 460 | COG1207, GlmU, N-acetylglucosamine-1-phosphate uri | 3e-05 | |
| PRK14354 | 458 | PRK14354, glmU, bifunctional N-acetylglucosamine-1 | 5e-05 | |
| cd05824 | 80 | cd05824, LbH_M1P_guanylylT_C, Mannose-1-phosphate | 5e-05 | |
| COG0110 | 190 | COG0110, WbbJ, Acetyltransferase (isoleucine patch | 8e-05 | |
| cd04651 | 104 | cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenyly | 9e-05 | |
| cd03358 | 119 | cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed p | 1e-04 | |
| COG1043 | 260 | COG1043, LpxA, Acyl-[acyl carrier protein] | 1e-04 | |
| cd05636 | 163 | cd05636, LbH_G1P_TT_C_like, Putative glucose-1-pho | 1e-04 | |
| TIGR03992 | 393 | TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diph | 1e-04 | |
| cd04645 | 153 | cd04645, LbH_gamma_CA_like, Gamma carbonic anhydra | 2e-04 | |
| cd04647 | 109 | cd04647, LbH_MAT_like, Maltose O-acyltransferase ( | 2e-04 | |
| cd05824 | 80 | cd05824, LbH_M1P_guanylylT_C, Mannose-1-phosphate | 3e-04 | |
| COG1044 | 338 | COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | 4e-04 | |
| PRK00725 | 425 | PRK00725, glgC, glucose-1-phosphate adenylyltransf | 4e-04 | |
| PRK14357 | 448 | PRK14357, glmU, bifunctional N-acetylglucosamine-1 | 5e-04 | |
| pfam00132 | 36 | pfam00132, Hexapep, Bacterial transferase hexapept | 7e-04 | |
| PRK14354 | 458 | PRK14354, glmU, bifunctional N-acetylglucosamine-1 | 0.003 | |
| PLN02241 | 436 | PLN02241, PLN02241, glucose-1-phosphate adenylyltr | 0.003 | |
| cd04745 | 155 | cd04745, LbH_paaY_like, paaY-like: This group is c | 0.003 | |
| COG0663 | 176 | COG0663, PaaY, Carbonic anhydrases/acetyltransfera | 0.003 | |
| PRK02862 | 429 | PRK02862, glgC, glucose-1-phosphate adenylyltransf | 0.004 |
| >gnl|CDD|100057 cd04652, LbH_eIF2B_gamma_C, eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
Score = 120 bits (303), Expect = 2e-34
Identities = 40/79 (50%), Positives = 59/79 (74%)
Query: 230 MLGEGSQMGDKCSVKRSVIGRHCRIGSNVKVVNSVVMNHVTIGDGCSIQGSVICSNAQLQ 289
++GE +Q+G+K S+KRSVIG +C+IG VK+ N V+M++VTI DGC+++ +I + A +
Sbjct: 1 LVGENTQVGEKTSIKRSVIGANCKIGKRVKITNCVIMDNVTIEDGCTLENCIIGNGAVIG 60
Query: 290 ERVALKDCQVGQGYVVSAG 308
E+ LKDC VG GY V AG
Sbjct: 61 EKCKLKDCLVGSGYRVEAG 79
|
eIF2B is important for regenerating GTP-bound eIF2 during the initiation process. This event is obligatory for eIF2 to bind initiator methionyl-tRNA, forming the ternary initiation complex. The eIF-2B gamma subunit contains an N-terminal domain that resembles a dinucleotide-binding Rossmann fold and a C-terminal LbH domain with 4 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). The epsilon and gamma subunits form the catalytic subcomplex of eIF-2B, which binds eIF2 and catalyzes guanine nucleotide exchange. Length = 81 |
| >gnl|CDD|100046 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma | Back alignment and domain information |
|---|
| >gnl|CDD|100061 cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >gnl|CDD|224129 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|133041 cd04198, eIF-2B_gamma_N, The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|224129 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|234858 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100056 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|233720 TIGR02091, glgC, glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|133001 cd02507, eIF-2B_gamma_N_like, The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity | Back alignment and domain information |
|---|
| >gnl|CDD|100046 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma | Back alignment and domain information |
|---|
| >gnl|CDD|233299 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc | Back alignment and domain information |
|---|
| >gnl|CDD|223525 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|234265 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family | Back alignment and domain information |
|---|
| >gnl|CDD|100050 cd03360, LbH_AT_putative, Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain | Back alignment and domain information |
|---|
| >gnl|CDD|235390 PRK05289, PRK05289, UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179997 PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >gnl|CDD|100042 cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc | Back alignment and domain information |
|---|
| >gnl|CDD|184646 PRK14360, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183539 PRK12461, PRK12461, UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188173 TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|224129 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >gnl|CDD|237685 PRK14355, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100056 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|184643 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234846 PRK00844, glgC, glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233599 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|179486 PRK02862, glgC, glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >gnl|CDD|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|100048 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|233599 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|224128 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|184643 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100062 cd05824, LbH_M1P_guanylylT_C, Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|223188 COG0110, WbbJ, Acetyltransferase (isoleucine patch superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|100056 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|100048 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|223973 COG1043, LpxA, Acyl-[acyl carrier protein] | Back alignment and domain information |
|---|
| >gnl|CDD|100060 cd05636, LbH_G1P_TT_C_like, Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains | Back alignment and domain information |
|---|
| >gnl|CDD|234433 TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|100051 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E | Back alignment and domain information |
|---|
| >gnl|CDD|100053 cd04647, LbH_MAT_like, Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|100062 cd05824, LbH_M1P_guanylylT_C, Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >gnl|CDD|234824 PRK00725, glgC, glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237687 PRK14357, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|189409 pfam00132, Hexapep, Bacterial transferase hexapeptide (six repeats) | Back alignment and domain information |
|---|
| >gnl|CDD|184643 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215133 PLN02241, PLN02241, glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|100058 cd04745, LbH_paaY_like, paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E | Back alignment and domain information |
|---|
| >gnl|CDD|223735 COG0663, PaaY, Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|179486 PRK02862, glgC, glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 321 | |||
| KOG1462 | 433 | consensus Translation initiation factor 2B, gamma | 100.0 | |
| COG0448 | 393 | GlgC ADP-glucose pyrophosphorylase [Carbohydrate t | 100.0 | |
| KOG1461 | 673 | consensus Translation initiation factor 2B, epsilo | 99.98 | |
| KOG1322 | 371 | consensus GDP-mannose pyrophosphorylase/mannose-1- | 99.95 | |
| PRK02862 | 429 | glgC glucose-1-phosphate adenylyltransferase; Prov | 99.95 | |
| PRK05293 | 380 | glgC glucose-1-phosphate adenylyltransferase; Prov | 99.94 | |
| PLN02241 | 436 | glucose-1-phosphate adenylyltransferase | 99.93 | |
| PRK00844 | 407 | glgC glucose-1-phosphate adenylyltransferase; Prov | 99.93 | |
| PRK00725 | 425 | glgC glucose-1-phosphate adenylyltransferase; Prov | 99.92 | |
| COG1208 | 358 | GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas | 99.92 | |
| TIGR02091 | 361 | glgC glucose-1-phosphate adenylyltransferase. This | 99.91 | |
| TIGR02092 | 369 | glgD glucose-1-phosphate adenylyltransferase, GlgD | 99.89 | |
| TIGR01208 | 353 | rmlA_long glucose-1-phosphate thymidylylransferase | 99.87 | |
| KOG1460 | 407 | consensus GDP-mannose pyrophosphorylase [Carbohydr | 99.87 | |
| PRK14355 | 459 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.86 | |
| PRK14356 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.84 | |
| PRK14359 | 430 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.84 | |
| PRK14352 | 482 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.84 | |
| PRK09451 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.84 | |
| PRK14353 | 446 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.84 | |
| TIGR01173 | 451 | glmU UDP-N-acetylglucosamine diphosphorylase/gluco | 99.83 | |
| PRK14358 | 481 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.79 | |
| COG1207 | 460 | GlmU N-acetylglucosamine-1-phosphate uridyltransfe | 99.75 | |
| PRK14354 | 458 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.74 | |
| TIGR03532 | 231 | DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla | 99.73 | |
| PRK14357 | 448 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.72 | |
| cd05636 | 163 | LbH_G1P_TT_C_like Putative glucose-1-phosphate thy | 99.68 | |
| PRK14360 | 450 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.65 | |
| cd05636 | 163 | LbH_G1P_TT_C_like Putative glucose-1-phosphate thy | 99.65 | |
| TIGR02287 | 192 | PaaY phenylacetic acid degradation protein PaaY. M | 99.64 | |
| cd04745 | 155 | LbH_paaY_like paaY-like: This group is composed by | 99.63 | |
| cd04652 | 81 | LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal | 99.63 | |
| PRK13627 | 196 | carnitine operon protein CaiE; Provisional | 99.61 | |
| COG0663 | 176 | PaaY Carbonic anhydrases/acetyltransferases, isole | 99.58 | |
| cd04646 | 164 | LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact | 99.58 | |
| cd03351 | 254 | LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr | 99.58 | |
| cd03351 | 254 | LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr | 99.57 | |
| PLN02296 | 269 | carbonate dehydratase | 99.57 | |
| TIGR01853 | 324 | lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam | 99.56 | |
| TIGR01852 | 254 | lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac | 99.56 | |
| COG1044 | 338 | LpxD UDP-3-O-[3-hydroxymyristoyl] | 99.56 | |
| cd03353 | 193 | LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl | 99.56 | |
| cd03356 | 79 | LbH_G1P_AT_C_like Left-handed parallel beta-Helix | 99.55 | |
| PLN02472 | 246 | uncharacterized protein | 99.54 | |
| COG1044 | 338 | LpxD UDP-3-O-[3-hydroxymyristoyl] | 99.54 | |
| cd04645 | 153 | LbH_gamma_CA_like Gamma carbonic anhydrase-like: T | 99.54 | |
| TIGR01852 | 254 | lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac | 99.54 | |
| cd04650 | 154 | LbH_FBP Ferripyochelin Binding Protein (FBP): FBP | 99.54 | |
| PRK00892 | 343 | lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac | 99.53 | |
| cd04652 | 81 | LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal | 99.52 | |
| cd00710 | 167 | LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo | 99.52 | |
| cd04651 | 104 | LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera | 99.52 | |
| PRK05289 | 262 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.52 | |
| TIGR03308 | 204 | phn_thr-fam phosphonate metabolim protein, transfe | 99.5 | |
| TIGR01853 | 324 | lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam | 99.5 | |
| cd00710 | 167 | LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo | 99.5 | |
| cd05824 | 80 | LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr | 99.5 | |
| cd05787 | 79 | LbH_eIF2B_epsilon eIF-2B epsilon subunit, central | 99.5 | |
| PRK14353 | 446 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.49 | |
| PRK05289 | 262 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.48 | |
| PRK00892 | 343 | lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac | 99.47 | |
| cd03356 | 79 | LbH_G1P_AT_C_like Left-handed parallel beta-Helix | 99.47 | |
| PRK12461 | 255 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.46 | |
| TIGR03570 | 201 | NeuD_NnaD sugar O-acyltransferase, sialic acid O-a | 99.45 | |
| cd03353 | 193 | LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl | 99.44 | |
| cd05824 | 80 | LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr | 99.44 | |
| cd04651 | 104 | LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera | 99.44 | |
| cd03350 | 139 | LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d | 99.43 | |
| cd04745 | 155 | LbH_paaY_like paaY-like: This group is composed by | 99.43 | |
| cd04646 | 164 | LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact | 99.43 | |
| PRK12461 | 255 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.43 | |
| cd03360 | 197 | LbH_AT_putative Putative Acyltransferase (AT), Lef | 99.43 | |
| cd03358 | 119 | LbH_WxcM_N_like WcxM-like, Left-handed parallel be | 99.42 | |
| PRK14360 | 450 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.42 | |
| KOG1461 | 673 | consensus Translation initiation factor 2B, epsilo | 99.42 | |
| TIGR02287 | 192 | PaaY phenylacetic acid degradation protein PaaY. M | 99.42 | |
| TIGR01173 | 451 | glmU UDP-N-acetylglucosamine diphosphorylase/gluco | 99.4 | |
| cd03350 | 139 | LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d | 99.39 | |
| TIGR00965 | 269 | dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate | 99.39 | |
| cd03352 | 205 | LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas | 99.39 | |
| TIGR00965 | 269 | dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate | 99.38 | |
| cd04650 | 154 | LbH_FBP Ferripyochelin Binding Protein (FBP): FBP | 99.38 | |
| PLN02296 | 269 | carbonate dehydratase | 99.38 | |
| cd04649 | 147 | LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah | 99.37 | |
| cd05787 | 79 | LbH_eIF2B_epsilon eIF-2B epsilon subunit, central | 99.37 | |
| cd03359 | 161 | LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact | 99.37 | |
| PLN02472 | 246 | uncharacterized protein | 99.37 | |
| PRK09451 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.36 | |
| PRK11830 | 272 | dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- | 99.36 | |
| COG1043 | 260 | LpxA Acyl-[acyl carrier protein] | 99.36 | |
| cd05635 | 101 | LbH_unknown Uncharacterized proteins, Left-handed | 99.35 | |
| PRK11830 | 272 | dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- | 99.34 | |
| PRK14356 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.33 | |
| PRK14358 | 481 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.33 | |
| cd03359 | 161 | LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact | 99.33 | |
| PRK14355 | 459 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.33 | |
| PRK14357 | 448 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.33 | |
| PRK14359 | 430 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.32 | |
| cd04645 | 153 | LbH_gamma_CA_like Gamma carbonic anhydrase-like: T | 99.31 | |
| PRK13627 | 196 | carnitine operon protein CaiE; Provisional | 99.31 | |
| KOG1462 | 433 | consensus Translation initiation factor 2B, gamma | 99.31 | |
| cd03352 | 205 | LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas | 99.3 | |
| TIGR03570 | 201 | NeuD_NnaD sugar O-acyltransferase, sialic acid O-a | 99.3 | |
| COG1207 | 460 | GlmU N-acetylglucosamine-1-phosphate uridyltransfe | 99.29 | |
| cd03360 | 197 | LbH_AT_putative Putative Acyltransferase (AT), Lef | 99.29 | |
| cd04649 | 147 | LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah | 99.28 | |
| PRK14352 | 482 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.28 | |
| COG0663 | 176 | PaaY Carbonic anhydrases/acetyltransferases, isole | 99.27 | |
| TIGR03532 | 231 | DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla | 99.26 | |
| cd05635 | 101 | LbH_unknown Uncharacterized proteins, Left-handed | 99.25 | |
| TIGR03308 | 204 | phn_thr-fam phosphonate metabolim protein, transfe | 99.25 | |
| PRK14354 | 458 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.25 | |
| COG1208 | 358 | GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas | 99.24 | |
| TIGR02092 | 369 | glgD glucose-1-phosphate adenylyltransferase, GlgD | 99.23 | |
| PRK05293 | 380 | glgC glucose-1-phosphate adenylyltransferase; Prov | 99.22 | |
| TIGR02091 | 361 | glgC glucose-1-phosphate adenylyltransferase. This | 99.2 | |
| TIGR03536 | 341 | DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl | 99.18 | |
| cd03358 | 119 | LbH_WxcM_N_like WcxM-like, Left-handed parallel be | 99.15 | |
| COG1043 | 260 | LpxA Acyl-[acyl carrier protein] | 99.14 | |
| TIGR03536 | 341 | DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl | 99.13 | |
| PRK10191 | 146 | putative acyl transferase; Provisional | 99.12 | |
| TIGR01172 | 162 | cysE serine O-acetyltransferase. Cysteine biosynth | 99.12 | |
| PRK10092 | 183 | maltose O-acetyltransferase; Provisional | 99.12 | |
| COG2171 | 271 | DapD Tetrahydrodipicolinate N-succinyltransferase | 99.1 | |
| PRK00725 | 425 | glgC glucose-1-phosphate adenylyltransferase; Prov | 99.1 | |
| COG0448 | 393 | GlgC ADP-glucose pyrophosphorylase [Carbohydrate t | 99.08 | |
| PRK00844 | 407 | glgC glucose-1-phosphate adenylyltransferase; Prov | 99.07 | |
| TIGR01208 | 353 | rmlA_long glucose-1-phosphate thymidylylransferase | 99.07 | |
| PLN02694 | 294 | serine O-acetyltransferase | 99.07 | |
| PRK10502 | 182 | putative acyl transferase; Provisional | 99.07 | |
| TIGR03535 | 319 | DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo | 99.06 | |
| PLN02241 | 436 | glucose-1-phosphate adenylyltransferase | 99.04 | |
| PRK11132 | 273 | cysE serine acetyltransferase; Provisional | 99.04 | |
| TIGR03535 | 319 | DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo | 99.03 | |
| PRK02862 | 429 | glgC glucose-1-phosphate adenylyltransferase; Prov | 99.02 | |
| cd03357 | 169 | LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and | 99.01 | |
| PLN02357 | 360 | serine acetyltransferase | 99.0 | |
| PRK09527 | 203 | lacA galactoside O-acetyltransferase; Reviewed | 99.0 | |
| PLN02694 | 294 | serine O-acetyltransferase | 98.99 | |
| PRK11132 | 273 | cysE serine acetyltransferase; Provisional | 98.99 | |
| PRK10502 | 182 | putative acyl transferase; Provisional | 98.99 | |
| PRK09677 | 192 | putative lipopolysaccharide biosynthesis O-acetyl | 98.97 | |
| cd03354 | 101 | LbH_SAT Serine acetyltransferase (SAT): SAT cataly | 98.97 | |
| cd03354 | 101 | LbH_SAT Serine acetyltransferase (SAT): SAT cataly | 98.96 | |
| PRK09677 | 192 | putative lipopolysaccharide biosynthesis O-acetyl | 98.96 | |
| cd00208 | 78 | LbetaH Left-handed parallel beta-Helix (LbetaH or | 98.96 | |
| KOG1460 | 407 | consensus GDP-mannose pyrophosphorylase [Carbohydr | 98.95 | |
| cd00208 | 78 | LbetaH Left-handed parallel beta-Helix (LbetaH or | 98.95 | |
| COG2171 | 271 | DapD Tetrahydrodipicolinate N-succinyltransferase | 98.94 | |
| KOG1322 | 371 | consensus GDP-mannose pyrophosphorylase/mannose-1- | 98.93 | |
| cd04647 | 109 | LbH_MAT_like Maltose O-acyltransferase (MAT)-like: | 98.92 | |
| KOG3121 | 184 | consensus Dynactin, subunit p25 [Cytoskeleton] | 98.9 | |
| PLN02739 | 355 | serine acetyltransferase | 98.89 | |
| PRK09527 | 203 | lacA galactoside O-acetyltransferase; Reviewed | 98.88 | |
| cd04198 | 214 | eIF-2B_gamma_N The N-terminal domain of gamma subu | 98.88 | |
| TIGR01172 | 162 | cysE serine O-acetyltransferase. Cysteine biosynth | 98.88 | |
| cd04647 | 109 | LbH_MAT_like Maltose O-acyltransferase (MAT)-like: | 98.87 | |
| cd05825 | 107 | LbH_wcaF_like wcaF-like: This group is composed of | 98.84 | |
| PRK10191 | 146 | putative acyl transferase; Provisional | 98.81 | |
| cd06428 | 257 | M1P_guanylylT_A_like_N N-terminal domain of M1P_gu | 98.8 | |
| PLN02357 | 360 | serine acetyltransferase | 98.79 | |
| PRK10092 | 183 | maltose O-acetyltransferase; Provisional | 98.78 | |
| cd03357 | 169 | LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and | 98.76 | |
| PLN02739 | 355 | serine acetyltransferase | 98.76 | |
| COG1045 | 194 | CysE Serine acetyltransferase [Amino acid transpor | 98.75 | |
| cd05825 | 107 | LbH_wcaF_like wcaF-like: This group is composed of | 98.68 | |
| cd06425 | 233 | M1P_guanylylT_B_like_N N-terminal domain of the M1 | 98.68 | |
| PF00483 | 248 | NTP_transferase: Nucleotidyl transferase This Pros | 98.57 | |
| TIGR02623 | 254 | G1P_cyt_trans glucose-1-phosphate cytidylyltransfe | 98.57 | |
| COG1045 | 194 | CysE Serine acetyltransferase [Amino acid transpor | 98.52 | |
| KOG3121 | 184 | consensus Dynactin, subunit p25 [Cytoskeleton] | 98.47 | |
| cd03349 | 145 | LbH_XAT Xenobiotic acyltransferase (XAT): The XAT | 98.44 | |
| PRK10122 | 297 | GalU regulator GalF; Provisional | 98.39 | |
| TIGR01105 | 297 | galF UTP-glucose-1-phosphate uridylyltransferase, | 98.37 | |
| COG1209 | 286 | RfbA dTDP-glucose pyrophosphorylase [Cell envelope | 98.34 | |
| cd03349 | 145 | LbH_XAT Xenobiotic acyltransferase (XAT): The XAT | 98.33 | |
| cd02507 | 216 | eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma | 98.3 | |
| TIGR02353 | 695 | NRPS_term_dom non-ribosomal peptide synthetase ter | 98.28 | |
| PRK13389 | 302 | UTP--glucose-1-phosphate uridylyltransferase subun | 98.24 | |
| KOG4750 | 269 | consensus Serine O-acetyltransferase [Amino acid t | 98.22 | |
| cd02541 | 267 | UGPase_prokaryotic Prokaryotic UGPase catalyses th | 98.22 | |
| TIGR02353 | 695 | NRPS_term_dom non-ribosomal peptide synthetase ter | 98.2 | |
| cd02538 | 240 | G1P_TT_short G1P_TT_short is the short form of glu | 98.2 | |
| TIGR01099 | 260 | galU UTP-glucose-1-phosphate uridylyltransferase. | 98.2 | |
| KOG4042 | 190 | consensus Dynactin subunit p27/WS-3, involved in t | 98.17 | |
| cd02524 | 253 | G1P_cytidylyltransferase G1P_cytidylyltransferase | 98.11 | |
| COG0110 | 190 | WbbJ Acetyltransferase (isoleucine patch superfami | 98.05 | |
| cd06422 | 221 | NTP_transferase_like_1 NTP_transferase_like_1 is a | 98.03 | |
| TIGR01207 | 286 | rmlA glucose-1-phosphate thymidylyltransferase, sh | 98.01 | |
| PRK15480 | 292 | glucose-1-phosphate thymidylyltransferase RfbA; Pr | 97.94 | |
| KOG4042 | 190 | consensus Dynactin subunit p27/WS-3, involved in t | 97.94 | |
| COG4801 | 277 | Predicted acyltransferase [General function predic | 97.93 | |
| cd04189 | 236 | G1P_TT_long G1P_TT_long represents the long form o | 97.83 | |
| cd04197 | 217 | eIF-2B_epsilon_N The N-terminal domain of epsilon | 97.78 | |
| COG0110 | 190 | WbbJ Acetyltransferase (isoleucine patch superfami | 97.7 | |
| COG4801 | 277 | Predicted acyltransferase [General function predic | 97.56 | |
| cd04181 | 217 | NTP_transferase NTP_transferases catalyze the tran | 97.51 | |
| cd06426 | 220 | NTP_transferase_like_2 NTP_trnasferase_like_2 is a | 97.44 | |
| cd06915 | 223 | NTP_transferase_WcbM_like WcbM_like is a subfamily | 97.43 | |
| cd02508 | 200 | ADP_Glucose_PP ADP-glucose pyrophosphorylase is in | 97.4 | |
| PF14602 | 34 | Hexapep_2: Hexapeptide repeat of succinyl-transfer | 97.38 | |
| PF14602 | 34 | Hexapep_2: Hexapeptide repeat of succinyl-transfer | 97.11 | |
| KOG4750 | 269 | consensus Serine O-acetyltransferase [Amino acid t | 97.1 | |
| PRK05450 | 245 | 3-deoxy-manno-octulosonate cytidylyltransferase; P | 97.01 | |
| cd02517 | 239 | CMP-KDO-Synthetase CMP-KDO synthetase catalyzes th | 96.72 | |
| cd04183 | 231 | GT2_BcE_like GT2_BcbE_like is likely involved in t | 96.67 | |
| cd02523 | 229 | PC_cytidylyltransferase Phosphocholine cytidylyltr | 96.66 | |
| PRK13368 | 238 | 3-deoxy-manno-octulosonate cytidylyltransferase; P | 96.61 | |
| PF07959 | 414 | Fucokinase: L-fucokinase; InterPro: IPR012887 In t | 96.36 | |
| PF07959 | 414 | Fucokinase: L-fucokinase; InterPro: IPR012887 In t | 96.12 | |
| PRK13412 | 974 | fkp bifunctional fucokinase/L-fucose-1-P-guanylylt | 95.4 | |
| COG1664 | 146 | CcmA Integral membrane protein CcmA involved in ce | 91.86 | |
| PF04519 | 101 | Bactofilin: Polymer-forming cytoskeletal; InterPro | 89.62 | |
| PRK13412 | 974 | fkp bifunctional fucokinase/L-fucose-1-P-guanylylt | 89.35 | |
| cd02540 | 229 | GT2_GlmU_N_bac N-terminal domain of bacterial GlmU | 87.74 | |
| TIGR01479 | 468 | GMP_PMI mannose-1-phosphate guanylyltransferase/ma | 87.18 | |
| COG1210 | 291 | GalU UDP-glucose pyrophosphorylase [Cell envelope | 84.55 |
| >KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.9e-42 Score=311.31 Aligned_cols=273 Identities=35% Similarity=0.607 Sum_probs=219.8
Q ss_pred ccccCCCCcccCCCCCcccEEEecCCccEEEeeccccccccceeecHHHHhhcCeeeecCCCccceEEeEeHHHHHHHHh
Q 020813 11 SEAGSSGAKDKTKKPGRYNIIGMDPTKQFLLHIATGAELEKDTRIRKSILRAVGQMDIRADLMDAHMYAFNRSVLQEVLD 90 (321)
Q Consensus 11 ~~~~~~~~~~~~~~~~~~~l~~lD~~~~~~~h~~~~a~~t~~l~i~~~~~~~~~~~~~~s~l~d~giYi~~~~vl~~~l~ 90 (321)
.+++.||+|.|.+ +.+ ++++++.++.++++....+|.++.+.+++++||.||++++.++|.|+|||+|++|+++ ++.
T Consensus 151 s~~~~pgqk~k~k-~~~-d~igi~e~t~rl~y~~~~~d~~~~l~i~~slL~~~prltl~t~L~dahiY~~k~~v~d-~l~ 227 (433)
T KOG1462|consen 151 SEVPIPGQKGKKK-QAR-DVIGINEDTERLAYSSDSADEEEPLVIRKSLLWNHPRLTLTTKLVDAHIYVFKHWVID-LLS 227 (433)
T ss_pred ccccccCcccccc-ccc-ceeeeccccceeEEeecCCcCCCceehhhhhhhcCCceEEeccccceeeeeeHHHHHH-HHh
Confidence 3689999999884 667 7999999999999999989999999999999999999999999999999999999995 778
Q ss_pred ccccCCCCccchhHHHHHhhccccccc--CCCCCCccccccCCCcchhhhhhcCCCCCccccccCCCCCCCCCCCcceeE
Q 020813 91 QKDKFQSLKQDVLPYLVRSQLKSEILI--NGAPQGQQAKENGNDKVSYRILANASTPSFHELYALGPNGSAPVRRTHKCC 168 (321)
Q Consensus 91 ~~~~~~si~~dlip~l~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~ 168 (321)
++....||+.||+|+|+++|++...-. |+.. ++. .+..+ .+.+.-...++.+|+
T Consensus 228 ~~~sisSfk~~f~P~lvkkQ~q~~~~~~~~~~~----------------~l~---t~~~~-----~~d~~~~~~d~ik~y 283 (433)
T KOG1462|consen 228 EKESISSFKADFLPYLVKKQFQKNPPLKKNETS----------------ILP---TPNLN-----NPDGIHSPDDRIKCY 283 (433)
T ss_pred cCCcceeecccccchhhhhhhhcCCCccccccc----------------ccC---Ccccc-----CcccccCcccceeee
Confidence 788899999999999999998643211 1100 000 01100 000100001247899
Q ss_pred EEEecCccceeeccCHHHHHHHchh--hccccccCCCcccccCCeeeCCCCeeCCCcEECCCCEECCCCEECCCCeEece
Q 020813 169 VYIASNSKYCVRLNSIQAFMDINRD--VIGEANHLSGYNFSAQNNIIHPSAELGSKTTVGPHCMLGEGSQMGDKCSVKRS 246 (321)
Q Consensus 169 ~~i~~~~~~w~~i~t~~~y~~~~~~--~l~~~~~~~~~~~~~~~~~i~p~a~i~~~~~i~~~~~Ig~~~~I~~~~~I~~s 246 (321)
+|+.+.+..+.|++|+-.|+++|++ +..-. ++.. .+...+.. .+.++..++|+++|.|++++.|++|
T Consensus 284 ~~~~p~e~~~~raNtL~~y~eiN~~k~~~~l~----~e~~-----~~k~~~~~--~~l~g~d~iv~~~t~i~~~s~ik~S 352 (433)
T KOG1462|consen 284 AYILPTESLFVRANTLLSYMEINRDKKLKKLC----SEAK-----FVKNYVKK--VALVGADSIVGDNTQIGENSNIKRS 352 (433)
T ss_pred EEEccCccceEEecchHHHHhhhHHHHHHHhc----cccc-----cccchhhh--eeccchhhccCCCceecccceeeee
Confidence 9999999999999999999999962 22111 1111 11111111 1556778999999999999999999
Q ss_pred EECCCCEECCCcEEeceEECCCCEECCCcEEeceEECCCCEECcCcEecCeEECCCcEEcCCcEEcCCeEeeecC
Q 020813 247 VIGRHCRIGSNVKVVNSVVMNHVTIGDGCSIQGSVICSNAQLQERVALKDCQVGQGYVVSAGCEYKGESLARKEK 321 (321)
Q Consensus 247 vIg~~~~Ig~~~~I~~siI~~~v~Ig~~~~I~~~iI~~~~~Ig~~~~i~~~iIg~~~~V~~~~~i~~~~~~~~~k 321 (321)
+||.||.||++++|.+|+||+||+||+|+.|++||||++++||+|+.+.+|+||.+.+|++..+..+|++.+.|+
T Consensus 353 viG~nC~Ig~~~~v~nSilm~nV~vg~G~~IensIIg~gA~Ig~gs~L~nC~Ig~~yvVeak~~~~~ev~~~~~d 427 (433)
T KOG1462|consen 353 VIGSNCDIGERVKVANSILMDNVVVGDGVNIENSIIGMGAQIGSGSKLKNCIIGPGYVVEAKGKHGGEVLVSNED 427 (433)
T ss_pred eecCCccccCCcEEEeeEeecCcEecCCcceecceecccceecCCCeeeeeEecCCcEEcccccccccEeeccch
Confidence 999999999999999999999999999999999999999999999999999999999999999999999988764
|
|
| >COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02241 glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR02091 glgC glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit | Back alignment and domain information |
|---|
| >TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form | Back alignment and domain information |
|---|
| >KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains | Back alignment and domain information |
|---|
| >PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains | Back alignment and domain information |
|---|
| >TIGR02287 PaaY phenylacetic acid degradation protein PaaY | Back alignment and domain information |
|---|
| >cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E | Back alignment and domain information |
|---|
| >cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >PRK13627 carnitine operon protein CaiE; Provisional | Back alignment and domain information |
|---|
| >COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc | Back alignment and domain information |
|---|
| >cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc | Back alignment and domain information |
|---|
| >PLN02296 carbonate dehydratase | Back alignment and domain information |
|---|
| >TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Back alignment and domain information |
|---|
| >TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase | Back alignment and domain information |
|---|
| >COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase | Back alignment and domain information |
|---|
| >cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma | Back alignment and domain information |
|---|
| >PLN02472 uncharacterized protein | Back alignment and domain information |
|---|
| >COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E | Back alignment and domain information |
|---|
| >TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase | Back alignment and domain information |
|---|
| >cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition | Back alignment and domain information |
|---|
| >PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site | Back alignment and domain information |
|---|
| >cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase | Back alignment and domain information |
|---|
| >PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family | Back alignment and domain information |
|---|
| >TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Back alignment and domain information |
|---|
| >cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site | Back alignment and domain information |
|---|
| >cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase | Back alignment and domain information |
|---|
| >cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma | Back alignment and domain information |
|---|
| >PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family | Back alignment and domain information |
|---|
| >cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase | Back alignment and domain information |
|---|
| >cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase | Back alignment and domain information |
|---|
| >cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase | Back alignment and domain information |
|---|
| >cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA | Back alignment and domain information |
|---|
| >cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E | Back alignment and domain information |
|---|
| >cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain | Back alignment and domain information |
|---|
| >cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain | Back alignment and domain information |
|---|
| >PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR02287 PaaY phenylacetic acid degradation protein PaaY | Back alignment and domain information |
|---|
| >TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA | Back alignment and domain information |
|---|
| >TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc | Back alignment and domain information |
|---|
| >TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition | Back alignment and domain information |
|---|
| >PLN02296 carbonate dehydratase | Back alignment and domain information |
|---|
| >cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH | Back alignment and domain information |
|---|
| >cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >PLN02472 uncharacterized protein | Back alignment and domain information |
|---|
| >PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1043 LpxA Acyl-[acyl carrier protein] | Back alignment and domain information |
|---|
| >cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E | Back alignment and domain information |
|---|
| >PRK13627 carnitine operon protein CaiE; Provisional | Back alignment and domain information |
|---|
| >KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc | Back alignment and domain information |
|---|
| >TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family | Back alignment and domain information |
|---|
| >COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain | Back alignment and domain information |
|---|
| >cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH | Back alignment and domain information |
|---|
| >PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase | Back alignment and domain information |
|---|
| >cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family | Back alignment and domain information |
|---|
| >PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit | Back alignment and domain information |
|---|
| >PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02091 glgC glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain | Back alignment and domain information |
|---|
| >COG1043 LpxA Acyl-[acyl carrier protein] | Back alignment and domain information |
|---|
| >TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >PRK10191 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01172 cysE serine O-acetyltransferase | Back alignment and domain information |
|---|
| >PRK10092 maltose O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form | Back alignment and domain information |
|---|
| >PLN02694 serine O-acetyltransferase | Back alignment and domain information |
|---|
| >PRK10502 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >PLN02241 glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >PRK11132 cysE serine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates | Back alignment and domain information |
|---|
| >PLN02357 serine acetyltransferase | Back alignment and domain information |
|---|
| >PRK09527 lacA galactoside O-acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PLN02694 serine O-acetyltransferase | Back alignment and domain information |
|---|
| >PRK11132 cysE serine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10502 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional | Back alignment and domain information |
|---|
| >cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine | Back alignment and domain information |
|---|
| >cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine | Back alignment and domain information |
|---|
| >PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional | Back alignment and domain information |
|---|
| >cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins | Back alignment and domain information |
|---|
| >KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN02739 serine acetyltransferase | Back alignment and domain information |
|---|
| >PRK09527 lacA galactoside O-acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >cd04198 eIF-2B_gamma_N The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2 | Back alignment and domain information |
|---|
| >TIGR01172 cysE serine O-acetyltransferase | Back alignment and domain information |
|---|
| >cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins | Back alignment and domain information |
|---|
| >cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E | Back alignment and domain information |
|---|
| >PRK10191 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >cd06428 M1P_guanylylT_A_like_N N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase | Back alignment and domain information |
|---|
| >PLN02357 serine acetyltransferase | Back alignment and domain information |
|---|
| >PRK10092 maltose O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates | Back alignment and domain information |
|---|
| >PLN02739 serine acetyltransferase | Back alignment and domain information |
|---|
| >COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E | Back alignment and domain information |
|---|
| >cd06425 M1P_guanylylT_B_like_N N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins | Back alignment and domain information |
|---|
| >PF00483 NTP_transferase: Nucleotidyl transferase This Prosite entry is only a sub-family of the Pfam entry | Back alignment and domain information |
|---|
| >TIGR02623 G1P_cyt_trans glucose-1-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others | Back alignment and domain information |
|---|
| >PRK10122 GalU regulator GalF; Provisional | Back alignment and domain information |
|---|
| >TIGR01105 galF UTP-glucose-1-phosphate uridylyltransferase, non-catalytic GalF subunit | Back alignment and domain information |
|---|
| >COG1209 RfbA dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others | Back alignment and domain information |
|---|
| >cd02507 eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity | Back alignment and domain information |
|---|
| >TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function | Back alignment and domain information |
|---|
| >PRK13389 UTP--glucose-1-phosphate uridylyltransferase subunit GalU; Provisional | Back alignment and domain information |
|---|
| >KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd02541 UGPase_prokaryotic Prokaryotic UGPase catalyses the synthesis of UDP-glucose | Back alignment and domain information |
|---|
| >TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function | Back alignment and domain information |
|---|
| >cd02538 G1P_TT_short G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase | Back alignment and domain information |
|---|
| >TIGR01099 galU UTP-glucose-1-phosphate uridylyltransferase | Back alignment and domain information |
|---|
| >KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] | Back alignment and domain information |
|---|
| >cd02524 G1P_cytidylyltransferase G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose | Back alignment and domain information |
|---|
| >COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >cd06422 NTP_transferase_like_1 NTP_transferase_like_1 is a member of the nucleotidyl transferase family | Back alignment and domain information |
|---|
| >TIGR01207 rmlA glucose-1-phosphate thymidylyltransferase, short form | Back alignment and domain information |
|---|
| >PRK15480 glucose-1-phosphate thymidylyltransferase RfbA; Provisional | Back alignment and domain information |
|---|
| >KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4801 Predicted acyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >cd04189 G1P_TT_long G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase | Back alignment and domain information |
|---|
| >cd04197 eIF-2B_epsilon_N The N-terminal domain of epsilon subunit of the eIF-2B is a subfamily of glycosyltransferase 2 | Back alignment and domain information |
|---|
| >COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG4801 Predicted acyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >cd04181 NTP_transferase NTP_transferases catalyze the transfer of nucleotides onto phosphosugars | Back alignment and domain information |
|---|
| >cd06426 NTP_transferase_like_2 NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family | Back alignment and domain information |
|---|
| >cd06915 NTP_transferase_WcbM_like WcbM_like is a subfamily of nucleotidyl transferases | Back alignment and domain information |
|---|
| >cd02508 ADP_Glucose_PP ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch | Back alignment and domain information |
|---|
| >PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A | Back alignment and domain information |
|---|
| >PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A | Back alignment and domain information |
|---|
| >KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05450 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd02517 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes the activation of KDO which is an essential component of the lipopolysaccharide | Back alignment and domain information |
|---|
| >cd04183 GT2_BcE_like GT2_BcbE_like is likely involved in the biosynthesis of the polysaccharide capsule | Back alignment and domain information |
|---|
| >cd02523 PC_cytidylyltransferase Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline | Back alignment and domain information |
|---|
| >PRK13368 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase [] | Back alignment and domain information |
|---|
| >PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase [] | Back alignment and domain information |
|---|
| >PRK13412 fkp bifunctional fucokinase/L-fucose-1-P-guanylyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1664 CcmA Integral membrane protein CcmA involved in cell shape determination [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF04519 Bactofilin: Polymer-forming cytoskeletal; InterPro: IPR007607 This family contains several uncharacterised hypothetical proteins | Back alignment and domain information |
|---|
| >PRK13412 fkp bifunctional fucokinase/L-fucose-1-P-guanylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd02540 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU | Back alignment and domain information |
|---|
| >TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase | Back alignment and domain information |
|---|
| >COG1210 GalU UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 321 | |||
| 3eh0_A | 341 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr | 3e-12 | |
| 3pmo_A | 372 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; | 4e-12 | |
| 2iu8_A | 374 | LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 5e-12 | |
| 3brk_X | 420 | Glucose-1-phosphate adenylyltransferase; ADP-gluco | 4e-11 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 2e-10 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 2e-10 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 1e-08 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 3e-05 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 9e-04 | |
| 3mqg_A | 192 | Lipopolysaccharides biosynthesis acetyltransferas; | 7e-10 | |
| 3mqg_A | 192 | Lipopolysaccharides biosynthesis acetyltransferas; | 4e-04 | |
| 3bfp_A | 194 | Acetyltransferase; LEFT-handed beta helix, COA bin | 8e-10 | |
| 3bfp_A | 194 | Acetyltransferase; LEFT-handed beta helix, COA bin | 3e-04 | |
| 4ea9_A | 220 | Perosamine N-acetyltransferase; beta helix, acetyl | 7e-09 | |
| 4ea9_A | 220 | Perosamine N-acetyltransferase; beta helix, acetyl | 3e-07 | |
| 3hsq_A | 259 | Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam | 2e-08 | |
| 1j2z_A | 270 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 4e-08 | |
| 3r0s_A | 266 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 5e-08 | |
| 3r8y_A | 240 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac | 5e-08 | |
| 4eqy_A | 283 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 5e-08 | |
| 2qia_A | 262 | UDP-N-acetylglucosamine acyltransferase; LEFT-hand | 6e-08 | |
| 3t57_A | 305 | UDP-N-acetylglucosamine O-acyltransferase domain- | 9e-08 | |
| 1yp2_A | 451 | Glucose-1-phosphate adenylyltransferase small subu | 9e-08 | |
| 3c8v_A | 496 | Putative acetyltransferase; YP_390128.1, structura | 7e-06 | |
| 2v0h_A | 456 | Bifunctional protein GLMU; cell WALL, magnesium, c | 1e-05 | |
| 2v0h_A | 456 | Bifunctional protein GLMU; cell WALL, magnesium, c | 6e-04 | |
| 3eev_A | 212 | Chloramphenicol acetyltransferase; beta-helix, str | 3e-05 | |
| 4e8l_A | 219 | Virginiamycin A acetyltransferase; structural geno | 4e-05 | |
| 1hm9_A | 468 | GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr | 1e-04 | |
| 1hm9_A | 468 | GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr | 1e-04 | |
| 3vbi_A | 205 | ANTD, galactoside O-acetyltransferase; anthrose, a | 1e-04 | |
| 3vbi_A | 205 | ANTD, galactoside O-acetyltransferase; anthrose, a | 1e-04 | |
| 3st8_A | 501 | Bifunctional protein GLMU; acetyltransferase, pyro | 2e-04 | |
| 3st8_A | 501 | Bifunctional protein GLMU; acetyltransferase, pyro | 3e-04 | |
| 1xat_A | 212 | Xenobiotic acetyltransferase; chloramphenicol, LEF | 3e-04 | |
| 4fce_A | 459 | Bifunctional protein GLMU; GLMU. csgid, niaid, str | 5e-04 | |
| 1mr7_A | 209 | Streptogramin A acetyltransferase; LEFT-handed par | 8e-04 |
| >3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Length = 341 | Back alignment and structure |
|---|
Score = 65.7 bits (161), Expect = 3e-12
Identities = 19/74 (25%), Positives = 43/74 (58%), Gaps = 3/74 (4%)
Query: 212 IIHPSAELGSKTTVGPHCMLGEGSQMGDKCSVK-RSVIGRHCRIGSNVKVV-NSVVMNHV 269
+I +A+LG+ ++G + ++ G ++GD + +G++ +IG+ ++ N + + +
Sbjct: 105 VIDATAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHEI 164
Query: 270 TIGDGCSIQ-GSVI 282
IG C IQ G+V+
Sbjct: 165 QIGQNCLIQSGTVV 178
|
| >3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Length = 372 | Back alignment and structure |
|---|
| >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Length = 374 | Back alignment and structure |
|---|
| >3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Length = 420 | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401 | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 | Back alignment and structure |
|---|
| >3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Length = 192 | Back alignment and structure |
|---|
| >3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Length = 192 | Back alignment and structure |
|---|
| >3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Length = 194 | Back alignment and structure |
|---|
| >3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Length = 194 | Back alignment and structure |
|---|
| >4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Length = 220 | Back alignment and structure |
|---|
| >4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Length = 220 | Back alignment and structure |
|---|
| >3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} PDB: 3i3a_A* 3i3x_A* Length = 259 | Back alignment and structure |
|---|
| >1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Length = 270 | Back alignment and structure |
|---|
| >3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} Length = 266 | Back alignment and structure |
|---|
| >3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* Length = 240 | Back alignment and structure |
|---|
| >4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} Length = 283 | Back alignment and structure |
|---|
| >2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A Length = 262 | Back alignment and structure |
|---|
| >3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} Length = 305 | Back alignment and structure |
|---|
| >1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Length = 451 | Back alignment and structure |
|---|
| >3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} Length = 496 | Back alignment and structure |
|---|
| >2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Length = 456 | Back alignment and structure |
|---|
| >2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Length = 456 | Back alignment and structure |
|---|
| >3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} Length = 212 | Back alignment and structure |
|---|
| >4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} Length = 219 | Back alignment and structure |
|---|
| >1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Length = 468 | Back alignment and structure |
|---|
| >1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Length = 468 | Back alignment and structure |
|---|
| >3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Length = 205 | Back alignment and structure |
|---|
| >3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Length = 205 | Back alignment and structure |
|---|
| >3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Length = 501 | Back alignment and structure |
|---|
| >3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Length = 501 | Back alignment and structure |
|---|
| >1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* Length = 212 | Back alignment and structure |
|---|
| >4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Length = 459 | Back alignment and structure |
|---|
| >1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* Length = 209 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 321 | |||
| 1yp2_A | 451 | Glucose-1-phosphate adenylyltransferase small subu | 99.93 | |
| 3brk_X | 420 | Glucose-1-phosphate adenylyltransferase; ADP-gluco | 99.91 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 99.89 | |
| 1hm9_A | 468 | GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr | 99.85 | |
| 2v0h_A | 456 | Bifunctional protein GLMU; cell WALL, magnesium, c | 99.82 | |
| 4fce_A | 459 | Bifunctional protein GLMU; GLMU. csgid, niaid, str | 99.82 | |
| 3st8_A | 501 | Bifunctional protein GLMU; acetyltransferase, pyro | 99.76 | |
| 3r8y_A | 240 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac | 99.73 | |
| 2iu8_A | 374 | LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 99.68 | |
| 3ixc_A | 191 | Hexapeptide transferase family protein; niaid, ssg | 99.67 | |
| 1xhd_A | 173 | Putative acetyltransferase/acyltransferase; struct | 99.67 | |
| 3tv0_A | 194 | Dynactin subunit 6; LEFT-handed beta-helix, ARP11, | 99.66 | |
| 3kwd_A | 213 | Carbon dioxide concentrating mechanism protein; LE | 99.65 | |
| 1v3w_A | 173 | Ferripyochelin binding protein; beta-helix, carbon | 99.64 | |
| 3r3r_A | 187 | Ferripyochelin binding protein; structural genomic | 99.64 | |
| 3vbi_A | 205 | ANTD, galactoside O-acetyltransferase; anthrose, a | 99.63 | |
| 3r1w_A | 189 | Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid | 99.61 | |
| 3mqg_A | 192 | Lipopolysaccharides biosynthesis acetyltransferas; | 99.61 | |
| 3pmo_A | 372 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; | 99.61 | |
| 3kwd_A | 213 | Carbon dioxide concentrating mechanism protein; LE | 99.6 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 99.6 | |
| 3c8v_A | 496 | Putative acetyltransferase; YP_390128.1, structura | 99.59 | |
| 4e79_A | 357 | UDP-3-O-acylglucosamine N-acyltransferase; lipopol | 99.59 | |
| 2pig_A | 334 | Putative transferase; SCR6, NESG, YDCK, structural | 99.59 | |
| 1qre_A | 247 | Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth | 99.58 | |
| 3bfp_A | 194 | Acetyltransferase; LEFT-handed beta helix, COA bin | 99.58 | |
| 4eqy_A | 283 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.58 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 99.57 | |
| 2qia_A | 262 | UDP-N-acetylglucosamine acyltransferase; LEFT-hand | 99.57 | |
| 3r0s_A | 266 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.57 | |
| 1qre_A | 247 | Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth | 99.57 | |
| 3eh0_A | 341 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr | 99.57 | |
| 4e6u_A | 265 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.56 | |
| 1j2z_A | 270 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.56 | |
| 3r0s_A | 266 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.56 | |
| 4ea9_A | 220 | Perosamine N-acetyltransferase; beta helix, acetyl | 99.55 | |
| 3hsq_A | 259 | Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam | 99.55 | |
| 3hsq_A | 259 | Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam | 99.55 | |
| 3mqg_A | 192 | Lipopolysaccharides biosynthesis acetyltransferas; | 99.55 | |
| 4eqy_A | 283 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.54 | |
| 4e6u_A | 265 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.54 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 99.53 | |
| 3pmo_A | 372 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; | 99.53 | |
| 3eh0_A | 341 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr | 99.51 | |
| 3tk8_A | 316 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.51 | |
| 1j2z_A | 270 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.5 | |
| 3t57_A | 305 | UDP-N-acetylglucosamine O-acyltransferase domain- | 99.5 | |
| 4e79_A | 357 | UDP-3-O-acylglucosamine N-acyltransferase; lipopol | 99.5 | |
| 3gos_A | 276 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.5 | |
| 2qia_A | 262 | UDP-N-acetylglucosamine acyltransferase; LEFT-hand | 99.5 | |
| 3eg4_A | 304 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.49 | |
| 3r5d_A | 347 | Tetrahydrodipicolinate N-succinyletransferase; 1.8 | 99.49 | |
| 1xhd_A | 173 | Putative acetyltransferase/acyltransferase; struct | 99.48 | |
| 3eg4_A | 304 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.48 | |
| 1v3w_A | 173 | Ferripyochelin binding protein; beta-helix, carbon | 99.48 | |
| 3ixc_A | 191 | Hexapeptide transferase family protein; niaid, ssg | 99.47 | |
| 3r3r_A | 187 | Ferripyochelin binding protein; structural genomic | 99.45 | |
| 3gos_A | 276 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.44 | |
| 3r8y_A | 240 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac | 99.44 | |
| 3fsy_A | 332 | Tetrahydrodipicolinate N-succinyltransferase; beta | 99.44 | |
| 3bfp_A | 194 | Acetyltransferase; LEFT-handed beta helix, COA bin | 99.44 | |
| 2iu8_A | 374 | LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 99.44 | |
| 3t57_A | 305 | UDP-N-acetylglucosamine O-acyltransferase domain- | 99.43 | |
| 4ea9_A | 220 | Perosamine N-acetyltransferase; beta helix, acetyl | 99.43 | |
| 3vbi_A | 205 | ANTD, galactoside O-acetyltransferase; anthrose, a | 99.43 | |
| 2rij_A | 387 | Putative 2,3,4,5-tetrahydropyridine-2-carboxylate | 99.43 | |
| 1hm9_A | 468 | GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr | 99.43 | |
| 3r1w_A | 189 | Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid | 99.42 | |
| 3jqy_B | 252 | NEUO, polysialic acid O-acetyltransferase; LEFT-ha | 99.42 | |
| 2v0h_A | 456 | Bifunctional protein GLMU; cell WALL, magnesium, c | 99.41 | |
| 4fce_A | 459 | Bifunctional protein GLMU; GLMU. csgid, niaid, str | 99.4 | |
| 3tv0_A | 194 | Dynactin subunit 6; LEFT-handed beta-helix, ARP11, | 99.4 | |
| 3c8v_A | 496 | Putative acetyltransferase; YP_390128.1, structura | 99.38 | |
| 2wlg_A | 215 | Polysialic acid O-acetyltransferase; enzyme, LEFT- | 99.38 | |
| 3tk8_A | 316 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.37 | |
| 3nz2_A | 195 | Hexapeptide-repeat containing-acetyltransferase; s | 99.34 | |
| 3fsy_A | 332 | Tetrahydrodipicolinate N-succinyltransferase; beta | 99.34 | |
| 2pig_A | 334 | Putative transferase; SCR6, NESG, YDCK, structural | 99.33 | |
| 3brk_X | 420 | Glucose-1-phosphate adenylyltransferase; ADP-gluco | 99.33 | |
| 3hjj_A | 190 | Maltose O-acetyltransferase; LEFT-handed beta-heli | 99.32 | |
| 3st8_A | 501 | Bifunctional protein GLMU; acetyltransferase, pyro | 99.29 | |
| 3r5d_A | 347 | Tetrahydrodipicolinate N-succinyletransferase; 1.8 | 99.29 | |
| 3srt_A | 188 | Maltose O-acetyltransferase; structural genomics, | 99.28 | |
| 3q1x_A | 313 | Serine acetyltransferase; cysteine biosynthesis, L | 99.27 | |
| 3q1x_A | 313 | Serine acetyltransferase; cysteine biosynthesis, L | 99.25 | |
| 3ftt_A | 199 | Putative acetyltransferase sacol2570; galactoside | 99.25 | |
| 3jqy_B | 252 | NEUO, polysialic acid O-acetyltransferase; LEFT-ha | 99.25 | |
| 1krr_A | 203 | Galactoside O-acetyltransferase; LEFT-handed paral | 99.23 | |
| 3mc4_A | 287 | WW/RSP5/WWP domain:bacterial transferase hexapept | 99.22 | |
| 1ocx_A | 182 | Maltose O-acetyltransferase; LEFT-handed parallel | 99.21 | |
| 1yp2_A | 451 | Glucose-1-phosphate adenylyltransferase small subu | 99.19 | |
| 3f1x_A | 310 | Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 | 99.17 | |
| 3nz2_A | 195 | Hexapeptide-repeat containing-acetyltransferase; s | 99.17 | |
| 2p2o_A | 185 | Maltose transacetylase; GK1921, GKA001001921.1, ge | 99.16 | |
| 4hur_A | 220 | Virginiamycin A acetyltransferase; structural geno | 99.15 | |
| 3hjj_A | 190 | Maltose O-acetyltransferase; LEFT-handed beta-heli | 99.15 | |
| 3srt_A | 188 | Maltose O-acetyltransferase; structural genomics, | 99.14 | |
| 3ftt_A | 199 | Putative acetyltransferase sacol2570; galactoside | 99.13 | |
| 1ssq_A | 267 | SAT, serine acetyltransferase; LEFT-handed paralle | 99.13 | |
| 2wlg_A | 215 | Polysialic acid O-acetyltransferase; enzyme, LEFT- | 99.11 | |
| 4hur_A | 220 | Virginiamycin A acetyltransferase; structural geno | 99.11 | |
| 1t3d_A | 289 | SAT, serine acetyltransferase; LEFT-handed-beta-he | 99.1 | |
| 2rij_A | 387 | Putative 2,3,4,5-tetrahydropyridine-2-carboxylate | 99.08 | |
| 3f1x_A | 310 | Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 | 99.07 | |
| 3mc4_A | 287 | WW/RSP5/WWP domain:bacterial transferase hexapept | 99.04 | |
| 1krr_A | 203 | Galactoside O-acetyltransferase; LEFT-handed paral | 98.99 | |
| 1ocx_A | 182 | Maltose O-acetyltransferase; LEFT-handed parallel | 98.98 | |
| 2p2o_A | 185 | Maltose transacetylase; GK1921, GKA001001921.1, ge | 98.97 | |
| 1ssq_A | 267 | SAT, serine acetyltransferase; LEFT-handed paralle | 98.96 | |
| 1t3d_A | 289 | SAT, serine acetyltransferase; LEFT-handed-beta-he | 98.93 | |
| 3eev_A | 212 | Chloramphenicol acetyltransferase; beta-helix, str | 98.88 | |
| 4e8l_A | 219 | Virginiamycin A acetyltransferase; structural geno | 98.83 | |
| 3eev_A | 212 | Chloramphenicol acetyltransferase; beta-helix, str | 98.79 | |
| 1mr7_A | 209 | Streptogramin A acetyltransferase; LEFT-handed par | 98.74 | |
| 4e8l_A | 219 | Virginiamycin A acetyltransferase; structural geno | 98.74 | |
| 1xat_A | 212 | Xenobiotic acetyltransferase; chloramphenicol, LEF | 98.73 | |
| 1xat_A | 212 | Xenobiotic acetyltransferase; chloramphenicol, LEF | 98.44 | |
| 1mr7_A | 209 | Streptogramin A acetyltransferase; LEFT-handed par | 98.4 | |
| 3juk_A | 281 | UDP-glucose pyrophosphorylase (GALU); transfer; HE | 98.16 | |
| 4ecm_A | 269 | Glucose-1-phosphate thymidylyltransferase; HET: DA | 97.78 | |
| 3pnn_A | 303 | Conserved domain protein; structural genomics, PSI | 97.46 | |
| 1tzf_A | 259 | Glucose-1-phosphate cytidylyltransferase; nucleoti | 97.17 | |
| 2pa4_A | 323 | UTP-glucose-1-phosphate uridylyltransferase; phosp | 97.14 | |
| 2e3d_A | 302 | UTP--glucose-1-phosphate uridylyltransferase; UDP- | 97.13 | |
| 2ux8_A | 297 | Glucose-1-phosphate uridylyltransferase; UGPG, GAL | 97.08 | |
| 4evw_A | 255 | Nucleoside-diphosphate-sugar pyrophosphorylase; st | 96.91 | |
| 2qh5_A | 308 | PMI, ALGA, mannose-6-phosphate isomerase; structur | 95.67 | |
| 1jyk_A | 254 | LICC protein, CTP:phosphocholine cytidylytransfera | 94.38 | |
| 2x65_A | 336 | Mannose-1-phosphate guanylyltransferase; nucleotid | 94.3 | |
| 1mc3_A | 296 | Glucose-1-phosphate thymidylyltransferase; glucose | 94.13 | |
| 3oam_A | 252 | 3-deoxy-manno-octulosonate cytidylyltransferase; c | 93.99 | |
| 1fxo_A | 293 | Glucose-1-phosphate thymidylyltransferase; rhamnos | 93.93 | |
| 1lvw_A | 295 | Glucose-1-phosphate thymidylyltransferase; protein | 93.6 | |
| 2y6p_A | 234 | 3-deoxy-manno-octulosonate cytidylyltransferase; l | 93.41 | |
| 2cu2_A | 337 | Putative mannose-1-phosphate guanylyl transferase; | 92.99 | |
| 4fcu_A | 253 | 3-deoxy-manno-octulosonate cytidylyltransferase; s | 92.46 | |
| 3tqd_A | 256 | 3-deoxy-manno-octulosonate cytidylyltransferase; c | 91.8 | |
| 1h7e_A | 245 | 3-deoxy-manno-octulosonate cytidylyltransferase; n | 91.34 | |
| 2icy_A | 469 | Probable UTP-glucose-1-phosphate uridylyltransfera | 91.11 | |
| 3k8d_A | 264 | 3-deoxy-manno-octulosonate cytidylyltransferase; K | 90.3 | |
| 1vic_A | 262 | 3-deoxy-manno-octulosonate cytidylyltransferase; s | 88.92 | |
| 2xme_A | 232 | CTP-inositol-1-phosphate cytidylyltransferase; CDP | 87.29 | |
| 2vsh_A | 236 | TARI, 2-C-methyl-D-erythritol 4-phosphate cytidyly | 84.32 |
| >1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* | Back alignment and structure |
|---|
Probab=99.93 E-value=2.7e-25 Score=214.62 Aligned_cols=168 Identities=20% Similarity=0.377 Sum_probs=129.5
Q ss_pred CCCccceEEeEeHHHHHHHHhcc-ccCCCCccchhHHHHHhhcccccccCCCCCCccccccCCCcchhhhhhcCCCCCcc
Q 020813 70 ADLMDAHMYAFNRSVLQEVLDQK-DKFQSLKQDVLPYLVRSQLKSEILINGAPQGQQAKENGNDKVSYRILANASTPSFH 148 (321)
Q Consensus 70 s~l~d~giYi~~~~vl~~~l~~~-~~~~si~~dlip~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 148 (321)
++++++|+|+|++++|..++++. ....++.+|++|.+++++
T Consensus 225 ~~~~~~Giy~~~~~~l~~~l~~~~~~~~~~~~~~l~~~i~~g-------------------------------------- 266 (451)
T 1yp2_A 225 PFIASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPGATSLG-------------------------------------- 266 (451)
T ss_dssp CEEEEEEEEEEEHHHHHHHHHTTCTTCCCTTTTHHHHHHHTT--------------------------------------
T ss_pred cceEEeeEEEEcHHHHHHHHHhhcccccchHhhHHHHHHhcC--------------------------------------
Confidence 45789999999999986666543 234567789999988764
Q ss_pred ccccCCCCCCCCCCCcceeEEEEecCccceeeccCHHHHHHHchhhcccc-ccCC---CcccccCCeeeCCCCeeCCCcE
Q 020813 149 ELYALGPNGSAPVRRTHKCCVYIASNSKYCVRLNSIQAFMDINRDVIGEA-NHLS---GYNFSAQNNIIHPSAELGSKTT 224 (321)
Q Consensus 149 ~~~~~~~~~~~~~~~~~~v~~~i~~~~~~w~~i~t~~~y~~~~~~~l~~~-~~~~---~~~~~~~~~~i~p~a~i~~~~~ 224 (321)
.++++| ..++||.++|++++|+++++.++... .... ..........|+|++.| .++.
T Consensus 267 ----------------~~v~~~--~~~~~w~digt~~~l~~a~~~l~~~~~~~~~~~~~~~~i~~~~~i~~~~~i-~~~~ 327 (451)
T 1yp2_A 267 ----------------MRVQAY--LYDGYWEDIGTIEAFYNANLGITKKPVPDFSFYDRSAPIYTQPRYLPPSKM-LDAD 327 (451)
T ss_dssp ----------------CCEEEE--ECCSCCEECSSHHHHHHHHHGGGCSSSCSSCSCCSSSCCCCCCCCCCCEEE-EEEE
T ss_pred ----------------CceEEE--EeCCEEEECCCHHHHHHHHHHHhcccccchhccCCCCeeccCCccCCCeEE-cceE
Confidence 246666 45789999999999999999988654 2111 11112223344445544 4455
Q ss_pred ECCCCEECCCCEECCCCeEeceEECCCCEECCCcEEeceEECCC-------------------CEECCCcEEeceEECCC
Q 020813 225 VGPHCMLGEGSQMGDKCSVKRSVIGRHCRIGSNVKVVNSVVMNH-------------------VTIGDGCSIQGSVICSN 285 (321)
Q Consensus 225 i~~~~~Ig~~~~I~~~~~I~~svIg~~~~Ig~~~~I~~siI~~~-------------------v~Ig~~~~I~~~iI~~~ 285 (321)
| .++.||++|.|+. +.|.+++||++|.||++|+|.+++++++ +.||++|.|++++|+++
T Consensus 328 I-~~~~Ig~~~~I~~-~~i~~~~Ig~~~~Ig~~~~I~~~~~~~~~~~~~~~~~~~~~~~g~~~~~Ig~~~~i~~~~Ig~~ 405 (451)
T 1yp2_A 328 V-TDSVIGEGCVIKN-CKIHHSVVGLRSCISEGAIIEDSLLMGADYYETDADRKLLAAKGSVPIGIGKNCHIKRAIIDKN 405 (451)
T ss_dssp E-EEEEECTTCEEEE-EEEESCEECTTCEECTTCEEESCEECCCSSCCCHHHHHHHHTTTCCCSEECTTCEEESEEECTT
T ss_pred E-eCeEECCCCEEcc-eEEeccEECCCCEECCCCEEcCceEECCCCcccccccccccccCceeEEECCCCEEeccEeCCC
Confidence 6 4678888888876 7888999999999999999999999888 99999999999999999
Q ss_pred CEECcCcEecC
Q 020813 286 AQLQERVALKD 296 (321)
Q Consensus 286 ~~Ig~~~~i~~ 296 (321)
|.||+|++|.+
T Consensus 406 ~~IG~~~~i~~ 416 (451)
T 1yp2_A 406 ARIGDNVKIIN 416 (451)
T ss_dssp CEECTTCEECC
T ss_pred cEECCCCEEeC
Confidence 99999999863
|
| >3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* | Back alignment and structure |
|---|
| >1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* | Back alignment and structure |
|---|
| >2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* | Back alignment and structure |
|---|
| >4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* | Back alignment and structure |
|---|
| >3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* | Back alignment and structure |
|---|
| >3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* | Back alignment and structure |
|---|
| >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* | Back alignment and structure |
|---|
| >3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A | Back alignment and structure |
|---|
| >3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A | Back alignment and structure |
|---|
| >1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A | Back alignment and structure |
|---|
| >3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A | Back alignment and structure |
|---|
| >3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* | Back alignment and structure |
|---|
| >3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} | Back alignment and structure |
|---|
| >3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* | Back alignment and structure |
|---|
| >3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* | Back alignment and structure |
|---|
| >3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A | Back alignment and structure |
|---|
| >2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A | Back alignment and structure |
|---|
| >1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A | Back alignment and structure |
|---|
| >3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A | Back alignment and structure |
|---|
| >4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* | Back alignment and structure |
|---|
| >2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A | Back alignment and structure |
|---|
| >3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 | Back alignment and structure |
|---|
| >1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A | Back alignment and structure |
|---|
| >3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* | Back alignment and structure |
|---|
| >1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 | Back alignment and structure |
|---|
| >3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 | Back alignment and structure |
|---|
| >4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* | Back alignment and structure |
|---|
| >3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* | Back alignment and structure |
|---|
| >3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* | Back alignment and structure |
|---|
| >3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* | Back alignment and structure |
|---|
| >4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* | Back alignment and structure |
|---|
| >3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 | Back alignment and structure |
|---|
| >3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A | Back alignment and structure |
|---|
| >3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A | Back alignment and structure |
|---|
| >2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A | Back alignment and structure |
|---|
| >3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} | Back alignment and structure |
|---|
| >3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A | Back alignment and structure |
|---|
| >1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A | Back alignment and structure |
|---|
| >3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} | Back alignment and structure |
|---|
| >1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A | Back alignment and structure |
|---|
| >3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A | Back alignment and structure |
|---|
| >3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A | Back alignment and structure |
|---|
| >3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* | Back alignment and structure |
|---|
| >3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* | Back alignment and structure |
|---|
| >3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A | Back alignment and structure |
|---|
| >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* | Back alignment and structure |
|---|
| >3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* | Back alignment and structure |
|---|
| >3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* | Back alignment and structure |
|---|
| >2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* | Back alignment and structure |
|---|
| >3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} | Back alignment and structure |
|---|
| >3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* | Back alignment and structure |
|---|
| >4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* | Back alignment and structure |
|---|
| >3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* | Back alignment and structure |
|---|
| >3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* | Back alignment and structure |
|---|
| >3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* | Back alignment and structure |
|---|
| >2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A | Back alignment and structure |
|---|
| >3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* | Back alignment and structure |
|---|
| >3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* | Back alignment and structure |
|---|
| >3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A | Back alignment and structure |
|---|
| >3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* | Back alignment and structure |
|---|
| >3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A | Back alignment and structure |
|---|
| >3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A | Back alignment and structure |
|---|
| >3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A | Back alignment and structure |
|---|
| >3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* | Back alignment and structure |
|---|
| >3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* | Back alignment and structure |
|---|
| >3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} | Back alignment and structure |
|---|
| >3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* | Back alignment and structure |
|---|
| >2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A | Back alignment and structure |
|---|
| >4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A | Back alignment and structure |
|---|
| >3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* | Back alignment and structure |
|---|
| >3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* | Back alignment and structure |
|---|
| >3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A | Back alignment and structure |
|---|
| >1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* | Back alignment and structure |
|---|
| >2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* | Back alignment and structure |
|---|
| >4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A | Back alignment and structure |
|---|
| >1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 | Back alignment and structure |
|---|
| >2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} | Back alignment and structure |
|---|
| >3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* | Back alignment and structure |
|---|
| >1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A | Back alignment and structure |
|---|
| >1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* | Back alignment and structure |
|---|
| >1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 | Back alignment and structure |
|---|
| >3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* | Back alignment and structure |
|---|
| >4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* | Back alignment and structure |
|---|
| >1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* | Back alignment and structure |
|---|
| >1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* | Back alignment and structure |
|---|
| >3juk_A UDP-glucose pyrophosphorylase (GALU); transfer; HET: UPG; 2.30A {Helicobacter pylori} PDB: 3juj_A* | Back alignment and structure |
|---|
| >4ecm_A Glucose-1-phosphate thymidylyltransferase; HET: DAU; 2.30A {Bacillus anthracis} PDB: 3hl3_A* | Back alignment and structure |
|---|
| >3pnn_A Conserved domain protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: MSE GOL; 1.90A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >1tzf_A Glucose-1-phosphate cytidylyltransferase; nucleotidyltransferase, mixed alpha/beta fold; HET: C5G; 2.10A {Salmonella enterica subsp} SCOP: c.68.1.13 PDB: 1wvc_A* | Back alignment and structure |
|---|
| >2pa4_A UTP-glucose-1-phosphate uridylyltransferase; phosphorylase, nucleotidyltransferase, metabolism; HET: GUD; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2e3d_A UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose, carbohydrate, pyrophosphorylase; 1.95A {Escherichia coli} | Back alignment and structure |
|---|
| >2ux8_A Glucose-1-phosphate uridylyltransferase; UGPG, GALU pyrophosphorylase, nucleotidyltransferase; HET: G1P; 2.65A {Sphingomonas elodea} | Back alignment and structure |
|---|
| >4evw_A Nucleoside-diphosphate-sugar pyrophosphorylase; structural genomics, PSI-biology; HET: MSE; 1.90A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2qh5_A PMI, ALGA, mannose-6-phosphate isomerase; structural genomics, PSI, protein structure initi nysgrc; 2.30A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1jyk_A LICC protein, CTP:phosphocholine cytidylytransferase; 3D structure, CTP:phosphocholine cytidylyltransferase; 1.50A {Streptococcus pneumoniae} SCOP: c.68.1.13 PDB: 1jyl_A* | Back alignment and structure |
|---|
| >2x65_A Mannose-1-phosphate guanylyltransferase; nucleotidyltransferase; HET: M1P; 2.10A {Thermotoga maritima} PDB: 2x5z_A* 2x60_A* 2x5s_A* | Back alignment and structure |
|---|
| >1mc3_A Glucose-1-phosphate thymidylyltransferase; glucose-1-phosphate thymidylytransferase, RFFH; HET: TTP; 2.60A {Escherichia coli} SCOP: c.68.1.6 | Back alignment and structure |
|---|
| >3oam_A 3-deoxy-manno-octulosonate cytidylyltransferase; center for structural genomics of infectious diseases; 1.75A {Vibrio cholerae o1 biovar el tor} SCOP: c.68.1.13 | Back alignment and structure |
|---|
| >1fxo_A Glucose-1-phosphate thymidylyltransferase; rhamnose, nucleotidyltransferase, pyrophosphorylase, allostery; HET: TMP; 1.66A {Pseudomonas aeruginosa} SCOP: c.68.1.6 PDB: 1fzw_A 1g0r_A* 1g1l_A* 1g23_A* 1g2v_A* 1g3l_A* 1h5r_A* 1h5s_C* 1h5t_A* 1h5s_D* 1h5s_A* 1h5r_B* 1h5s_B* 1h5t_B* 1iim_A* 1iin_A* 3pkp_A* 3pkq_A* 1mp5_A* 1mp3_A* ... | Back alignment and structure |
|---|
| >1lvw_A Glucose-1-phosphate thymidylyltransferase; protein nucleotide complex, nucleotide binding fold; HET: TYD; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.68.1.6 | Back alignment and structure |
|---|
| >2y6p_A 3-deoxy-manno-octulosonate cytidylyltransferase; lipid A; HET: CTP; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2cu2_A Putative mannose-1-phosphate guanylyl transferase; mannose-1-phosphate geranyltransferase, thermus thermophilus structural genomics; 2.20A {Thermus thermophilus} SCOP: b.81.4.1 c.68.1.20 | Back alignment and structure |
|---|
| >4fcu_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.90A {Acinetobacter baumannii} PDB: 3pol_A | Back alignment and structure |
|---|
| >3tqd_A 3-deoxy-manno-octulosonate cytidylyltransferase; cell envelope; 1.80A {Coxiella burnetii} SCOP: c.68.1.0 | Back alignment and structure |
|---|
| >1h7e_A 3-deoxy-manno-octulosonate cytidylyltransferase; nucleotidyltransferase, CMP-KDO synthetase, nucleoside monophosphate glycosides; 1.83A {Escherichia coli} SCOP: c.68.1.13 PDB: 1gqc_A* 1gq9_A 1h6j_A 1h7f_A* 1h7g_A* 1h7h_A* 1h7t_A* | Back alignment and structure |
|---|
| >3k8d_A 3-deoxy-manno-octulosonate cytidylyltransferase; KDSB synthetase KDO complex, lipopolysaccharide biosynthesis magnesium, nucleotidyltransferase; HET: KDO CTP; 1.90A {Escherichia coli} SCOP: c.68.1.13 PDB: 3k8e_C 1vh1_A 3jtj_A* | Back alignment and structure |
|---|
| >1vic_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics; 1.80A {Haemophilus influenzae} SCOP: c.68.1.13 PDB: 1vh3_A 3duv_A* | Back alignment and structure |
|---|
| >2xme_A CTP-inositol-1-phosphate cytidylyltransferase; CDP-inositol, DI-MYO-inositol phosphate; 1.89A {Archaeoglobus fulgidus} PDB: 2xmh_A* | Back alignment and structure |
|---|
| >2vsh_A TARI, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; nucleotidyltransferase; HET: 1PE PG4 P6G; 2.00A {Streptococcus pneumoniae} PDB: 2vsi_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 321 | ||||
| d2f9ca1 | 320 | b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salm | 1e-08 | |
| d2f9ca1 | 320 | b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salm | 6e-04 | |
| d1fxja1 | 78 | b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha | 3e-08 | |
| d1fxja1 | 78 | b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha | 4e-07 | |
| d1fxja1 | 78 | b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha | 5e-05 | |
| d1j2za_ | 259 | b.81.1.1 (A:) UDP N-acetylglucosamine acyltransfer | 3e-06 | |
| d1j2za_ | 259 | b.81.1.1 (A:) UDP N-acetylglucosamine acyltransfer | 1e-04 | |
| d2jf2a1 | 262 | b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltra | 3e-05 | |
| d2jf2a1 | 262 | b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltra | 8e-05 | |
| d1mr7a_ | 203 | b.81.1.3 (A:) Xenobiotic acetyltransferase {Entero | 9e-05 | |
| d1yp2a1 | 135 | b.81.1.4 (A:317-451) Glucose-1-phosphate adenylylt | 6e-04 | |
| d1g97a1 | 196 | b.81.1.4 (A:252-447) N-acetylglucosamine 1-phospha | 0.004 |
| >d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Length = 320 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Single-stranded left-handed beta-helix superfamily: Trimeric LpxA-like enzymes family: YdcK-like domain: Hypothetical protein YdcK species: Salmonella enterica [TaxId: 28901]
Score = 53.3 bits (127), Expect = 1e-08
Identities = 25/128 (19%), Positives = 40/128 (31%), Gaps = 11/128 (8%)
Query: 170 YIASNSKYCVRLNSIQA---FMDINRDVIG-----EAN--HLSGYNFSAQNNIIHPSAEL 219
Y K V L + A F D+ G + +N + E+
Sbjct: 13 YQVDGEKKSVLLRQVIAVTDFNDVKAGTSGGWVDADNVLSQQGDCWIYDENAMAFAGTEI 72
Query: 220 GSKTTVGPHCMLGEGSQMGDKCSVKRSVIGRHCRIGSNVKVVNSV-VMNHVTIGDGCSIQ 278
+ C L ++GD + R+ I RI NV + +S GD +
Sbjct: 73 TGNARITQPCTLYNNVRIGDNVWIDRADISDGARISDNVTIQSSSVREECAIYGDARVLN 132
Query: 279 GSVICSNA 286
S I +
Sbjct: 133 QSEILAIQ 140
|
| >d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Length = 320 | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 | Back information, alignment and structure |
|---|
| >d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Length = 259 | Back information, alignment and structure |
|---|
| >d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Length = 259 | Back information, alignment and structure |
|---|
| >d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Length = 262 | Back information, alignment and structure |
|---|
| >d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Length = 262 | Back information, alignment and structure |
|---|
| >d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} Length = 203 | Back information, alignment and structure |
|---|
| >d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 135 | Back information, alignment and structure |
|---|
| >d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 196 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 321 | |||
| d1qrea_ | 210 | gamma-carbonic anhydrase {Archaeon Methanosarcina | 99.63 | |
| d1yp2a1 | 135 | Glucose-1-phosphate adenylyltransferase small subu | 99.53 | |
| d1qrea_ | 210 | gamma-carbonic anhydrase {Archaeon Methanosarcina | 99.53 | |
| d2jf2a1 | 262 | UDP N-acetylglucosamine acyltransferase {Escherich | 99.51 | |
| d1xhda_ | 172 | Putative acetyltransferase/acyltransferase BC4754 | 99.51 | |
| d3bswa1 | 193 | Acetyltransferase PglD {Campylobacter jejuni [TaxI | 99.5 | |
| d1j2za_ | 259 | UDP N-acetylglucosamine acyltransferase {Helicobac | 99.46 | |
| d1fxja1 | 78 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.45 | |
| d2jf2a1 | 262 | UDP N-acetylglucosamine acyltransferase {Escherich | 99.44 | |
| d3bswa1 | 193 | Acetyltransferase PglD {Campylobacter jejuni [TaxI | 99.41 | |
| d1g97a1 | 196 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.4 | |
| d1fxja1 | 78 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.39 | |
| d1v3wa_ | 173 | Ferripyochelin binding protein {Archaeon Pyrococcu | 99.38 | |
| d1j2za_ | 259 | UDP N-acetylglucosamine acyltransferase {Helicobac | 99.35 | |
| d1krra_ | 200 | Galactoside acetyltransferase {Escherichia coli [T | 99.3 | |
| d1xhda_ | 172 | Putative acetyltransferase/acyltransferase BC4754 | 99.26 | |
| d1g97a1 | 196 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.26 | |
| d1v3wa_ | 173 | Ferripyochelin binding protein {Archaeon Pyrococcu | 99.19 | |
| d1ocxa_ | 182 | Maltose O-acetyltransferase {Escherichia coli [Tax | 99.19 | |
| d1yp2a1 | 135 | Glucose-1-phosphate adenylyltransferase small subu | 99.14 | |
| d3tdta_ | 274 | Tetrahydrodipicolinate-N-succinlytransferase, THDP | 99.1 | |
| d2oi6a1 | 201 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.1 | |
| d3tdta_ | 274 | Tetrahydrodipicolinate-N-succinlytransferase, THDP | 99.08 | |
| d1krra_ | 200 | Galactoside acetyltransferase {Escherichia coli [T | 99.02 | |
| d1mr7a_ | 203 | Xenobiotic acetyltransferase {Enterococcus faecium | 99.02 | |
| d1yp2a2 | 307 | Glucose-1-phosphate adenylyltransferase small subu | 98.89 | |
| d1ocxa_ | 182 | Maltose O-acetyltransferase {Escherichia coli [Tax | 98.89 | |
| d2oi6a1 | 201 | N-acetylglucosamine 1-phosphate uridyltransferase | 98.87 | |
| d1mr7a_ | 203 | Xenobiotic acetyltransferase {Enterococcus faecium | 98.86 | |
| d2f9ca1 | 320 | Hypothetical protein YdcK {Salmonella enterica [Ta | 98.75 | |
| d1ssqa_ | 241 | Serine acetyltransferase {Haemophilus influenzae [ | 98.75 | |
| d1xata_ | 208 | Xenobiotic acetyltransferase {Pseudomonas aerugino | 98.7 | |
| d1ssqa_ | 241 | Serine acetyltransferase {Haemophilus influenzae [ | 98.66 | |
| d1xata_ | 208 | Xenobiotic acetyltransferase {Pseudomonas aerugino | 98.54 | |
| d2f9ca1 | 320 | Hypothetical protein YdcK {Salmonella enterica [Ta | 98.48 | |
| d1fxoa_ | 292 | RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} | 98.4 | |
| d1mc3a_ | 291 | RffH {Escherichia coli [TaxId: 562]} | 98.02 | |
| d1tzfa_ | 259 | Glucose-1-phosphate cytidylyltransferase RfbF {Sal | 97.27 | |
| d1lvwa_ | 295 | RmlA (RfbA) {Archaeon Methanobacterium thermoautot | 95.99 | |
| d2cu2a2 | 268 | Putative mannose-1-phosphate guanylyl transferase | 95.29 | |
| d1g97a2 | 250 | N-acetylglucosamine 1-phosphate uridyltransferase | 89.63 |
| >d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Single-stranded left-handed beta-helix superfamily: Trimeric LpxA-like enzymes family: gamma-carbonic anhydrase-like domain: gamma-carbonic anhydrase species: Archaeon Methanosarcina thermophila [TaxId: 2210]
Probab=99.63 E-value=1.9e-15 Score=129.10 Aligned_cols=103 Identities=14% Similarity=0.264 Sum_probs=71.2
Q ss_pred eeeCCCCeeCCCcEECCCCEECCCCEECCCCeEe-----ceEECCCCEECCCcEEe------------------------
Q 020813 211 NIIHPSAELGSKTTVGPHCMLGEGSQMGDKCSVK-----RSVIGRHCRIGSNVKVV------------------------ 261 (321)
Q Consensus 211 ~~i~p~a~i~~~~~i~~~~~Ig~~~~I~~~~~I~-----~svIg~~~~Ig~~~~I~------------------------ 261 (321)
..|+|+|+|++++.|.+++.||++|.|+.+|.|+ +.+||++|.|++++.|.
T Consensus 23 p~I~~~a~I~p~A~i~g~V~IG~~~~Igp~~vIrgd~~~~i~IG~~~~I~~~~~I~~~~~~~~~~~~~~~~~~~~~~~~~ 102 (210)
T d1qrea_ 23 PVIDPTAYIDPQASVIGEVTIGANVMVSPMASIRSDEGMPIFVGDRSNVQDGVVLHALETINEEGEPIEDNIVEVDGKEY 102 (210)
T ss_dssp CEECTTCEECTTCEEEESEEECTTCEECTTCEEEESSSCCEEECTTCEECTTCEEEECCSBCTTSCBCGGGCEEETTEEE
T ss_pred CccCCCCEECCCCEEecceEECCCCEEccCeeeecccCCceEEcccceeeeeeEeccceeeccccccccCcccccccccc
Confidence 3456666666666555555666666666666652 35777777777777772
Q ss_pred ceEECCCCEECCCcEEe-ceEECCCCEECcCcEecCeEECCCcEEcCCcEEcC
Q 020813 262 NSVVMNHVTIGDGCSIQ-GSVICSNAQLQERVALKDCQVGQGYVVSAGCEYKG 313 (321)
Q Consensus 262 ~siI~~~v~Ig~~~~I~-~~iI~~~~~Ig~~~~i~~~iIg~~~~V~~~~~i~~ 313 (321)
.+.|+++|.||+++.|. ++.||+++.||.++++.++.||++++|++++.+.+
T Consensus 103 ~~~IG~~v~IG~~~~i~g~~~IGd~~~IG~gs~i~~~~IG~~~vIg~~svv~g 155 (210)
T d1qrea_ 103 AVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVFKSKVGNNCVLEPRSAAIG 155 (210)
T ss_dssp SEEECTTCEECTTCEEEEEEEECTTCEECTTCEEEEEEECTTCEECTTCEEES
T ss_pred ceeeccccccccccccccCCcccCCcEeeCCccccccccccCcEEecCcEecC
Confidence 36788888888888886 67888888888888877777777777776666554
|
| >d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} | Back information, alignment and structure |
|---|
| >d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} | Back information, alignment and structure |
|---|
| >d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} | Back information, alignment and structure |
|---|
| >d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d1yp2a2 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} | Back information, alignment and structure |
|---|
| >d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} | Back information, alignment and structure |
|---|
| >d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tzfa_ c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2cu2a2 c.68.1.20 (A:1-268) Putative mannose-1-phosphate guanylyl transferase (GDP)/mannose-6-phosphate isomerase TTHA1750 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1g97a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|