Citrus Sinensis ID: 020822

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-
MLALVPLGSELERIMGSVRMFYITILLATSNAILHLLIALLVAHIPFYRLQNVMDECAIGFSGVIFSLIVIETSLSGAQSRSVFGLFNIPAKWYPLILLVLFQVLMTNVSLLGHLCGILSGFAYTYGFFNLLMPGTSFYSAIESSSLLSTCIRQPKFILCTGGNPSGYIPTYSGQNTSSSGLFSGNIWSNLSSWMPQRETSSQPTQDSRFPGRGRTLSSSQSPVHVDSNLQARLLDNSSPENRSHMIVTETGDRLSDERQPALGTAVAVDRVPAGQQGAVVSDEEIQKLVSMGFDKTQVEVALAAADGDLNVAVEILSQQG
ccccHHcHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHcccccEEEEEEEcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccccccccHHcccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHcc
cccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHEHcHHHHHHHHHHHHHHcccccccEEEEEEEccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcHHHHHcccHHHHHHEEcccHHHHHEccccEEEEccccccccccccccccccccccccccHHHccHcccccccccccccccccccccccEccccccccccccHHHHHHcccccccccccccccccccccccccccHHHHHHHccccccccccccccHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHccc
mlalvplgSELERIMGSVRMFYITILLATSNAILHLLIALLVAHIPFYRLQNVMDECAIGFSGVIFSLIVIETslsgaqsrsvfglfnipakwYPLILLVLFQVLMTNVSLLGHLCGILSGFAYTYgffnllmpgtsfysAIESSSllstcirqpkfilctggnpsgyiptysgqntsssglfsgNIWSnlsswmpqretssqptqdsrfpgrgrtlsssqspvhvdsnlqarlldnsspenrshmivtetgdrlsderqpalgtavavdrvpagqqgavvsDEEIQKLVSMGFDKTQVEVALAAADGDLNVAVEILSQQG
MLALVPLGSELERIMGSVRMFYITILLATSNAILHLLIALLVAHIPFYRLQNVMDECAIGFSGVIFSLIVIETSLSGAQSRSVFGLFNIPAKWYPLILLVLFQVLMTNVSLLGHLCGILSGFAYTYGFFNLLMPGTSFYSAIESSSLLSTCIRQPKFILCTGGNPSGYIPTYSGQNTSSSGLFSGNIWSNLSSWMPQRETSSQPTQDSRFPGRGRtlsssqspvhvdsnLQARLldnsspenrsHMIVTetgdrlsdeRQPALGTAVAVDRVPAGQQGAVVSDEEIQKLVSMGFDKTQVEVALAAADGDLNVAVEILSQQG
MLALVPLGSELERIMGSVRMFYITILLATSNailhlliallvahiPFYRLQNVMDECAIGFSGVIFSLIVIETSLSGAQSRSVFGLFNIPAKWYPLILLVLFQVLMTNVSLLGHLCGILSGFAYTYGFFNLLMPGTSFYSAIESSSLLSTCIRQPKFILCTGGNPSGYIPTYSGQNTSSSGLFSGNIWSNLSSWMPQRETSSQPTQDSRFPGRGRTLSSSQSPVHVDSNLQARLLDNSSPENRSHMIVTETGDRLSDERQPALGTAVAVDRVPAGQQGAVVSDEEIQKLVSMGFDKTQVEVALAAADGDLNVAVEILSQQG
******LGSELERIMGSVRMFYITILLATSNAILHLLIALLVAHIPFYRLQNVMDECAIGFSGVIFSLIVIETSLSGAQSRSVFGLFNIPAKWYPLILLVLFQVLMTNVSLLGHLCGILSGFAYTYGFFNLLMPGTSFYSAIESSSLLSTCIRQPKFILCTGGNPSGYIPTYS********LFSGNIWSN*****************************************************************************************VVSDEEIQKLVSMGFDKTQVEVALAAADGDLNVAVEI*****
MLALVPLGSELERIMGSVRMFYITILLATSNAILHLLIALLVAHIPFYRLQNVMDECAIGFSGVIFSLIVIETSLSGAQSRSVFGLFNIPAKWYPLILLVLFQVLMTNVSLLGHLCGILSGFAYTYGFFNLLMPGTSFYSAIESSSLLSTCIRQPKFILC*******************************************************************************************************************************KLVSMGFDKTQVEVALAAADGDLNVAVEILSQQ*
MLALVPLGSELERIMGSVRMFYITILLATSNAILHLLIALLVAHIPFYRLQNVMDECAIGFSGVIFSLIVIETSLSGAQSRSVFGLFNIPAKWYPLILLVLFQVLMTNVSLLGHLCGILSGFAYTYGFFNLLMPGTSFYSAIESSSLLSTCIRQPKFILCTGGNPSGYIPTYSGQNTSSSGLFSGNIWSNLSSWM*****************************HVDSNLQARLLDNSSPENRSHMIVTETGDRLSDERQPALGTAVAVDRVPAGQQGAVVSDEEIQKLVSMGFDKTQVEVALAAADGDLNVAVEILSQQG
*LALVPLGSELERIMGSVRMFYITILLATSNAILHLLIALLVAHIPFYRLQNVMDECAIGFSGVIFSLIVIETSLSGAQSRSVFGLFNIPAKWYPLILLVLFQVLMTNVSLLGHLCGILSGFAYTYGFFNLLMPGTSFYSAIESSSLLSTCIRQPKFILCTGGNPSGYIPTYSGQNTSSSGLFSGNIWSNLSSW***************************************************************************************SDEEIQKLVSMGFDKTQVEVALAAADGDLNVAVEILSQQ*
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLALVPLGSELERIMGSVRMFYITILLATSNAILHLLIALLVAHIPFYRLQNVMDECAIGFSGVIFSLIVIETSLSGAQSRSVFGLFNIPAKWYPLILLVLFQVLMTNVSLLGHLCGILSGFAYTYGFFNLLMPGTSFYSAIESSSLLSTCIRQPKFILCTGGNPSGYIPTYSGQNTSSSGLFSGNIWSNLSSWMPQRETSSQPTQDSRFPGRGRTLSSSQSPVHVDSNLQARLLDNSSPENRSHMIVTETGDRLSDERQPALGTAVAVDRVPAGQQGAVVSDEEIQKLVSMGFDKTQVEVALAAADGDLNVAVEILSQQG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query321 2.2.26 [Sep-21-2011]
Q8LB17403 Uncharacterized protein A yes no 0.978 0.779 0.638 1e-118
Q8TEB9315 Rhomboid-related protein yes no 0.404 0.412 0.300 1e-08
Q8BHC7315 Rhomboid-related protein yes no 0.404 0.412 0.293 8e-08
Q5RBS4318 Rhomboid-related protein yes no 0.420 0.424 0.289 1e-07
Q4V8F3316 Rhomboid-related protein yes no 0.548 0.556 0.263 1e-06
Q8RXW0334 Uncharacterized protein A no no 0.373 0.359 0.352 2e-06
Q6CDV6297 Rhomboid protein 2 OS=Yar yes no 0.392 0.424 0.278 4e-05
Q4I4A4267 Rhomboid protein 2 OS=Gib yes no 0.289 0.348 0.329 0.0001
O74926251 Rhomboid protein 2 OS=Sch yes no 0.355 0.454 0.28 0.0007
>sp|Q8LB17|Y3846_ARATH Uncharacterized protein At3g58460 OS=Arabidopsis thaliana GN=At3g58460 PE=1 SV=2 Back     alignment and function desciption
 Score =  426 bits (1094), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 207/324 (63%), Positives = 259/324 (79%), Gaps = 10/324 (3%)

Query: 1   MLALVPLGSELERIMGSVRMFYITILLATSNAILHLLIALLVAHIPFYRLQNVMDECAIG 60
           M+ALVP+GSELERIMGSVR+ Y+T+LLAT+NA+LHLLIA L  + PFY+  ++M+ECAIG
Sbjct: 84  MMALVPMGSELERIMGSVRLLYLTVLLATTNAVLHLLIASLAGYNPFYQYDHLMNECAIG 143

Query: 61  FSGVIFSLIVIETSLSGAQSRSVFGLFNIPAKWYPLILLVLFQVLMTNVSLLGHLCGILS 120
           FSG++FS+IVIETSLSG  SRSVFGLFN+PAK YP ILL++FQ+LMTNVSLLGHLCGILS
Sbjct: 144 FSGILFSMIVIETSLSGVTSRSVFGLFNVPAKLYPWILLIVFQLLMTNVSLLGHLCGILS 203

Query: 121 GFAYTYGFFNLLMPGTSFYSAIESSSLLSTCIRQPKFILCTGGNPSGYIPTYSGQNTSSS 180
           GF+Y+YG FN LMPG+SF++ IES+S +S+ IR+PKFI+CTGGNPS YIPTYS QNT+SS
Sbjct: 204 GFSYSYGLFNFLMPGSSFFTTIESASWMSSFIRRPKFIMCTGGNPSSYIPTYSAQNTTSS 263

Query: 181 GLFSGNIWSNLSSWMPQRETSSQPTQDSRFPGRGRTLSSSQSPV----HVDSNLQARLLD 236
           G  +GN W +LSSW+PQRE S+Q ++DSRFPGRGRTLS+++ P       D NL ARLL+
Sbjct: 264 GFSTGNAWRSLSSWLPQREASNQSSEDSRFPGRGRTLSTARDPTAPAGETDPNLHARLLE 323

Query: 237 NSSPENRSHMIVTETGDRLSDERQPALGTAVAVDRVPAGQQGAVVSDEEIQKLVSMGFDK 296
           +SS  +R   +   T + ++D RQ  +  A     +P  Q     S+E+IQKLV+MGFD+
Sbjct: 324 DSSSPDR---LSDATVNTVADSRQAPIANAAV---LPQSQGRVAASEEQIQKLVAMGFDR 377

Query: 297 TQVEVALAAADGDLNVAVEILSQQ 320
           TQVEVALAAAD DL VAVEIL  Q
Sbjct: 378 TQVEVALAAADDDLTVAVEILMSQ 401

Arabidopsis thaliana (taxid: 3702)
>sp|Q8TEB9|RHBL4_HUMAN Rhomboid-related protein 4 OS=Homo sapiens GN=RHBDD1 PE=1 SV=1 Back     alignment and function description
>sp|Q8BHC7|RHBL4_MOUSE Rhomboid-related protein 4 OS=Mus musculus GN=Rhbdd1 PE=1 SV=1 Back     alignment and function description
>sp|Q5RBS4|RHBL4_PONAB Rhomboid-related protein 4 OS=Pongo abelii GN=RHBDD1 PE=2 SV=1 Back     alignment and function description
>sp|Q4V8F3|RHBL4_RAT Rhomboid-related protein 4 OS=Rattus norvegicus GN=Rhbdd1 PE=2 SV=1 Back     alignment and function description
>sp|Q8RXW0|Y3761_ARATH Uncharacterized protein At3g17611 OS=Arabidopsis thaliana GN=At3g17611 PE=2 SV=1 Back     alignment and function description
>sp|Q6CDV6|RBD2_YARLI Rhomboid protein 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RBD2 PE=3 SV=1 Back     alignment and function description
>sp|Q4I4A4|RBD2_GIBZE Rhomboid protein 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RBD2 PE=3 SV=1 Back     alignment and function description
>sp|O74926|RBD2_SCHPO Rhomboid protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rbd2 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query321
359481109406 PREDICTED: uncharacterized protein At3g5 1.0 0.790 0.721 1e-130
224091513410 predicted protein [Populus trichocarpa] 1.0 0.782 0.721 1e-128
255581586397 Rhomboid protein, putative [Ricinus comm 0.953 0.770 0.719 1e-123
356505467414 PREDICTED: uncharacterized protein At3g5 0.996 0.772 0.702 1e-118
21593075403 unknown [Arabidopsis thaliana] 0.978 0.779 0.641 1e-117
358348102403 hypothetical protein MTR_118s0012 [Medic 0.975 0.776 0.676 1e-117
334186083 426 rhomboid-like protein 15 [Arabidopsis th 0.978 0.737 0.638 1e-117
449459580397 PREDICTED: uncharacterized protein At3g5 0.953 0.770 0.671 1e-117
18410961403 rhomboid-like protein 15 [Arabidopsis th 0.978 0.779 0.638 1e-116
356570925415 PREDICTED: LOW QUALITY PROTEIN: uncharac 1.0 0.773 0.693 1e-116
>gi|359481109|ref|XP_002267146.2| PREDICTED: uncharacterized protein At3g58460-like [Vitis vinifera] gi|296089310|emb|CBI39082.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  469 bits (1207), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 233/323 (72%), Positives = 274/323 (84%), Gaps = 2/323 (0%)

Query: 1   MLALVPLGSELERIMGSVRMFYITILLATSNAILHLLIALLVAHIPFYRLQNVMDECAIG 60
           M+ALVPLGSELERIMGSVR+FY+ +LLATSNAI H+LIA LVA+ PFY    +M+ECAIG
Sbjct: 84  MMALVPLGSELERIMGSVRLFYMIVLLATSNAIFHVLIASLVAYNPFYSYHYLMNECAIG 143

Query: 61  FSGVIFSLIVIETSLSGAQSRSVFGLFNIPAKWYPLILLVLFQVLMTNVSLLGHLCGILS 120
           FSG++FS+IVIETSLSGAQ+RSVFGLFN+PAKWY  ILLV+FQ+LMTNVSLLGHLCGILS
Sbjct: 144 FSGILFSMIVIETSLSGAQTRSVFGLFNVPAKWYAWILLVVFQLLMTNVSLLGHLCGILS 203

Query: 121 GFAYTYGFFNLLMPGTSFYSAIESSSLLSTCIRQPKFILCTGGNPSGYIPTYSGQNTSSS 180
           GFAYTYG FN L+PGTSFYSAIESSSLLS+C+R+PKFILCTGGNP  YIPT+S  NTS S
Sbjct: 204 GFAYTYGLFNFLIPGTSFYSAIESSSLLSSCVRRPKFILCTGGNPQAYIPTHSSSNTSPS 263

Query: 181 GLFSGNIWSNLSSWMPQRETSSQPTQD-SRFPGRGRTLSSSQSPVH-VDSNLQARLLDNS 238
           GL SGNIW NLSSWMPQR  S+Q TQ+ SRFPGRGRTLSSS+S     DS L+ARLLDNS
Sbjct: 264 GLISGNIWRNLSSWMPQRGMSTQATQESSRFPGRGRTLSSSRSQTTPSDSTLEARLLDNS 323

Query: 239 SPENRSHMIVTETGDRLSDERQPALGTAVAVDRVPAGQQGAVVSDEEIQKLVSMGFDKTQ 298
           + ++   +    T  ++ DER+ ++ +A AV R  A  Q ++VS+E+IQKLVSMGF++TQ
Sbjct: 324 NLDHSLDVAANTTQQQVLDERRSSVDSAAAVARGNAHDQDSLVSEEDIQKLVSMGFERTQ 383

Query: 299 VEVALAAADGDLNVAVEILSQQG 321
           VEVALAAADGDLN+AVEILSQQG
Sbjct: 384 VEVALAAADGDLNIAVEILSQQG 406

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224091513|ref|XP_002309277.1| predicted protein [Populus trichocarpa] gi|222855253|gb|EEE92800.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255581586|ref|XP_002531598.1| Rhomboid protein, putative [Ricinus communis] gi|223528794|gb|EEF30801.1| Rhomboid protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356505467|ref|XP_003521512.1| PREDICTED: uncharacterized protein At3g58460-like [Glycine max] Back     alignment and taxonomy information
>gi|21593075|gb|AAM65024.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|358348102|ref|XP_003638088.1| hypothetical protein MTR_118s0012 [Medicago truncatula] gi|355504023|gb|AES85226.1| hypothetical protein MTR_118s0012 [Medicago truncatula] Back     alignment and taxonomy information
>gi|334186083|ref|NP_001190126.1| rhomboid-like protein 15 [Arabidopsis thaliana] gi|332646264|gb|AEE79785.1| rhomboid-like protein 15 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449459580|ref|XP_004147524.1| PREDICTED: uncharacterized protein At3g58460-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|18410961|ref|NP_567064.1| rhomboid-like protein 15 [Arabidopsis thaliana] gi|73921121|sp|Q8LB17.2|Y3846_ARATH RecName: Full=Uncharacterized protein At3g58460 gi|22531096|gb|AAM97052.1| putative protein [Arabidopsis thaliana] gi|23197956|gb|AAN15505.1| putative protein [Arabidopsis thaliana] gi|332646263|gb|AEE79784.1| rhomboid-like protein 15 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356570925|ref|XP_003553633.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At3g58460-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query321
DICTYBASE|DDB_G0281359343 DDB_G0281359 [Dictyostelium di 0.585 0.548 0.304 4.9e-12
DICTYBASE|DDB_G0349377458 DDB_G0349377 [Dictyostelium di 0.311 0.218 0.343 2.6e-08
TAIR|locus:1005716534334 RBL14 "RHOMBOID-like protein 1 0.373 0.359 0.328 7.1e-07
UNIPROTKB|E1BT32239 RHBDD1 "Uncharacterized protei 0.395 0.531 0.301 1.3e-06
TAIR|locus:2097473269 RBL13 "RHOMBOID-like protein 1 0.252 0.301 0.317 6.8e-06
UNIPROTKB|Q8TEB9315 RHBDD1 "Rhomboid-related prote 0.404 0.412 0.278 1.9e-05
ZFIN|ZDB-GENE-050417-85335 rhbdd1 "rhomboid domain contai 0.239 0.229 0.371 2.2e-05
UNIPROTKB|E2R6X6316 RHBDD1 "Uncharacterized protei 0.395 0.401 0.301 3.3e-05
UNIPROTKB|E2RD89316 RHBDD1 "Uncharacterized protei 0.395 0.401 0.301 3.3e-05
UNIPROTKB|Q08DF5267 RHBDD1 "Rhomboid domain contai 0.404 0.486 0.270 3.7e-05
DICTYBASE|DDB_G0281359 DDB_G0281359 [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
 Score = 183 (69.5 bits), Expect = 4.9e-12, P = 4.9e-12
 Identities = 66/217 (30%), Positives = 104/217 (47%)

Query:     1 MLALVPLGSELERI-MGSVRMFYITILLATSNXXXXXXXXXXXXXXPFYRLQNVMDECAI 59
             M+  + L ++LER+  G+++ FY+  L                    F    NV   C +
Sbjct:   101 MITFLDL-AKLERLTFGTLKYFYLLFLFGIITNLICLFIY-------FIGRNNV---CHL 149

Query:    60 GFSGVIFSLIVIETSLSGAQSRSVFGLFN---IPAKWYPLILLVLFQVLMTNVSLLGHLC 116
             GFSGV+F+LI IE++ SG   R VF LFN   IP+K YP  +L+L  V +   S +GH  
Sbjct:   150 GFSGVLFALIYIESNSSG---RDVF-LFNAVKIPSKLYPWAMLILAHVFVPRSSFIGHFS 205

Query:   117 GILSGFAYTYGFFNLLMPGTSFYSAIESSSLLSTCIRQPKF--ILCTGGNPSGYIPTYSG 174
             GI+ G  +  G+ ++ +      S IESS L++    +  +  I+  GG+      +Y+ 
Sbjct:   206 GIVVGILFIKGYLDIFILSNQKLSEIESSQLMNIFTTKNSYFPIIKFGGSRR----SYNT 261

Query:   175 QNTSSSGLFSGNIWSNLSSWMPQRETSSQPTQDSRFP 211
                S  GLF      NL +  PQ++   Q  +  + P
Sbjct:   262 DRKSLDGLFFE--LKNLFN--PQQQQQRQQQRQQQQP 294
GO:0016021 "integral to membrane" evidence=IEA
GO:0004252 "serine-type endopeptidase activity" evidence=IEA
DICTYBASE|DDB_G0349377 DDB_G0349377 [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:1005716534 RBL14 "RHOMBOID-like protein 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E1BT32 RHBDD1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
TAIR|locus:2097473 RBL13 "RHOMBOID-like protein 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TEB9 RHBDD1 "Rhomboid-related protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050417-85 rhbdd1 "rhomboid domain containing 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2R6X6 RHBDD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2RD89 RHBDD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q08DF5 RHBDD1 "Rhomboid domain containing 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8LB17Y3846_ARATHNo assigned EC number0.63880.97810.7791yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query321
pfam01694146 pfam01694, Rhomboid, Rhomboid family 9e-15
pfam0062737 pfam00627, UBA, UBA/TS-N domain 3e-07
cd0019438 cd00194, UBA, Ubiquitin Associated domain 1e-06
COG0705228 COG0705, COG0705, Membrane associated serine prote 1e-06
smart0016537 smart00165, UBA, Ubiquitin associated domain 7e-06
>gnl|CDD|216649 pfam01694, Rhomboid, Rhomboid family Back     alignment and domain information 
 Score = 69.9 bits (172), Expect = 9e-15
 Identities = 32/132 (24%), Positives = 52/132 (39%), Gaps = 19/132 (14%)

Query: 1   MLALVPLGSELERIMGSVRMFYITILLATSNAILHLLIALLVAHIPFYRLQNVMDECAIG 60
           MLAL+  G  LERI+GSVR   + +L   + ++L  L +                  ++G
Sbjct: 27  MLALLFFGIPLERILGSVRFLLLYLLSGLAGSLLSYLFSPAS-------------SPSVG 73

Query: 61  FSGVIFSLIVIETSLSG---AQSRSVFGLFNIPAKWYPLILLVLFQVLMTNVSLLGHLCG 117
            SG IF L+     L         +  G   +      L LL+     +  +S   HL G
Sbjct: 74  ASGAIFGLLGALLVLLPRNRILLFNFPGALLLLLGIILLNLLL---GFLPGISNFAHLGG 130

Query: 118 ILSGFAYTYGFF 129
           +++G    +   
Sbjct: 131 LIAGLLLGFLLL 142

This family contains integral membrane proteins that are related to Drosophila rhomboid protein. Members of this family are found in bacteria and eukaryotes. Rhomboid promotes the cleavage of the membrane-anchored TGF-alpha-like growth factor Spitz, allowing it to activate the Drosophila EGF receptor. Analysis has shown that Rhomboid-1 is an intramembrane serine protease (EC:3.4.21.105). Parasite-encoded rhomboid enzymes are also important for invasion of host cells by Toxoplasma and the malaria parasite. Length = 146
>gnl|CDD|201355 pfam00627, UBA, UBA/TS-N domain Back     alignment and domain information
>gnl|CDD|238116 cd00194, UBA, Ubiquitin Associated domain Back     alignment and domain information
>gnl|CDD|223777 COG0705, COG0705, Membrane associated serine protease [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|197551 smart00165, UBA, Ubiquitin associated domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 321
KOG2632258 consensus Rhomboid family proteins [Function unkno 99.91
PTZ00101278 rhomboid-1 protease; Provisional 99.41
COG0705228 Membrane associated serine protease [Amino acid tr 99.39
PRK10907276 intramembrane serine protease GlpG; Provisional 99.34
PF01694145 Rhomboid: Rhomboid family; InterPro: IPR022764 In 99.33
PF0062737 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma 99.24
smart0016537 UBA Ubiquitin associated domain. Present in Rad23, 99.1
cd0019438 UBA Ubiquitin Associated domain. The UBA domain is 99.06
KOG2289316 consensus Rhomboid family proteins [Signal transdu 98.63
TIGR00601 378 rad23 UV excision repair protein Rad23. All protei 98.4
KOG0011 340 consensus Nucleotide excision repair factor NEF2, 97.95
PF04511197 DER1: Der1-like family; InterPro: IPR007599 The en 97.88
KOG0944763 consensus Ubiquitin-specific protease UBP14 [Postt 97.79
TIGR00601378 rad23 UV excision repair protein Rad23. All protei 97.74
KOG2290652 consensus Rhomboid family proteins [Signal transdu 97.57
KOG0011340 consensus Nucleotide excision repair factor NEF2, 97.51
KOG0418200 consensus Ubiquitin-protein ligase [Posttranslatio 97.49
PF1455543 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 96.93
KOG2561 568 consensus Adaptor protein NUB1, contains UBA domai 96.76
KOG0858239 consensus Predicted membrane protein [Function unk 96.71
PF0284542 CUE: CUE domain; InterPro: IPR003892 This domain m 96.56
COG5207749 UBP14 Isopeptidase T [Posttranslational modificati 96.56
PF0855199 DUF1751: Eukaryotic integral membrane protein (DUF 96.42
smart0054643 CUE Domain that may be involved in binding ubiquit 96.15
PRK06369115 nac nascent polypeptide-associated complex protein 95.91
COG5207 749 UBP14 Isopeptidase T [Posttranslational modificati 95.7
KOG2561568 consensus Adaptor protein NUB1, contains UBA domai 95.64
TIGR00264116 alpha-NAC-related protein. This hypothetical prote 95.47
KOG0944 763 consensus Ubiquitin-specific protease UBP14 [Postt 95.41
PF0928855 UBA_3: Fungal ubiquitin-associated domain ; InterP 95.41
KOG2890326 consensus Predicted membrane protein [Function unk 95.08
COG1308122 EGD2 Transcription factor homologous to NACalpha-B 94.25
COG5291313 Predicted membrane protein [Function unknown] 93.91
KOG2980310 consensus Integral membrane protease of the rhombo 93.13
KOG0010493 consensus Ubiquitin-like protein [Posttranslationa 93.04
COG4008153 Predicted metal-binding transcription factor [Tran 90.15
PF1162687 Rap1_C: TRF2-interacting telomeric protein/Rap1 - 88.55
PF1154753 E3_UbLigase_EDD: E3 ubiquitin ligase EDD; InterPro 88.22
smart0080463 TAP_C C-terminal domain of vertebrate Tap protein. 87.92
PF0064130 zf-RanBP: Zn-finger in Ran binding protein and oth 87.4
PF0394351 TAP_C: TAP C-terminal domain; InterPro: IPR005637 86.92
PF0697260 DUF1296: Protein of unknown function (DUF1296); In 85.32
KOG1071 340 consensus Mitochondrial translation elongation fac 84.27
KOG4463323 consensus Uncharacterized conserved protein [Funct 80.24
PF0749947 RuvA_C: RuvA, C-terminal domain; InterPro: IPR0111 80.1
>KOG2632 consensus Rhomboid family proteins [Function unknown] Back     alignment and domain information 
Probab=99.91  E-value=1.7e-24  Score=200.06  Aligned_cols=138  Identities=46%  Similarity=0.743  Sum_probs=127.8

Q ss_pred             CeeehhhhHHHHHhhC-hHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhcccccCCccccCChHHHHHHHHHHHHHhcCCc
Q 020822            1 MLALVPLGSELERIMG-SVRMFYITILLATSNAILHLLIALLVAHIPFYRLQNVMDECAIGFSGVIFSLIVIETSLSGAQ   79 (321)
Q Consensus         1 MlaL~~~G~~lEr~~G-T~~fl~lyll~~i~~glly~ll~~l~~~~~~~~~~~~~~~~~vGaSGaIFaLl~~~~~~~p~~   79 (321)
                      |++|+++|..+||.+| |.+++.++.+.++++|++|+++++++.     .++.+++++++|+||+.||+++..+...|.+
T Consensus        73 mlaL~~~g~~fE~~~G~t~~~l~~~~llalf~gIl~ll~~~~~~-----~~d~~~~~~a~G~s~v~Fam~~~~~~~sp~r  147 (258)
T KOG2632|consen   73 MLALWPLGSQFERTHGTTVRILMFTVLLALFSGILYLLAYHVFL-----LSDLVYVEGAIGFSGVLFAMMAVLEVQSPVR  147 (258)
T ss_pred             HHHHHhchhHHHhhccceehHHHHHHHHHHHHHHHHHHHHHHHh-----hcchhhhcccccccHHHHHHHHHHhhcCccc
Confidence            7899999999999999 999999999999999999999998542     3334567889999999999999998888888


Q ss_pred             cccccccccchhHHHHHHHHHHHHHhcchhHHHHHHHHHHHHHHHHHHhhhhcCCchhhHHHhhh
Q 020822           80 SRSVFGLFNIPAKWYPLILLVLFQVLMTNVSLLGHLCGILSGFAYTYGFFNLLMPGTSFYSAIES  144 (321)
Q Consensus        80 ~~~l~G~~~IP~~~~p~ilLil~~ll~p~~S~lgHL~Gil~G~ly~~g~l~~l~p~~~~~~~iE~  144 (321)
                      .+++||.+.||+++.||++++.+++++|+.||+||+||+++||.|.++.+ +++|..+.++.+|.
T Consensus       148 ~~~~fg~~siP~~l~Pw~lLi~~~~lvp~aSFlghl~GllvG~ay~~~~f-~lip~~~~~~~v~~  211 (258)
T KOG2632|consen  148 SRSVFGLFSIPIVLAPWALLIATQILVPQASFLGHLCGLLVGYAYAFSSF-GLIPGIRNYRAVTE  211 (258)
T ss_pred             chhhcccccccHHHHHHHHHHHHHHHccCchHHHHHHHHHHHHHHHHHhh-ccCCcchhHHHhhh
Confidence            88899999999999999999999999999999999999999999999988 99999999999996

>PTZ00101 rhomboid-1 protease; Provisional Back     alignment and domain information
>COG0705 Membrane associated serine protease [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10907 intramembrane serine protease GlpG; Provisional Back     alignment and domain information
>PF01694 Rhomboid: Rhomboid family; InterPro: IPR022764 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] Back     alignment and domain information
>smart00165 UBA Ubiquitin associated domain Back     alignment and domain information
>cd00194 UBA Ubiquitin Associated domain Back     alignment and domain information
>KOG2289 consensus Rhomboid family proteins [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair] Back     alignment and domain information
>PF04511 DER1: Der1-like family; InterPro: IPR007599 The endoplasmic reticulum (ER) of the yeast Saccharomyces cerevisiae (Baker's yeast) contains a proteolytic system able to selectively degrade misfolded lumenal secretory proteins Back     alignment and domain information
>KOG0944 consensus Ubiquitin-specific protease UBP14 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>KOG2290 consensus Rhomboid family proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair] Back     alignment and domain information
>KOG0418 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0858 consensus Predicted membrane protein [Function unknown] Back     alignment and domain information
>PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08551 DUF1751: Eukaryotic integral membrane protein (DUF1751); InterPro: IPR013861 This entry is found in eukaryotic integral membrane proteins Back     alignment and domain information
>smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>PRK06369 nac nascent polypeptide-associated complex protein; Reviewed Back     alignment and domain information
>COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00264 alpha-NAC-related protein Back     alignment and domain information
>KOG0944 consensus Ubiquitin-specific protease UBP14 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09288 UBA_3: Fungal ubiquitin-associated domain ; InterPro: IPR015368 This C-terminal domain is found in ubiquitin binding proteins, it adopts a structure consisting of a three alpha-helix bundle Back     alignment and domain information
>KOG2890 consensus Predicted membrane protein [Function unknown] Back     alignment and domain information
>COG1308 EGD2 Transcription factor homologous to NACalpha-BTF3 [Transcription] Back     alignment and domain information
>COG5291 Predicted membrane protein [Function unknown] Back     alignment and domain information
>KOG2980 consensus Integral membrane protease of the rhomboid family involved in different forms of regulated intramembrane proteolysis [Signal transduction mechanisms] Back     alignment and domain information
>KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>COG4008 Predicted metal-binding transcription factor [Transcription] Back     alignment and domain information
>PF11626 Rap1_C: TRF2-interacting telomeric protein/Rap1 - C terminal domain; InterPro: IPR021661 This family of proteins represents the C-terminal domain of the protein Rap-1, which plays a distinct role in silencing at the silent mating-type loci and telomeres [] Back     alignment and domain information
>PF11547 E3_UbLigase_EDD: E3 ubiquitin ligase EDD; InterPro: IPR024725 EDD, the ER ubiquitin ligase from the HECT ligases, contains an N-terminal ubiquitin-associated (UBA) domain which binds ubiquitin Back     alignment and domain information
>smart00804 TAP_C C-terminal domain of vertebrate Tap protein Back     alignment and domain information
>PF00641 zf-RanBP: Zn-finger in Ran binding protein and others; InterPro: IPR001876 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF03943 TAP_C: TAP C-terminal domain; InterPro: IPR005637 This entry contains the NXF family of shuttling transport receptors for nuclear export of mRNA, which include: vertebrate mRNA export factor TAP or nuclear RNA export factor 1 (NXF1) Back     alignment and domain information
>PF06972 DUF1296: Protein of unknown function (DUF1296); InterPro: IPR009719 This family represents a conserved region approximately 60 residues long within a number of plant proteins of unknown function Back     alignment and domain information
>KOG1071 consensus Mitochondrial translation elongation factor EF-Tsmt, catalyzes nucleotide exchange on EF-Tumt [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4463 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07499 RuvA_C: RuvA, C-terminal domain; InterPro: IPR011114 In prokaryotes, RuvA, RuvB, and RuvC process the universal DNA intermediate of homologous recombination, termed Holliday junction Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query321
1vg5_A73 Solution Structure Of Rsgi Ruh-014, A Uba Domain Fr 7e-11
>pdb|1VG5|A Chain A, Solution Structure Of Rsgi Ruh-014, A Uba Domain From Arabidopsis Cdna Length = 73 Back     alignment and structure 
Iteration: 1

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 35/51 (68%), Positives = 40/51 (78%), Gaps = 1/51 (1%)
Query: 272 VPAGQQGAVVSDEEIQKLVSMGFDKTQVEVALAAADGDLNVAVEIL-SQQG 321
           +P  Q     S+E+IQKLV+MGFD+TQVEVALAAAD DL VAVEIL SQ G
Sbjct: 19  LPQSQGRVAASEEQIQKLVAMGFDRTQVEVALAAADDDLTVAVEILMSQSG 69

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query321
1vg5_A73 RSGI RUH-014, rhomboid family protein; UBA domain, 2e-13
2xov_A181 Rhomboid protease GLPG; membrane protein, hydrolas 1e-07
1wiv_A73 UBP14, ubiquitin-specific protease 14; ubiquitin a 2e-07
2dak_A63 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 2e-07
2nr9_A196 Protein GLPG homolog; intramembrane peptidase, rho 4e-07
1ify_A49 HHR23A, UV excision repair protein RAD23 homolog A 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
1oqy_A368 HHR23A, UV excision repair protein RAD23 homolog A 9e-05
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 1e-04
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 2e-04
3ihp_A854 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 2e-04
3e46_A253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 2e-04
2pwq_A216 Ubiquitin conjugating enzyme; structural genomics 7e-04
1z96_A40 DNA-damage, UBA-domain protein MUD1; ubiquitin, th 9e-04
>1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Length = 73 Back     alignment and structure
 Score = 63.7 bits (154), Expect = 2e-13
 Identities = 33/49 (67%), Positives = 38/49 (77%)

Query: 272 VPAGQQGAVVSDEEIQKLVSMGFDKTQVEVALAAADGDLNVAVEILSQQ 320
           +P  Q     S+E+IQKLV+MGFD+TQVEVALAAAD DL VAVEIL  Q
Sbjct: 19  LPQSQGRVAASEEQIQKLVAMGFDRTQVEVALAAADDDLTVAVEILMSQ 67
>2xov_A Rhomboid protease GLPG; membrane protein, hydrolase, intramembrane protease; HET: BNG; 1.65A {Escherichia coli} PDB: 2ic8_A* 2nrf_A 2xtu_A* 2irv_A* 3b45_A* 2o7l_A* 2xow_A* 3txt_A* 2xtv_A* 3b44_A* Length = 181 Back     alignment and structure
>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Length = 73 Back     alignment and structure
>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>2nr9_A Protein GLPG homolog; intramembrane peptidase, rhomboid protease, membrane protein; HET: PA6 PQE; 2.20A {Haemophilus influenzae} SCOP: f.51.1.1 PDB: 3odj_A Length = 196 Back     alignment and structure
>1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 Length = 49 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Length = 368 Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Length = 118 Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Length = 201 Back     alignment and structure
>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Length = 854 Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Length = 253 Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Length = 216 Back     alignment and structure
>1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 Length = 40 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query321
1vg5_A73 RSGI RUH-014, rhomboid family protein; UBA domain, 99.56
2xov_A181 Rhomboid protease GLPG; membrane protein, hydrolas 99.47
2nr9_A196 Protein GLPG homolog; intramembrane peptidase, rho 99.45
2g3q_A43 Protein YBL047C; endocytosis, solution structure, 99.31
1ify_A49 HHR23A, UV excision repair protein RAD23 homolog A 99.29
1veg_A83 NEDD8 ultimate buster-1; ubiquitin associated doma 99.28
2jy5_A52 Ubiquilin-1; UBA, alternative splicing, cytoplasm, 99.24
1wji_A63 Tudor domain containing protein 3; UBA domain, str 99.23
1wiv_A73 UBP14, ubiquitin-specific protease 14; ubiquitin a 99.23
2knz_A53 Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc 99.22
1z96_A40 DNA-damage, UBA-domain protein MUD1; ubiquitin, th 99.2
2dak_A63 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 99.15
2dai_A83 Ubadc1, ubiquitin associated domain containing 1; 99.15
1wgn_A63 UBAP1, ubiquitin associated protein; ubiquitin ass 99.14
2bwb_A46 Ubiquitin-like protein DSK2; UBA, signaling protei 99.14
1vej_A74 Riken cDNA 4931431F19; UBA domain, three helix bun 99.14
2ekk_A47 UBA domain from E3 ubiquitin-protein ligase HUWE1; 99.11
1dv0_A47 DNA repair protein HHR23A; helical bundle, DNA bin 99.08
2dag_A74 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 99.08
2cpw_A64 CBL-interacting protein STS-1 variant; ubiquitin a 99.07
1wr1_B58 Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu 99.07
1whc_A64 RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain 99.06
2dah_A54 Ubiquilin-3; UBA domain, structural genomics, NPPS 99.05
2ooa_A52 E3 ubiquitin-protein ligase CBL-B; alpha-helical d 99.01
2crn_A64 Ubash3A protein; compact three-helix bundle, struc 98.98
2dkl_A85 Trinucleotide repeat containing 6C protein; TNRC6C 98.95
1vek_A84 UBP14, ubiquitin-specific protease 14, putative; U 98.92
2d9s_A53 CBL E3 ubiquitin protein ligase; UBA domain, dimer 98.91
2cwb_A108 Chimera of immunoglobulin G binding protein G and 98.82
2juj_A56 E3 ubiquitin-protein ligase CBL; alpha helix, UBA 98.82
2dna_A67 Unnamed protein product; ubiquitin associated doma 98.82
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 98.74
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 98.74
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 98.7
1wj7_A104 Hypothetical protein (RSGI RUH-015); UBA domain, u 98.68
2oo9_A46 E3 ubiquitin-protein ligase CBL; alpha-helical dom 98.62
2cp8_A54 NEXT to BRCA1 gene 1 protein; UBA domain, structur 98.51
2qsf_X171 RAD23, UV excision repair protein RAD23; alpha-bet 98.48
3e46_A253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 98.47
1oqy_A 368 HHR23A, UV excision repair protein RAD23 homolog A 98.37
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 98.37
2cos_A54 Serine/threonine protein kinase LATS2; UBA domain, 98.33
1oqy_A368 HHR23A, UV excision repair protein RAD23 homolog A 98.22
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 98.16
2pwq_A216 Ubiquitin conjugating enzyme; structural genomics 97.7
2cp9_A64 EF-TS, EF-TSMT, elongation factor TS, mitochondria 97.18
1otr_A49 Protein CUE2; protein-protein complex, cell cycle; 97.01
1wgl_A59 TOLL-interacting protein; CUE domain, structural g 96.91
3ihp_A854 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 96.9
1tte_A215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 96.89
2dhy_A67 CUE domain-containing protein 1; structural genomi 96.54
1q02_A52 Sequestosome 1; helical bundle, protein binding; N 96.46
1v92_A46 NSFL1 cofactor P47; 3-helix bundle, recombination; 96.43
3e21_A45 HFAF1, FAS-associated factor 1; UBA, alternative s 96.12
2d9g_A53 YY1-associated factor 2; ZF-ranbp domain, structur 96.1
2dal_A62 Protein KIAA0794; FAS associted factor 1, UBA-like 96.0
1tr8_A102 Conserved protein (MTH177); chaperones, nascent po 95.92
2dam_A67 ETEA protein; KIAA0887, UBA-like domain, structura 95.69
2crc_A52 Ubiquitin conjugating enzyme 7 interacting protein 95.41
2dzl_A66 Protein FAM100B; UBA-like domain, structural genom 93.95
1nj3_A31 NPL4; NZF domain, rubredoxin knuckle, beta-ribbon, 93.53
4dbg_B162 Ring finger protein 31; ubiquitin fold, ubiquitina 93.23
3a9j_C34 Mitogen-activated protein kinase kinase kinase 7- 92.74
3ihp_A 854 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 92.66
2di0_A71 Activating signal cointegrator 1 complex subunit 2 88.27
3b08_B64 Ranbp-type and C3HC4-type zinc finger-containing; 87.78
2qho_B53 E3 ubiquitin-protein ligase EDD1; protein-protein 87.36
2jp7_A57 MRNA export factor MEX67; solution MEX67, UBA, tra 85.26
1oai_A59 Nuclear RNA export factor; nuclear transport, nucl 84.91
2ebq_A47 Nuclear pore complex protein NUP153; ZF-ranbp doma 81.44
>1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
Probab=99.56  E-value=6.8e-15  Score=111.80  Aligned_cols=61  Identities=61%  Similarity=0.799  Sum_probs=51.9

Q ss_pred             cCCCccccccccccCCCCCCCCCCCCHHHHHHHHhcCCCHHHHHHHHHHhCCCHHHHHHHh-hcc
Q 020822          257 DERQPALGTAVAVDRVPAGQQGAVVSDEEIQKLVSMGFDKTQVEVALAAADGDLNVAVEIL-SQQ  320 (321)
Q Consensus       257 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~L~~MGf~~~~a~~AL~~~~~d~~~A~e~L-~~~  320 (321)
                      -+|+++++|+.   ..+|..|....++++|++|++|||+|++|++||++++||+++|+||| +.+
T Consensus         7 ~~r~~~~~~a~---~~~~~~~~~~~~ee~I~~L~eMGF~r~~a~~AL~~~~~nve~Ave~Ll~~~   68 (73)
T 1vg5_A            7 GSRQAPIANAA---VLPQSQGRVAASEEQIQKLVAMGFDRTQVEVALAAADDDLTVAVEILMSQS   68 (73)
T ss_dssp             CCCCCCCSCCC---CCSSSCCCSCCCHHHHHHHHTTTCCHHHHHHHHHHHTSCHHHHHHHHHTCS
T ss_pred             cccccccccCC---CCCCCccCCcccHHHHHHHHHcCCCHHHHHHHHHHhCCCHHHHHHHHHHCC
Confidence            46888877776   33344677788999999999999999999999999999999999999 554
>2xov_A Rhomboid protease GLPG; membrane protein, hydrolase, intramembrane protease; HET: BNG; 1.65A {Escherichia coli} PDB: 2ic8_A* 2nrf_A 2xtu_A* 2irv_A* 3b45_A* 2o7l_A* 2xow_A* 3txt_A* 2xtv_A* 3b44_A* Back     alignment and structure
>2nr9_A Protein GLPG homolog; intramembrane peptidase, rhomboid protease, membrane protein; HET: PA6 PQE; 2.20A {Haemophilus influenzae} SCOP: f.51.1.1 PDB: 3odj_A Back     alignment and structure
>2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B Back     alignment and structure
>1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} Back     alignment and structure
>1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 Back     alignment and structure
>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A Back     alignment and structure
>1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A Back     alignment and structure
>2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2ooa_A E3 ubiquitin-protein ligase CBL-B; alpha-helical domain; 1.56A {Homo sapiens} PDB: 2oob_A 2jnh_A 2do6_A Back     alignment and structure
>2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2d9s_A CBL E3 ubiquitin protein ligase; UBA domain, dimer, protein binding, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A Back     alignment and structure
>2juj_A E3 ubiquitin-protein ligase CBL; alpha helix, UBA domain, calcium, cytoplasm, metal- binding, phosphorylation, proto-oncogene, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Back     alignment and structure
>1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2oo9_A E3 ubiquitin-protein ligase CBL; alpha-helical domain, homodimer; 2.10A {Homo sapiens} Back     alignment and structure
>2cp8_A NEXT to BRCA1 gene 1 protein; UBA domain, structural genomics, human, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Back     alignment and structure
>2cos_A Serine/threonine protein kinase LATS2; UBA domain, structure genomics, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Back     alignment and structure
>2cp9_A EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UBA, structural genomics, human, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.2 Back     alignment and structure
>1otr_A Protein CUE2; protein-protein complex, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.4 Back     alignment and structure
>1wgl_A TOLL-interacting protein; CUE domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, immune system; NMR {Homo sapiens} SCOP: a.5.2.4 Back     alignment and structure
>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Back     alignment and structure
>2dhy_A CUE domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1q02_A Sequestosome 1; helical bundle, protein binding; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 2jy7_A 2jy8_A 2k0b_X 2knv_A 2rru_A 3b0f_A Back     alignment and structure
>1v92_A NSFL1 cofactor P47; 3-helix bundle, recombination; NMR {Rattus norvegicus} SCOP: a.5.2.3 Back     alignment and structure
>3e21_A HFAF1, FAS-associated factor 1; UBA, alternative splicing, apoptosis, nucleus, phosphoprotein; 1.73A {Homo sapiens} Back     alignment and structure
>2d9g_A YY1-associated factor 2; ZF-ranbp domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dal_A Protein KIAA0794; FAS associted factor 1, UBA-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1tr8_A Conserved protein (MTH177); chaperones, nascent polypeptide-associated complex, ribosome domain, ubiquitin, chaperone; 2.27A {Methanothermobacter marburgensis} Back     alignment and structure
>2dam_A ETEA protein; KIAA0887, UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2crc_A Ubiquitin conjugating enzyme 7 interacting protein 3; ZF-ranbp domain, hepatitis B virus X-associated protein 4, HBV associated factor 4; NMR {Homo sapiens} Back     alignment and structure
>2dzl_A Protein FAM100B; UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1nj3_A NPL4; NZF domain, rubredoxin knuckle, beta-ribbon, zinc- finger, ubiquitin, protein binding; NMR {Rattus norvegicus} SCOP: g.41.11.1 PDB: 1q5w_A Back     alignment and structure
>4dbg_B Ring finger protein 31; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} Back     alignment and structure
>3a9j_C Mitogen-activated protein kinase kinase kinase 7- interacting protein 2; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 2wwz_C 2wx0_C 2wx1_C 3a9k_C Back     alignment and structure
>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Back     alignment and structure
>2di0_A Activating signal cointegrator 1 complex subunit 2; ASCC2, CUE domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.4 Back     alignment and structure
>3b08_B Ranbp-type and C3HC4-type zinc finger-containing; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Mus musculus} PDB: 3b0a_B* Back     alignment and structure
>2qho_B E3 ubiquitin-protein ligase EDD1; protein-protein complex, protein binding/ligase complex; 1.85A {Homo sapiens} Back     alignment and structure
>2jp7_A MRNA export factor MEX67; solution MEX67, UBA, translation; NMR {Saccharomyces cerevisiae} PDB: 2khh_A Back     alignment and structure
>1oai_A Nuclear RNA export factor; nuclear transport, nuclear transport factor; 1.0A {Homo sapiens} SCOP: a.5.2.3 Back     alignment and structure
>2ebq_A Nuclear pore complex protein NUP153; ZF-ranbp domain, nucleoporin NUP153, 153 kDa nucleoporin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 321
d1oqya141 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Hum 4e-09
d1wiva_73 a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress 4e-08
d1vg5a_73 a.5.2.1 (A:) Rhomboid family protein At3g58460 {Th 6e-08
d1wjia_63 a.5.2.1 (A:) Tudor domain containing protein 3, TD 3e-07
d1wgna_63 a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 9e-07
d3b45a1180 f.51.1.1 (A:91-270) GlpG {Escherichia coli [TaxId: 5e-06
d2g3qa143 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL0 9e-05
d2cpwa151 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 2e-04
d1z96a138 a.5.2.1 (A:295-332) UBA-domain protein mud1 {Schiz 4e-04
d1veka_84 a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress 9e-04
d2crna151 a.5.2.1 (A:8-58) Suppressor of T-cell receptor sig 0.001
d2bwba144 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharom 0.002
d1veja161 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculu 0.002
d2daha141 a.5.2.1 (A:8-48) Ubiquilin-3 {Human (Homo sapiens) 0.002
d2nr9a1189 f.51.1.1 (A:4-192) GlpG homolog HI0618 {Haemophilu 0.002
d2dnaa150 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {M 0.003
d1vega_83 a.5.2.1 (A:) NEDD8 ultimate buster-1 (Nub1) {Mouse 0.003
d1whca_64 a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus 0.003
d1oqya244 a.5.2.1 (A:317-360) DNA repair protein Hhr23a {Hum 0.004
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure

class: All alpha proteins
fold: RuvA C-terminal domain-like
superfamily: UBA-like
family: UBA domain
domain: DNA repair protein Hhr23a
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 49.2 bits (118), Expect = 4e-09
 Identities = 11/35 (31%), Positives = 23/35 (65%)

Query: 283 DEEIQKLVSMGFDKTQVEVALAAADGDLNVAVEIL 317
           +  + +++SMG+++ +V  AL A+  + + AVE L
Sbjct: 5   ETMLTEIMSMGYERERVVAALRASYNNPHRAVEYL 39
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure
>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d3b45a1 f.51.1.1 (A:91-270) GlpG {Escherichia coli [TaxId: 562]} Length = 180 Back     information, alignment and structure
>d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} Length = 43 Back     information, alignment and structure
>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1z96a1 a.5.2.1 (A:295-332) UBA-domain protein mud1 {Schizosaccharomyces pombe [TaxId: 4896]} Length = 38 Back     information, alignment and structure
>d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 84 Back     information, alignment and structure
>d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d2bwba1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 44 Back     information, alignment and structure
>d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 61 Back     information, alignment and structure
>d2daha1 a.5.2.1 (A:8-48) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d2nr9a1 f.51.1.1 (A:4-192) GlpG homolog HI0618 {Haemophilus influenzae [TaxId: 727]} Length = 189 Back     information, alignment and structure
>d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1vega_ a.5.2.1 (A:) NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 83 Back     information, alignment and structure
>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 64 Back     information, alignment and structure
>d1oqya2 a.5.2.1 (A:317-360) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query321
d1oqya141 DNA repair protein Hhr23a {Human (Homo sapiens) [T 99.42
d3b45a1180 GlpG {Escherichia coli [TaxId: 562]} 99.41
d1vg5a_73 Rhomboid family protein At3g58460 {Thale cress (Ar 99.41
d2nr9a1189 GlpG homolog HI0618 {Haemophilus influenzae [TaxId 99.39
d2g3qa143 Endocytic protein Ede1, YBL047C {Saccharomyces cer 99.27
d1wgna_63 Ubiquitin-associated protein 1, UBAP1 {Human (Homo 99.24
d1wiva_73 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 99.22
d1wjia_63 Tudor domain containing protein 3, TDRD3 {Human (H 99.19
d2cpwa151 Cbl-interacting protein p70, STS1 {Human (Homo sap 99.02
d1whca_64 UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [Ta 98.95
d1veka_84 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 98.84
d2crna151 Suppressor of T-cell receptor signaling 2 (STS-2) 98.79
d3e46a142 Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal 98.61
d1veja161 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 98.59
d2dnaa150 Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus 98.57
d2bwba144 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 98.46
d2daha141 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 98.39
d1oqya244 DNA repair protein Hhr23a {Human (Homo sapiens) [T 98.39
d1z96a138 UBA-domain protein mud1 {Schizosaccharomyces pombe 98.18
d1vega_83 NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculu 98.15
d1efub354 Elongation factor Ts (EF-Ts), N-terminal domain {E 96.99
d1aipc152 Elongation factor Ts (EF-Ts), N-terminal domain {T 96.92
d1wj7a191 Ubiquitin-associated protein 2-like Ubap2l {Mouse 96.85
d1xb2b156 Elongation factor Ts (EF-Ts), N-terminal domain {C 96.81
d2cosa141 Serine/threonine protein kinase LATS2 {Mouse (Mus 96.79
d1v92a_46 NSFL1 (p97 ATPase) cofactor p47, UBA-like domain { 96.53
d1ttea155 Ubiquitin-protein ligase ubc1 {Baker's yeast (Sacc 95.72
d2dkla172 Trinucleotide repeat containing 6c protein, TNRC6C 95.6
d1wgla_59 Toll-interacting protein {Human (Homo sapiens) [Ta 95.4
d2k0bx152 Sequestosome 1 (Sqstm1) {Human (Homo sapiens) [Tax 94.16
d2cp8a141 Migration-inducing protein 19 NBR1 {Human (Homo sa 93.85
d1mn3a_54 Vacuolar protein sorting-associated protein vps9 { 90.46
d1q5wa_31 Npl4 {Rat (Rattus norvegicus) [TaxId: 10116]} 88.27
d1oaia_59 FG-binding, C-terminal domain of TAP {Human (Homo 85.7
d1umqa_60 Photosynthetic apparatus regulatory protein PprA ( 81.73
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: RuvA C-terminal domain-like
superfamily: UBA-like
family: UBA domain
domain: DNA repair protein Hhr23a
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.42  E-value=3.4e-14  Score=94.72  Aligned_cols=36  Identities=31%  Similarity=0.486  Sum_probs=35.2

Q ss_pred             CHHHHHHHHhcCCCHHHHHHHHHHhCCCHHHHHHHh
Q 020822          282 SDEEIQKLVSMGFDKTQVEVALAAADGDLNVAVEIL  317 (321)
Q Consensus       282 ~~~~v~~L~~MGf~~~~a~~AL~~~~~d~~~A~e~L  317 (321)
                      .|++|++|++|||+|++|++||++++||+|+|+|||
T Consensus         4 ~e~~i~~L~~MGF~~~~a~~AL~~~~~N~e~A~~~L   39 (41)
T d1oqya1           4 YETMLTEIMSMGYERERVVAALRASYNNPHRAVEYL   39 (41)
T ss_dssp             HHHHHHHHHTTTCCSHHHHHHHHHSCSSTTHHHHTT
T ss_pred             HHHHHHHHHHcCCCHHHHHHHHHHhCCCHHHHHHHH
Confidence            589999999999999999999999999999999999
>d3b45a1 f.51.1.1 (A:91-270) GlpG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2nr9a1 f.51.1.1 (A:4-192) GlpG homolog HI0618 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3e46a1 a.5.2.1 (A:157-198) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bwba1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2daha1 a.5.2.1 (A:8-48) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqya2 a.5.2.1 (A:317-360) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z96a1 a.5.2.1 (A:295-332) UBA-domain protein mud1 {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1vega_ a.5.2.1 (A:) NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1efub3 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wj7a1 a.5.2.1 (A:8-98) Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2cosa1 a.5.2.1 (A:8-48) Serine/threonine protein kinase LATS2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ttea1 a.5.2.1 (A:161-215) Ubiquitin-protein ligase ubc1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dkla1 a.5.2.1 (A:8-79) Trinucleotide repeat containing 6c protein, TNRC6C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgla_ a.5.2.4 (A:) Toll-interacting protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2k0bx1 a.5.2.1 (X:1-52) Sequestosome 1 (Sqstm1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cp8a1 a.5.2.1 (A:8-48) Migration-inducing protein 19 NBR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mn3a_ a.5.2.4 (A:) Vacuolar protein sorting-associated protein vps9 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q5wa_ g.41.11.1 (A:) Npl4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1oaia_ a.5.2.3 (A:) FG-binding, C-terminal domain of TAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1umqa_ a.4.1.12 (A:) Photosynthetic apparatus regulatory protein PprA (RegA), DNA-binding domain {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure