Citrus Sinensis ID: 020840
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 320 | ||||||
| 255552842 | 490 | conserved hypothetical protein [Ricinus | 0.784 | 0.512 | 0.801 | 1e-119 | |
| 225452686 | 483 | PREDICTED: protein midA, mitochondrial [ | 0.778 | 0.515 | 0.808 | 1e-118 | |
| 357473955 | 449 | MidA-like protein [Medicago truncatula] | 0.759 | 0.541 | 0.786 | 1e-114 | |
| 217074438 | 449 | unknown [Medicago truncatula] | 0.759 | 0.541 | 0.781 | 1e-114 | |
| 449505855 | 493 | PREDICTED: protein midA, mitochondrial-l | 0.787 | 0.511 | 0.75 | 1e-112 | |
| 449461913 | 493 | PREDICTED: protein midA, mitochondrial-l | 0.787 | 0.511 | 0.75 | 1e-112 | |
| 356538547 | 464 | PREDICTED: protein midA, mitochondrial-l | 0.728 | 0.502 | 0.819 | 1e-112 | |
| 297815160 | 471 | hypothetical protein ARALYDRAFT_905140 [ | 0.725 | 0.492 | 0.792 | 1e-111 | |
| 42565270 | 471 | uncharacterized protein [Arabidopsis tha | 0.725 | 0.492 | 0.792 | 1e-110 | |
| 334185683 | 471 | uncharacterized protein [Arabidopsis tha | 0.725 | 0.492 | 0.792 | 1e-110 |
| >gi|255552842|ref|XP_002517464.1| conserved hypothetical protein [Ricinus communis] gi|223543475|gb|EEF45006.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 432 bits (1111), Expect = e-119, Method: Compositional matrix adjust.
Identities = 202/252 (80%), Positives = 227/252 (90%), Gaps = 1/252 (0%)
Query: 41 QIPNSHSVEPLDDNRSEHASTAISIDRSGLYNPPEHSHERKLESELVKHLKGIIKFRGGP 100
+IP+S+ VE L+DN + +ST +S+DRSGLYNPPEHSHE ESEL KHLKGIIKFRGGP
Sbjct: 49 EIPHSNLVEQLEDNNVQ-SSTTVSVDRSGLYNPPEHSHEPNSESELFKHLKGIIKFRGGP 107
Query: 101 ISVAEYMEEVLTNPKAGFYINRDVFGAEGDFITSPEVSQMFGEMVGVWAMCLWEQMGQPN 160
I+VAEYMEEVLTNPKAGFYINRDVFGAEGDFITSPEVSQMFGEMVGVWA+CLWEQM QP
Sbjct: 108 ITVAEYMEEVLTNPKAGFYINRDVFGAEGDFITSPEVSQMFGEMVGVWALCLWEQMEQPK 167
Query: 161 RVNLVELGPGRGTLMADLLRGASKFKNFTESLHIHLVECSPTLQKLQHHNLKCMDENNAN 220
VNLVELGPGRGTLMADLLRGASKFK+FTESLHIH+VECSP LQKLQHHNLKC+D+NN+
Sbjct: 168 SVNLVELGPGRGTLMADLLRGASKFKSFTESLHIHMVECSPALQKLQHHNLKCVDDNNSC 227
Query: 221 DNVEERTISSLAGTPVSWHAALEQVPSGFPTIIVAHEFYDALPVHQFQKTTRGWCEKLVD 280
+ EERTIS+LAGTP+SWH +LEQVP+G PTII+AHEFYDALPVHQFQ+ +RGWCEK+VD
Sbjct: 228 GSGEERTISTLAGTPISWHTSLEQVPTGSPTIIIAHEFYDALPVHQFQRASRGWCEKMVD 287
Query: 281 IAEDSSLHQQLS 292
+AEDS LS
Sbjct: 288 VAEDSMFRFVLS 299
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225452686|ref|XP_002276826.1| PREDICTED: protein midA, mitochondrial [Vitis vinifera] gi|296087782|emb|CBI35038.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357473955|ref|XP_003607262.1| MidA-like protein [Medicago truncatula] gi|355508317|gb|AES89459.1| MidA-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|217074438|gb|ACJ85579.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449505855|ref|XP_004162586.1| PREDICTED: protein midA, mitochondrial-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449461913|ref|XP_004148686.1| PREDICTED: protein midA, mitochondrial-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356538547|ref|XP_003537764.1| PREDICTED: protein midA, mitochondrial-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297815160|ref|XP_002875463.1| hypothetical protein ARALYDRAFT_905140 [Arabidopsis lyrata subsp. lyrata] gi|297321301|gb|EFH51722.1| hypothetical protein ARALYDRAFT_905140 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|42565270|ref|NP_189511.2| uncharacterized protein [Arabidopsis thaliana] gi|95147286|gb|ABF57278.1| At3g28700 [Arabidopsis thaliana] gi|332643957|gb|AEE77478.1| uncharacterized protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|334185683|ref|NP_001189995.1| uncharacterized protein [Arabidopsis thaliana] gi|332643958|gb|AEE77479.1| uncharacterized protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 320 | ||||||
| TAIR|locus:2095527 | 471 | AT3G28700 [Arabidopsis thalian | 0.868 | 0.590 | 0.694 | 1.4e-103 | |
| DICTYBASE|DDB_G0282615 | 484 | midA "DUF185 family protein" [ | 0.690 | 0.456 | 0.467 | 1.7e-52 | |
| FB|FBgn0037880 | 437 | CG17726 [Drosophila melanogast | 0.671 | 0.491 | 0.486 | 3.2e-49 | |
| UNIPROTKB|Q6GQ37 | 437 | ndufaf7 "NADH dehydrogenase [u | 0.706 | 0.517 | 0.436 | 1.4e-46 | |
| UNIPROTKB|Q2KHV5 | 441 | NDUFAF7 "NADH dehydrogenase [u | 0.690 | 0.501 | 0.449 | 3.8e-46 | |
| RGD|1311578 | 436 | Ndufaf7 "NADH dehydrogenase (u | 0.740 | 0.543 | 0.431 | 4.7e-46 | |
| ZFIN|ZDB-GENE-060929-628 | 422 | zgc:153989 "zgc:153989" [Danio | 0.609 | 0.462 | 0.475 | 6.2e-46 | |
| UNIPROTKB|Q5BKM6 | 430 | ndufaf7 "NADH dehydrogenase [u | 0.712 | 0.530 | 0.439 | 1e-45 | |
| UNIPROTKB|F1MJQ5 | 441 | C11H2orf56 "Uncharacterized pr | 0.690 | 0.501 | 0.444 | 2.7e-45 | |
| MGI|MGI:1920944 | 436 | Ndufaf7 "NADH dehydrogenase (u | 0.715 | 0.525 | 0.443 | 5.6e-45 |
| TAIR|locus:2095527 AT3G28700 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1026 (366.2 bits), Expect = 1.4e-103, P = 1.4e-103
Identities = 202/291 (69%), Positives = 226/291 (77%)
Query: 3 LRKLSLQPSSPLRVLSSKYPFPLLQKWXXXXXXXXXXXXXXXXXXVEPLDDNRS-EHAST 61
LRKL Q SS R+L S P PL K P ++ + EH T
Sbjct: 2 LRKLLTQTSSR-RLLFSGVP-PLFSK------STISPFSSLSSSPEPPSSESPAVEHPGT 53
Query: 62 AISIDRSGLYNPPEHSHERKLESELVKHLKGIIKFRGGPISVAEYMEEVLTNPKAGFYIN 121
ISIDRS LY PP+HSHE +SELVKHLK IIKFRGGPISVAEYMEEVLTNPKAGFY+N
Sbjct: 54 TISIDRSSLYTPPDHSHESTPDSELVKHLKSIIKFRGGPISVAEYMEEVLTNPKAGFYMN 113
Query: 122 RDVFGAEGDFITSPEVSQMFGEMVGVWAMCLWEQMGQPNRVNLVELGPGRGTLMADLLRG 181
RDVFGA+GDFITSPEVSQMFGEM+GVW +CLWEQMG+P RVNLVELGPGRGTLMADLLRG
Sbjct: 114 RDVFGAQGDFITSPEVSQMFGEMIGVWTVCLWEQMGRPERVNLVELGPGRGTLMADLLRG 173
Query: 182 ASKFKNFTESLHIHLVECSPTLQKLQHHNLKCMDENNANDNVEERTISSLAGTPVSWHAA 241
SKFKNFTESLHIHLVECSP LQKLQH NLKC DE+++ E++ +SSLAGTPV WHA
Sbjct: 174 TSKFKNFTESLHIHLVECSPALQKLQHQNLKCTDESSS----EKKAVSSLAGTPVHWHAT 229
Query: 242 LEQVPSGFPTIIVAHEFYDALPVHQFQKTTRGWCEKLVDIAEDSSLHQQLS 292
L++VPSG PT+I+AHEFYDALPVHQFQK+TRGWCEK+VD+ EDS LS
Sbjct: 230 LQEVPSGVPTLIIAHEFYDALPVHQFQKSTRGWCEKMVDVGEDSKFRFVLS 280
|
|
| DICTYBASE|DDB_G0282615 midA "DUF185 family protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0037880 CG17726 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6GQ37 ndufaf7 "NADH dehydrogenase [ubiquinone] complex I, assembly factor 7" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2KHV5 NDUFAF7 "NADH dehydrogenase [ubiquinone] complex I, assembly factor 7" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|1311578 Ndufaf7 "NADH dehydrogenase (ubiquinone) complex I, assembly factor 7" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060929-628 zgc:153989 "zgc:153989" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5BKM6 ndufaf7 "NADH dehydrogenase [ubiquinone] complex I, assembly factor 7" [Xenopus (Silurana) tropicalis (taxid:8364)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MJQ5 C11H2orf56 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1920944 Ndufaf7 "NADH dehydrogenase (ubiquinone) 1 alpha subcomplex assembly factor 7" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 320 | |||
| COG1565 | 370 | COG1565, COG1565, Uncharacterized conserved protei | 1e-55 | |
| pfam02636 | 241 | pfam02636, Methyltransf_28, Putative S-adenosyl-L- | 4e-42 |
| >gnl|CDD|224481 COG1565, COG1565, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
Score = 184 bits (470), Expect = 1e-55
Identities = 68/183 (37%), Positives = 108/183 (59%), Gaps = 19/183 (10%)
Query: 98 GGPISVAEYMEEVLTNPKAGFYINRDVFGAEGDFITSPEVSQMFGEMVGVWAMCLWEQMG 157
GGPIS +++ME L +P+ G+Y + G +GDFIT+PE+SQ+FGE++ + LW+++G
Sbjct: 15 GGPISFSDFMELALYDPEHGYYSSAVKIGRKGDFITAPELSQLFGELLAEQFLQLWQELG 74
Query: 158 QPNRVNLVELGPGRGTLMADLLRGASK-FKNFTESLHIHLVECSPTLQKLQHHNLKCMDE 216
+P + LVE+G GRGTL +D+LR + + E+L +++E SP L+ Q LK
Sbjct: 75 RPAPLKLVEIGAGRGTLASDILRTLRRLYPELYEALSYYIIEPSPELRARQKETLK---- 130
Query: 217 NNANDNVEERTISSLAGTPVSWHAALEQVPSGFPTIIVAHEFYDALPVHQFQKTTRGWCE 276
D + W +E +P FP I+V++E +DALPV QF +T + E
Sbjct: 131 -ATED-------------LIRWVEWVEDLPKKFPGIVVSNELFDALPVEQFIRTKGLFVE 176
Query: 277 KLV 279
++V
Sbjct: 177 RVV 179
|
Length = 370 |
| >gnl|CDD|217158 pfam02636, Methyltransf_28, Putative S-adenosyl-L-methionine-dependent methyltransferase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 320 | |||
| COG1565 | 370 | Uncharacterized conserved protein [Function unknow | 100.0 | |
| KOG2901 | 415 | consensus Uncharacterized conserved protein [Funct | 100.0 | |
| PF02636 | 252 | Methyltransf_28: Putative S-adenosyl-L-methionine- | 100.0 | |
| PHA03412 | 241 | putative methyltransferase; Provisional | 97.19 | |
| PF05175 | 170 | MTS: Methyltransferase small domain; InterPro: IPR | 97.03 | |
| TIGR00740 | 239 | methyltransferase, putative. A simple BLAST search | 96.96 | |
| PRK15451 | 247 | tRNA cmo(5)U34 methyltransferase; Provisional | 96.64 | |
| PLN02244 | 340 | tocopherol O-methyltransferase | 96.58 | |
| PRK14896 | 258 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 96.55 | |
| PF00398 | 262 | RrnaAD: Ribosomal RNA adenine dimethylase; InterPr | 96.53 | |
| TIGR03587 | 204 | Pse_Me-ase pseudaminic acid biosynthesis-associate | 96.49 | |
| PRK06202 | 232 | hypothetical protein; Provisional | 96.43 | |
| TIGR03438 | 301 | probable methyltransferase. This model represents | 96.41 | |
| PRK01683 | 258 | trans-aconitate 2-methyltransferase; Provisional | 96.41 | |
| smart00650 | 169 | rADc Ribosomal RNA adenine dimethylases. | 96.39 | |
| PHA03411 | 279 | putative methyltransferase; Provisional | 96.31 | |
| COG0030 | 259 | KsgA Dimethyladenosine transferase (rRNA methylati | 96.3 | |
| PF12847 | 112 | Methyltransf_18: Methyltransferase domain; PDB: 3G | 96.28 | |
| PRK11036 | 255 | putative S-adenosyl-L-methionine-dependent methylt | 96.16 | |
| TIGR02072 | 240 | BioC biotin biosynthesis protein BioC. This enzyme | 96.15 | |
| TIGR02752 | 231 | MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me | 96.14 | |
| PRK07580 | 230 | Mg-protoporphyrin IX methyl transferase; Validated | 96.14 | |
| PRK00274 | 272 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 96.0 | |
| PF13649 | 101 | Methyltransf_25: Methyltransferase domain; PDB: 3B | 95.88 | |
| PF13847 | 152 | Methyltransf_31: Methyltransferase domain; PDB: 3T | 95.86 | |
| TIGR00755 | 253 | ksgA dimethyladenosine transferase. Alternate name | 95.85 | |
| PF08242 | 99 | Methyltransf_12: Methyltransferase domain; InterPr | 95.85 | |
| COG3963 | 194 | Phospholipid N-methyltransferase [Lipid metabolism | 95.8 | |
| TIGR02469 | 124 | CbiT precorrin-6Y C5,15-methyltransferase (decarbo | 95.72 | |
| TIGR03533 | 284 | L3_gln_methyl protein-(glutamine-N5) methyltransfe | 95.67 | |
| TIGR02021 | 219 | BchM-ChlM magnesium protoporphyrin O-methyltransfe | 95.58 | |
| PRK11805 | 307 | N5-glutamine S-adenosyl-L-methionine-dependent met | 95.53 | |
| PRK08317 | 241 | hypothetical protein; Provisional | 95.4 | |
| PRK14103 | 255 | trans-aconitate 2-methyltransferase; Provisional | 95.39 | |
| PF13679 | 141 | Methyltransf_32: Methyltransferase domain | 95.38 | |
| smart00138 | 264 | MeTrc Methyltransferase, chemotaxis proteins. Meth | 95.34 | |
| PF05185 | 448 | PRMT5: PRMT5 arginine-N-methyltransferase; InterPr | 95.33 | |
| PRK08287 | 187 | cobalt-precorrin-6Y C(15)-methyltransferase; Valid | 95.27 | |
| PRK00121 | 202 | trmB tRNA (guanine-N(7)-)-methyltransferase; Revie | 95.25 | |
| PRK09328 | 275 | N5-glutamine S-adenosyl-L-methionine-dependent met | 95.19 | |
| PTZ00338 | 294 | dimethyladenosine transferase-like protein; Provis | 95.17 | |
| PF13489 | 161 | Methyltransf_23: Methyltransferase domain; PDB: 3J | 95.01 | |
| PRK13942 | 212 | protein-L-isoaspartate O-methyltransferase; Provis | 95.01 | |
| TIGR02987 | 524 | met_A_Alw26 type II restriction m6 adenine DNA met | 94.88 | |
| COG2263 | 198 | Predicted RNA methylase [Translation, ribosomal st | 94.83 | |
| PRK00107 | 187 | gidB 16S rRNA methyltransferase GidB; Reviewed | 94.82 | |
| TIGR00536 | 284 | hemK_fam HemK family putative methylases. The gene | 94.8 | |
| PRK11705 | 383 | cyclopropane fatty acyl phospholipid synthase; Pro | 94.77 | |
| PRK13944 | 205 | protein-L-isoaspartate O-methyltransferase; Provis | 94.74 | |
| PRK11088 | 272 | rrmA 23S rRNA methyltransferase A; Provisional | 94.71 | |
| PRK00216 | 239 | ubiE ubiquinone/menaquinone biosynthesis methyltra | 94.7 | |
| PRK07402 | 196 | precorrin-6B methylase; Provisional | 94.69 | |
| PF07757 | 112 | AdoMet_MTase: Predicted AdoMet-dependent methyltra | 94.67 | |
| TIGR00080 | 215 | pimt protein-L-isoaspartate(D-aspartate) O-methylt | 94.67 | |
| PF13659 | 117 | Methyltransf_26: Methyltransferase domain; PDB: 3G | 94.6 | |
| TIGR03704 | 251 | PrmC_rel_meth putative protein-(glutamine-N5) meth | 94.57 | |
| KOG0820 | 315 | consensus Ribosomal RNA adenine dimethylase [RNA p | 94.55 | |
| PRK09489 | 342 | rsmC 16S ribosomal RNA m2G1207 methyltransferase; | 94.53 | |
| TIGR03534 | 251 | RF_mod_PrmC protein-(glutamine-N5) methyltransfera | 94.52 | |
| PRK00377 | 198 | cbiT cobalt-precorrin-6Y C(15)-methyltransferase; | 94.51 | |
| TIGR00138 | 181 | gidB 16S rRNA methyltransferase GidB. GidB (glucos | 94.46 | |
| PRK15001 | 378 | SAM-dependent 23S ribosomal RNA mG1835 methyltrans | 94.45 | |
| KOG1540 | 296 | consensus Ubiquinone biosynthesis methyltransferas | 94.45 | |
| PRK00312 | 212 | pcm protein-L-isoaspartate O-methyltransferase; Re | 94.44 | |
| TIGR00091 | 194 | tRNA (guanine-N(7)-)-methyltransferase. In E. coli | 94.4 | |
| PRK14967 | 223 | putative methyltransferase; Provisional | 94.31 | |
| PF02384 | 311 | N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T | 94.29 | |
| PRK10258 | 251 | biotin biosynthesis protein BioC; Provisional | 94.2 | |
| PRK00811 | 283 | spermidine synthase; Provisional | 94.2 | |
| TIGR00537 | 179 | hemK_rel_arch HemK-related putative methylase. The | 94.16 | |
| TIGR01934 | 223 | MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis | 94.11 | |
| KOG2904 | 328 | consensus Predicted methyltransferase [General fun | 94.09 | |
| PF08241 | 95 | Methyltransf_11: Methyltransferase domain; InterPr | 94.06 | |
| TIGR00417 | 270 | speE spermidine synthase. the SpeE subunit of sper | 93.83 | |
| PRK01544 | 506 | bifunctional N5-glutamine S-adenosyl-L-methionine- | 93.82 | |
| COG2890 | 280 | HemK Methylase of polypeptide chain release factor | 93.51 | |
| TIGR01983 | 224 | UbiG ubiquinone biosynthesis O-methyltransferase. | 93.5 | |
| PRK05785 | 226 | hypothetical protein; Provisional | 93.46 | |
| PRK11207 | 197 | tellurite resistance protein TehB; Provisional | 93.43 | |
| cd02440 | 107 | AdoMet_MTases S-adenosylmethionine-dependent methy | 93.36 | |
| PTZ00098 | 263 | phosphoethanolamine N-methyltransferase; Provision | 93.31 | |
| PRK04457 | 262 | spermidine synthase; Provisional | 93.22 | |
| COG2226 | 238 | UbiE Methylase involved in ubiquinone/menaquinone | 92.93 | |
| PLN02233 | 261 | ubiquinone biosynthesis methyltransferase | 92.86 | |
| TIGR03439 | 319 | methyl_EasF probable methyltransferase domain, Eas | 92.68 | |
| TIGR00477 | 195 | tehB tellurite resistance protein TehB. Part of a | 92.64 | |
| COG4123 | 248 | Predicted O-methyltransferase [General function pr | 92.58 | |
| PLN02585 | 315 | magnesium protoporphyrin IX methyltransferase | 92.46 | |
| TIGR00406 | 288 | prmA ribosomal protein L11 methyltransferase. Ribo | 92.32 | |
| PF06325 | 295 | PrmA: Ribosomal protein L11 methyltransferase (Prm | 92.22 | |
| PF05206 | 259 | TRM13: Methyltransferase TRM13; InterPro: IPR00787 | 92.12 | |
| COG2813 | 300 | RsmC 16S RNA G1207 methylase RsmC [Translation, ri | 92.09 | |
| PLN02396 | 322 | hexaprenyldihydroxybenzoate methyltransferase | 91.98 | |
| PRK13943 | 322 | protein-L-isoaspartate O-methyltransferase; Provis | 91.94 | |
| PRK14968 | 188 | putative methyltransferase; Provisional | 91.88 | |
| COG2518 | 209 | Pcm Protein-L-isoaspartate carboxylmethyltransfera | 91.85 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 91.75 | |
| PF01135 | 209 | PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl | 91.67 | |
| TIGR01444 | 143 | fkbM_fam methyltransferase, FkbM family. Members o | 91.34 | |
| COG4106 | 257 | Tam Trans-aconitate methyltransferase [General fun | 91.22 | |
| smart00828 | 224 | PKS_MT Methyltransferase in polyketide synthase (P | 91.21 | |
| PRK04266 | 226 | fibrillarin; Provisional | 91.14 | |
| COG2264 | 300 | PrmA Ribosomal protein L11 methylase [Translation, | 91.07 | |
| PRK00517 | 250 | prmA ribosomal protein L11 methyltransferase; Revi | 91.05 | |
| TIGR00438 | 188 | rrmJ cell division protein FtsJ. | 90.99 | |
| PRK05134 | 233 | bifunctional 3-demethylubiquinone-9 3-methyltransf | 90.73 | |
| PF01209 | 233 | Ubie_methyltran: ubiE/COQ5 methyltransferase famil | 90.61 | |
| PF10294 | 173 | Methyltransf_16: Putative methyltransferase; Inter | 90.47 | |
| PLN02366 | 308 | spermidine synthase | 90.3 | |
| PRK14966 | 423 | unknown domain/N5-glutamine S-adenosyl-L-methionin | 90.07 | |
| PF01596 | 205 | Methyltransf_3: O-methyltransferase; InterPro: IPR | 89.95 | |
| PRK12335 | 287 | tellurite resistance protein TehB; Provisional | 89.9 | |
| PRK03522 | 315 | rumB 23S rRNA methyluridine methyltransferase; Rev | 89.9 | |
| PF05401 | 201 | NodS: Nodulation protein S (NodS); InterPro: IPR00 | 89.83 | |
| PLN02490 | 340 | MPBQ/MSBQ methyltransferase | 89.36 | |
| PRK10909 | 199 | rsmD 16S rRNA m(2)G966-methyltransferase; Provisio | 89.14 | |
| PRK01581 | 374 | speE spermidine synthase; Validated | 89.01 | |
| PF07021 | 193 | MetW: Methionine biosynthesis protein MetW; InterP | 88.93 | |
| PF00891 | 241 | Methyltransf_2: O-methyltransferase; InterPro: IPR | 88.82 | |
| TIGR02081 | 194 | metW methionine biosynthesis protein MetW. This pr | 88.75 | |
| PRK06922 | 677 | hypothetical protein; Provisional | 88.74 | |
| PRK11188 | 209 | rrmJ 23S rRNA methyltransferase J; Provisional | 88.65 | |
| KOG0822 | 649 | consensus Protein kinase inhibitor [Cell cycle con | 88.59 | |
| TIGR00452 | 314 | methyltransferase, putative. Known examples to dat | 88.55 | |
| PLN02781 | 234 | Probable caffeoyl-CoA O-methyltransferase | 88.46 | |
| COG2519 | 256 | GCD14 tRNA(1-methyladenosine) methyltransferase an | 88.42 | |
| PRK14121 | 390 | tRNA (guanine-N(7)-)-methyltransferase; Provisiona | 88.34 | |
| PLN02823 | 336 | spermine synthase | 87.89 | |
| COG0421 | 282 | SpeE Spermidine synthase [Amino acid transport and | 87.57 | |
| PF12147 | 311 | Methyltransf_20: Putative methyltransferase; Inter | 87.55 | |
| PRK13168 | 443 | rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe | 87.51 | |
| PRK11873 | 272 | arsM arsenite S-adenosylmethyltransferase; Reviewe | 87.48 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 87.07 | |
| PRK03612 | 521 | spermidine synthase; Provisional | 87.0 | |
| PF08123 | 205 | DOT1: Histone methylation protein DOT1 ; InterPro: | 86.64 | |
| TIGR02143 | 353 | trmA_only tRNA (uracil-5-)-methyltransferase. This | 86.54 | |
| TIGR02085 | 374 | meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer | 86.39 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 86.14 | |
| PTZ00146 | 293 | fibrillarin; Provisional | 85.83 | |
| PF02390 | 195 | Methyltransf_4: Putative methyltransferase ; Inter | 85.68 | |
| TIGR02716 | 306 | C20_methyl_CrtF C-20 methyltransferase BchU. Membe | 85.58 | |
| COG2230 | 283 | Cfa Cyclopropane fatty acid synthase and related m | 84.99 | |
| PF08704 | 247 | GCD14: tRNA methyltransferase complex GCD14 subuni | 84.85 | |
| PRK05031 | 362 | tRNA (uracil-5-)-methyltransferase; Validated | 84.5 | |
| TIGR00479 | 431 | rumA 23S rRNA (uracil-5-)-methyltransferase RumA. | 84.42 | |
| KOG4300 | 252 | consensus Predicted methyltransferase [General fun | 84.14 | |
| PRK15068 | 322 | tRNA mo(5)U34 methyltransferase; Provisional | 83.33 | |
| TIGR00095 | 189 | RNA methyltransferase, RsmD family. This model rep | 83.32 | |
| PF09243 | 274 | Rsm22: Mitochondrial small ribosomal subunit Rsm22 | 83.29 | |
| TIGR01177 | 329 | conserved hypothetical protein TIGR01177. This fam | 83.24 | |
| PF02353 | 273 | CMAS: Mycolic acid cyclopropane synthetase; InterP | 83.15 | |
| PF01564 | 246 | Spermine_synth: Spermine/spermidine synthase; Inte | 82.49 | |
| COG0220 | 227 | Predicted S-adenosylmethionine-dependent methyltra | 82.12 | |
| COG2227 | 243 | UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- | 81.55 | |
| KOG2361 | 264 | consensus Predicted methyltransferase [General fun | 81.25 | |
| PF03291 | 331 | Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 | 80.05 |
| >COG1565 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2e-53 Score=411.65 Aligned_cols=186 Identities=37% Similarity=0.695 Sum_probs=170.7
Q ss_pred HHHHHHHHHHHhcCCcccHHHHHHHhhcCCCCcccCCCCCCCCCCCeecCCChhHHHHHHHHHHHHHHHHHcCCCCcceE
Q 020840 85 ELVKHLKGIIKFRGGPISVAEYMEEVLTNPKAGFYINRDVFGAEGDFITSPEVSQMFGEMVGVWAMCLWEQMGQPNRVNL 164 (320)
Q Consensus 85 ~L~~~i~~~I~~~~GpIsf~dfM~~aLY~P~~GYY~~~~~~G~~GDFiTSpEIsp~FGe~IA~~i~~~w~~~g~p~~l~I 164 (320)
.+..+|++.|+.. |||||++||++|||+|++|||++..+||+.||||||||||++|||+||.|++++|++.|.|.++.|
T Consensus 3 ~~~~~~~~~i~~~-g~i~f~~fM~~~L~~p~~GYYs~~~~~G~~GDFiTApels~lFGella~~~~~~wq~~g~p~~~~l 81 (370)
T COG1565 3 LLALIIRALIAQG-GPISFSDFMELALYDPEHGYYSSAVKIGRKGDFITAPELSQLFGELLAEQFLQLWQELGRPAPLKL 81 (370)
T ss_pred cHHHHHHHHHhcC-CCccHHHHHHHHHcCCCCcccccchhccccCCeeechhHHHHHHHHHHHHHHHHHHHhcCCCCceE
Confidence 3566778888875 999999999999999999999998889999999999999999999999999999999999999999
Q ss_pred EEecCCchhHHHHHHHHHh-cCcCcccceeEEEEecChhhHHHHHHhccccccCCcCcccchhhhcccCCCCeEeecccc
Q 020840 165 VELGPGRGTLMADLLRGAS-KFKNFTESLHIHLVECSPTLQKLQHHNLKCMDENNANDNVEERTISSLAGTPVSWHAALE 243 (320)
Q Consensus 165 vEiGaG~GtLa~DIL~~l~-~~p~~~~~l~y~iVE~Sp~Lr~~Q~e~L~~~~~~~~~~~~~~~~~~~~~~~~i~W~~sle 243 (320)
||||||+|+||.|||++++ ..|++|+.++|+|||+||.|+++||++|+... ..+.|...++
T Consensus 82 vEiGaG~G~l~~DiL~~l~~L~P~~~~~~~~~iiE~s~~L~~~Qk~~L~~~~------------------~~~~~~~~~e 143 (370)
T COG1565 82 VEIGAGRGTLASDILRTLRRLYPELYEALSYYIIEPSPELRARQKETLKATE------------------DLIRWVEWVE 143 (370)
T ss_pred EEeCCCcChHHHHHHHHHHHhCHHHHhcceEEEEecCHHHHHHHHHHHhccc------------------cchhHHHHHH
Confidence 9999999999999999995 57999999999999999999999999998631 3678888889
Q ss_pred cCCCCCCEEEEEecccccccceeEEEeCCeeEEEEEEEcCCCceEE
Q 020840 244 QVPSGFPTIIVAHEFYDALPVHQFQKTTRGWCEKLVDIAEDSSLHQ 289 (320)
Q Consensus 244 elp~~~~~~iiANE~fDALPv~~f~~~~~~w~E~~V~v~~~g~f~~ 289 (320)
++|.+.++|||+|||||||||++|.+++++|+|++|.-+.++++.+
T Consensus 144 ~~p~~~~~i~~~NElfDAlPv~q~~~~~~~~~Er~~~~~~~~~~~~ 189 (370)
T COG1565 144 DLPKKFPGIVVSNELFDALPVEQFIRTKGLFVERVVVLDAEGRLVF 189 (370)
T ss_pred hccccCceEEEechhhccccceeEeccCceEEEEeeccCcccceee
Confidence 9999889999999999999999999999999999996445566655
|
|
| >KOG2901 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF02636 Methyltransf_28: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR003788 This entry describes proteins of unknown function | Back alignment and domain information |
|---|
| >PHA03412 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases | Back alignment and domain information |
|---|
| >TIGR00740 methyltransferase, putative | Back alignment and domain information |
|---|
| >PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02244 tocopherol O-methyltransferase | Back alignment and domain information |
|---|
| >PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional | Back alignment and domain information |
|---|
| >PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e | Back alignment and domain information |
|---|
| >TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase | Back alignment and domain information |
|---|
| >PRK06202 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03438 probable methyltransferase | Back alignment and domain information |
|---|
| >PRK01683 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >smart00650 rADc Ribosomal RNA adenine dimethylases | Back alignment and domain information |
|---|
| >PHA03411 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A | Back alignment and domain information |
|---|
| >PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02072 BioC biotin biosynthesis protein BioC | Back alignment and domain information |
|---|
| >TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase | Back alignment and domain information |
|---|
| >PRK07580 Mg-protoporphyrin IX methyl transferase; Validated | Back alignment and domain information |
|---|
| >PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed | Back alignment and domain information |
|---|
| >PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A | Back alignment and domain information |
|---|
| >PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A | Back alignment and domain information |
|---|
| >TIGR00755 ksgA dimethyladenosine transferase | Back alignment and domain information |
|---|
| >PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >COG3963 Phospholipid N-methyltransferase [Lipid metabolism] | Back alignment and domain information |
|---|
| >TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit | Back alignment and domain information |
|---|
| >TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific | Back alignment and domain information |
|---|
| >TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase | Back alignment and domain information |
|---|
| >PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08317 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14103 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13679 Methyltransf_32: Methyltransferase domain | Back alignment and domain information |
|---|
| >smart00138 MeTrc Methyltransferase, chemotaxis proteins | Back alignment and domain information |
|---|
| >PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] | Back alignment and domain information |
|---|
| >PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PTZ00338 dimethyladenosine transferase-like protein; Provisional | Back alignment and domain information |
|---|
| >PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C | Back alignment and domain information |
|---|
| >PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family | Back alignment and domain information |
|---|
| >COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed | Back alignment and domain information |
|---|
| >TIGR00536 hemK_fam HemK family putative methylases | Back alignment and domain information |
|---|
| >PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional | Back alignment and domain information |
|---|
| >PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11088 rrmA 23S rRNA methyltransferase A; Provisional | Back alignment and domain information |
|---|
| >PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK07402 precorrin-6B methylase; Provisional | Back alignment and domain information |
|---|
| >PF07757 AdoMet_MTase: Predicted AdoMet-dependent methyltransferase; InterPro: IPR011671 tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [] | Back alignment and domain information |
|---|
| >TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase | Back alignment and domain information |
|---|
| >PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A | Back alignment and domain information |
|---|
| >TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific | Back alignment and domain information |
|---|
| >KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific | Back alignment and domain information |
|---|
| >PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00138 gidB 16S rRNA methyltransferase GidB | Back alignment and domain information |
|---|
| >PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00091 tRNA (guanine-N(7)-)-methyltransferase | Back alignment and domain information |
|---|
| >PRK14967 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 | Back alignment and domain information |
|---|
| >PRK10258 biotin biosynthesis protein BioC; Provisional | Back alignment and domain information |
|---|
| >PRK00811 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR00537 hemK_rel_arch HemK-related putative methylase | Back alignment and domain information |
|---|
| >TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases | Back alignment and domain information |
|---|
| >KOG2904 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >TIGR00417 speE spermidine synthase | Back alignment and domain information |
|---|
| >PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase | Back alignment and domain information |
|---|
| >PRK05785 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11207 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) | Back alignment and domain information |
|---|
| >PTZ00098 phosphoethanolamine N-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK04457 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PLN02233 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >TIGR03439 methyl_EasF probable methyltransferase domain, EasF family | Back alignment and domain information |
|---|
| >TIGR00477 tehB tellurite resistance protein TehB | Back alignment and domain information |
|---|
| >COG4123 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02585 magnesium protoporphyrin IX methyltransferase | Back alignment and domain information |
|---|
| >TIGR00406 prmA ribosomal protein L11 methyltransferase | Back alignment and domain information |
|---|
| >PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences | Back alignment and domain information |
|---|
| >PF05206 TRM13: Methyltransferase TRM13; InterPro: IPR007871 This entry consists of eukaryotic and bacterial proteins that specifically methylates guanosine-4 in various tRNAs with a Gly(CCG), His or Pro signatures [] | Back alignment and domain information |
|---|
| >COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN02396 hexaprenyldihydroxybenzoate methyltransferase | Back alignment and domain information |
|---|
| >PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14968 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 | Back alignment and domain information |
|---|
| >TIGR01444 fkbM_fam methyltransferase, FkbM family | Back alignment and domain information |
|---|
| >COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes | Back alignment and domain information |
|---|
| >PRK04266 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00438 rrmJ cell division protein FtsJ | Back alignment and domain information |
|---|
| >PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional | Back alignment and domain information |
|---|
| >PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] | Back alignment and domain information |
|---|
| >PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases | Back alignment and domain information |
|---|
| >PLN02366 spermidine synthase | Back alignment and domain information |
|---|
| >PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional | Back alignment and domain information |
|---|
| >PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases | Back alignment and domain information |
|---|
| >PRK12335 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins | Back alignment and domain information |
|---|
| >PLN02490 MPBQ/MSBQ methyltransferase | Back alignment and domain information |
|---|
| >PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK01581 speE spermidine synthase; Validated | Back alignment and domain information |
|---|
| >PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins | Back alignment and domain information |
|---|
| >PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >TIGR02081 metW methionine biosynthesis protein MetW | Back alignment and domain information |
|---|
| >PRK06922 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional | Back alignment and domain information |
|---|
| >KOG0822 consensus Protein kinase inhibitor [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR00452 methyltransferase, putative | Back alignment and domain information |
|---|
| >PLN02781 Probable caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02823 spermine synthase | Back alignment and domain information |
|---|
| >COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length | Back alignment and domain information |
|---|
| >PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >PRK03612 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] | Back alignment and domain information |
|---|
| >TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase | Back alignment and domain information |
|---|
| >TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00146 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 | Back alignment and domain information |
|---|
| >TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU | Back alignment and domain information |
|---|
| >COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] | Back alignment and domain information |
|---|
| >PRK05031 tRNA (uracil-5-)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA | Back alignment and domain information |
|---|
| >KOG4300 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15068 tRNA mo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00095 RNA methyltransferase, RsmD family | Back alignment and domain information |
|---|
| >PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >TIGR01177 conserved hypothetical protein TIGR01177 | Back alignment and domain information |
|---|
| >PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) | Back alignment and domain information |
|---|
| >PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 | Back alignment and domain information |
|---|
| >COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG2361 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 320 | ||||
| 1zkd_A | 387 | X-ray Structure Of The Putative Protein Q6n1p6 From | 7e-37 | ||
| 4f3n_A | 432 | High Resolution Native Crystal Structure Of An Unch | 5e-10 |
| >pdb|1ZKD|A Chain A, X-ray Structure Of The Putative Protein Q6n1p6 From Rhodopseudomonas Palustris At The Resolution 2.1 A , Northeast Structural Genomics Consortium Target Rpr58 Length = 387 | Back alignment and structure |
|
| >pdb|4F3N|A Chain A, High Resolution Native Crystal Structure Of An Uncharacterized Acr, Cog1565 Superfamily Protein From Burkholderia Thailandensis, Solved By Iodide Ion Sad Length = 432 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 320 | |||
| 1zkd_A | 387 | DUF185; NESG, RPR58, structural genomics, PSI, pro | 3e-87 | |
| 4f3n_A | 432 | Uncharacterized ACR, COG1565 superfamily; structur | 2e-74 |
| >1zkd_A DUF185; NESG, RPR58, structural genomics, PSI, protein structure INI northeast structural genomics consortium, unknown function; 2.10A {Rhodopseudomonas palustris} SCOP: c.66.1.52 Length = 387 | Back alignment and structure |
|---|
Score = 266 bits (681), Expect = 3e-87
Identities = 79/210 (37%), Positives = 120/210 (57%), Gaps = 21/210 (10%)
Query: 83 ESELVKHLKGIIKFRGGPISVAEYMEEVLTNPKAGFYINRDVFGAEGDFITSPEVSQMFG 142
++ L +K +IK GP+ V YME L +P+ G+Y+ RD G EGDF TSPE+SQMFG
Sbjct: 4 QTALATEIKRLIK-AAGPMPVWRYMELCLGHPEHGYYVTRDPLGREGDFTTSPEISQMFG 62
Query: 143 EMVGVWAMCLWEQMGQPNRVNLVELGPGRGTLMADLLRGASKFKNFTESLHIHLVECSPT 202
E++G+W+ +W+ +P + L+E+GPGRGT+MAD LR +SL +HLVE +P
Sbjct: 63 ELLGLWSASVWKAADEPQTLRLIEIGPGRGTMMADALRALRVLPILYQSLSVHLVEINPV 122
Query: 203 LQKLQHHNLKCMDENNANDNVEERTISSLAGTPVSWHAALEQVPSGFPTIIVAHEFYDAL 262
L++ Q L + + WH + E VP G P +I+A+E++D L
Sbjct: 123 LRQKQQTLLAGIR-------------------NIHWHDSFEDVPEG-PAVILANEYFDVL 162
Query: 263 PVHQFQKTTRGWCEKLVDIAEDSSLHQQLS 292
P+HQ K GW E++++I L ++
Sbjct: 163 PIHQAIKRETGWHERVIEIGASGELVFGVA 192
|
| >4f3n_A Uncharacterized ACR, COG1565 superfamily; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.75A {Burkholderia thailandensis} Length = 432 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 320 | |||
| 1zkd_A | 387 | DUF185; NESG, RPR58, structural genomics, PSI, pro | 100.0 | |
| 4f3n_A | 432 | Uncharacterized ACR, COG1565 superfamily; structur | 100.0 | |
| 4gek_A | 261 | TRNA (CMO5U34)-methyltransferase; structural genom | 97.76 | |
| 1kpg_A | 287 | CFA synthase;, cyclopropane-fatty-acyl-phospholipi | 96.89 | |
| 3fut_A | 271 | Dimethyladenosine transferase; methyltransferase, | 96.88 | |
| 3hem_A | 302 | Cyclopropane-fatty-acyl-phospholipid synthase 2; p | 96.85 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 96.83 | |
| 2aot_A | 292 | HMT, histamine N-methyltransferase; classic methyl | 96.77 | |
| 2o57_A | 297 | Putative sarcosine dimethylglycine methyltransfera | 96.7 | |
| 4htf_A | 285 | S-adenosylmethionine-dependent methyltransferase; | 96.68 | |
| 3gjy_A | 317 | Spermidine synthase; APC62791, structural genomics | 96.67 | |
| 2f8l_A | 344 | Hypothetical protein LMO1582; structural genomics, | 96.63 | |
| 2fk8_A | 318 | Methoxy mycolic acid synthase 4; S-adenosylmethion | 96.62 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 96.51 | |
| 3gru_A | 295 | Dimethyladenosine transferase; rossman fold, ribos | 96.49 | |
| 4dzr_A | 215 | Protein-(glutamine-N5) methyltransferase, release | 96.4 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 96.36 | |
| 3lcc_A | 235 | Putative methyl chloride transferase; halide methy | 96.34 | |
| 3iv6_A | 261 | Putative Zn-dependent alcohol dehydrogenase; alpha | 96.26 | |
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 96.24 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 96.23 | |
| 3gu3_A | 284 | Methyltransferase; alpha-beta protein, structural | 96.2 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 96.16 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 96.16 | |
| 3bkx_A | 275 | SAM-dependent methyltransferase; YP_807781.1, cycl | 96.13 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 96.12 | |
| 2pbf_A | 227 | Protein-L-isoaspartate O-methyltransferase beta-A | 96.11 | |
| 2p35_A | 259 | Trans-aconitate 2-methyltransferase; SAM dependent | 96.09 | |
| 2gs9_A | 211 | Hypothetical protein TT1324; methyl transferase, s | 96.08 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 96.07 | |
| 3ccf_A | 279 | Cyclopropane-fatty-acyl-phospholipid synthase; YP_ | 96.06 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 96.05 | |
| 1x19_A | 359 | CRTF-related protein; methyltransferase, bacterioc | 96.04 | |
| 3p9n_A | 189 | Possible methyltransferase (methylase); RV2966C, a | 96.03 | |
| 1qam_A | 244 | ERMC' methyltransferase; rRNA methyltransferase ER | 96.03 | |
| 3tqs_A | 255 | Ribosomal RNA small subunit methyltransferase A; p | 96.02 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 96.0 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 95.98 | |
| 3hm2_A | 178 | Precorrin-6Y C5,15-methyltransferase; alpha-beta-s | 95.95 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 95.91 | |
| 1r18_A | 227 | Protein-L-isoaspartate(D-aspartate)-O-methyltrans; | 95.9 | |
| 3uzu_A | 279 | Ribosomal RNA small subunit methyltransferase A; s | 95.88 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 95.88 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 95.87 | |
| 1pjz_A | 203 | Thiopurine S-methyltransferase; polymorphism, S-ad | 95.87 | |
| 3jwh_A | 217 | HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena | 95.79 | |
| 1ne2_A | 200 | Hypothetical protein TA1320; structural genomics, | 95.78 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 95.78 | |
| 3lkd_A | 542 | Type I restriction-modification system methyltrans | 95.78 | |
| 3vc1_A | 312 | Geranyl diphosphate 2-C-methyltransferase; rossman | 95.76 | |
| 1wy7_A | 207 | Hypothetical protein PH1948; seven-stranded beta s | 95.75 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 95.75 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 95.73 | |
| 3gwz_A | 369 | MMCR; methyltransferase, mitomycin, S-adenosyl met | 95.72 | |
| 3e23_A | 211 | Uncharacterized protein RPA2492; alpha-beta protei | 95.72 | |
| 3orh_A | 236 | Guanidinoacetate N-methyltransferase; structura ge | 95.7 | |
| 3mti_A | 185 | RRNA methylase; SAM-dependent, PSI, MCSG, structur | 95.7 | |
| 3jwg_A | 219 | HEN1, methyltransferase type 12; 1.90A {Clostridiu | 95.69 | |
| 1y8c_A | 246 | S-adenosylmethionine-dependent methyltransferase; | 95.67 | |
| 1ri5_A | 298 | MRNA capping enzyme; methyltransferase, M7G, messe | 95.67 | |
| 1jsx_A | 207 | Glucose-inhibited division protein B; methyltransf | 95.67 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 95.62 | |
| 1nkv_A | 256 | Hypothetical protein YJHP; structural genomics, PS | 95.62 | |
| 3lbf_A | 210 | Protein-L-isoaspartate O-methyltransferase; modifi | 95.61 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 95.6 | |
| 3e05_A | 204 | Precorrin-6Y C5,15-methyltransferase (decarboxyla; | 95.6 | |
| 3evz_A | 230 | Methyltransferase; NYSGXRC, NEW YORK SGX research | 95.59 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 95.58 | |
| 3khk_A | 544 | Type I restriction-modification system methylation | 95.54 | |
| 2okc_A | 445 | Type I restriction enzyme stysji M protein; NP_813 | 95.54 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 95.53 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 95.53 | |
| 1zq9_A | 285 | Probable dimethyladenosine transferase; SGC, struc | 95.53 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 95.53 | |
| 1qyr_A | 252 | KSGA, high level kasugamycin resistance protein, S | 95.51 | |
| 2yxe_A | 215 | Protein-L-isoaspartate O-methyltransferase; rossma | 95.5 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 95.49 | |
| 3eey_A | 197 | Putative rRNA methylase; rRNA methylation, S-adeno | 95.46 | |
| 1l3i_A | 192 | Precorrin-6Y methyltransferase/putative decarboxyl | 95.45 | |
| 1vbf_A | 231 | 231AA long hypothetical protein-L-isoaspartate O- | 95.42 | |
| 3m70_A | 286 | Tellurite resistance protein TEHB homolog; structu | 95.42 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 95.41 | |
| 3mgg_A | 276 | Methyltransferase; NYSGXRC, PSI-II, protein struct | 95.33 | |
| 2ih2_A | 421 | Modification methylase TAQI; DNA, DNA methyltransf | 95.31 | |
| 1u2z_A | 433 | Histone-lysine N-methyltransferase, H3 lysine-79 s | 95.22 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 95.21 | |
| 4e2x_A | 416 | TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s | 95.21 | |
| 4fsd_A | 383 | Arsenic methyltransferase; rossmann fold; 1.75A {C | 95.2 | |
| 3ftd_A | 249 | Dimethyladenosine transferase; KSGA, rossmann-like | 95.16 | |
| 2fhp_A | 187 | Methylase, putative; alpha-beta-alpha sandwich, st | 95.15 | |
| 3adn_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 95.15 | |
| 2gb4_A | 252 | Thiopurine S-methyltransferase; 18204406, thiopuri | 95.11 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 95.11 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 95.1 | |
| 1jg1_A | 235 | PIMT;, protein-L-isoaspartate O-methyltransferase; | 95.08 | |
| 1vl5_A | 260 | Unknown conserved protein BH2331; putative methylt | 95.07 | |
| 3dr5_A | 221 | Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 | 95.05 | |
| 3i53_A | 332 | O-methyltransferase; CO-complex, rossmann-like fol | 95.03 | |
| 1zx0_A | 236 | Guanidinoacetate N-methyltransferase; structural g | 95.03 | |
| 1iy9_A | 275 | Spermidine synthase; rossmann fold, structural gen | 95.02 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 95.0 | |
| 3bwc_A | 304 | Spermidine synthase; SAM, SGPP, structura genomics | 94.99 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 94.97 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 94.95 | |
| 2fca_A | 213 | TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac | 94.95 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 94.91 | |
| 3fzg_A | 200 | 16S rRNA methylase; methyltransferase, plasmid, tr | 94.91 | |
| 3mb5_A | 255 | SAM-dependent methyltransferase; RNA methyltransfe | 94.9 | |
| 1yzh_A | 214 | TRNA (guanine-N(7)-)-methyltransferase; alpha-beta | 94.9 | |
| 3m33_A | 226 | Uncharacterized protein; structural genomics, PSI- | 94.88 | |
| 1ws6_A | 171 | Methyltransferase; structural genomics, riken stru | 94.88 | |
| 3uwp_A | 438 | Histone-lysine N-methyltransferase, H3 lysine-79; | 94.86 | |
| 3u81_A | 221 | Catechol O-methyltransferase; neurotransmitter deg | 94.81 | |
| 3ocj_A | 305 | Putative exported protein; structural genomics, PS | 94.79 | |
| 2esr_A | 177 | Methyltransferase; structural genomics, hypothetic | 94.78 | |
| 3gdh_A | 241 | Trimethylguanosine synthase homolog; M7G, CAP, dim | 94.76 | |
| 3njr_A | 204 | Precorrin-6Y methylase; methyltransferase, decarbo | 94.75 | |
| 2hnk_A | 239 | SAM-dependent O-methyltransferase; modified rossma | 94.74 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 94.72 | |
| 3mq2_A | 218 | 16S rRNA methyltransferase; methyltranferase, ribo | 94.71 | |
| 2avd_A | 229 | Catechol-O-methyltransferase; structural genomics, | 94.71 | |
| 1i9g_A | 280 | Hypothetical protein RV2118C; mtase, adoMet, cryst | 94.69 | |
| 1p91_A | 269 | Ribosomal RNA large subunit methyltransferase A; R | 94.68 | |
| 2pwy_A | 258 | TRNA (adenine-N(1)-)-methyltransferase; mtase, ado | 94.66 | |
| 3ntv_A | 232 | MW1564 protein; rossmann fold, putative methyltran | 94.66 | |
| 1inl_A | 296 | Spermidine synthase; beta-barrel, rossman fold, st | 94.64 | |
| 1uir_A | 314 | Polyamine aminopropyltransferase; spermidien synth | 94.6 | |
| 3c3p_A | 210 | Methyltransferase; NP_951602.1, structural genomic | 94.57 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 94.54 | |
| 2b25_A | 336 | Hypothetical protein; structural genomics, methyl | 94.53 | |
| 2o07_A | 304 | Spermidine synthase; structural genomics, structur | 94.51 | |
| 2i7c_A | 283 | Spermidine synthase; transferase, structural genom | 94.49 | |
| 1tw3_A | 360 | COMT, carminomycin 4-O-methyltransferase; anthracy | 94.49 | |
| 3dxy_A | 218 | TRNA (guanine-N(7)-)-methyltransferase; rossmann f | 94.48 | |
| 2kw5_A | 202 | SLR1183 protein; structural genomics, northeast st | 94.47 | |
| 3tr6_A | 225 | O-methyltransferase; cellular processes; HET: SAH; | 94.47 | |
| 1o54_A | 277 | SAM-dependent O-methyltransferase; TM0748, structu | 94.46 | |
| 2gpy_A | 233 | O-methyltransferase; structural genomics, PSI, pro | 94.45 | |
| 1qzz_A | 374 | RDMB, aclacinomycin-10-hydroxylase; anthracycline, | 94.43 | |
| 2avn_A | 260 | Ubiquinone/menaquinone biosynthesis methyltransfe | 94.43 | |
| 4dcm_A | 375 | Ribosomal RNA large subunit methyltransferase G; 2 | 94.4 | |
| 3ege_A | 261 | Putative methyltransferase from antibiotic biosyn | 94.38 | |
| 3g2m_A | 299 | PCZA361.24; SAM-dependent methyltransferase, glyco | 94.37 | |
| 3duw_A | 223 | OMT, O-methyltransferase, putative; alternating of | 94.36 | |
| 1fbn_A | 230 | MJ fibrillarin homologue; MJ proteins, ribosomal R | 94.36 | |
| 3d2l_A | 243 | SAM-dependent methyltransferase; ZP_00538691.1, st | 94.35 | |
| 2h1r_A | 299 | Dimethyladenosine transferase, putative; SGC toron | 94.35 | |
| 1i4w_A | 353 | Mitochondrial replication protein MTF1; mitochondr | 94.34 | |
| 3c3y_A | 237 | Pfomt, O-methyltransferase; plant secondary metabo | 94.33 | |
| 1o9g_A | 250 | RRNA methyltransferase; antibiotic resistance, Se- | 94.32 | |
| 2yvl_A | 248 | TRMI protein, hypothetical protein; tRNA, methyltr | 94.32 | |
| 2b2c_A | 314 | Spermidine synthase; beta-alpha, transferase; 2.50 | 94.29 | |
| 3cc8_A | 230 | Putative methyltransferase; structural genomics, j | 94.28 | |
| 4gqb_A | 637 | Protein arginine N-methyltransferase 5; TIM barrel | 94.27 | |
| 2ozv_A | 260 | Hypothetical protein ATU0636; structural genomics, | 94.25 | |
| 3q87_B | 170 | N6 adenine specific DNA methylase; SAM-methyltrans | 94.23 | |
| 1xj5_A | 334 | Spermidine synthase 1; structural genomics, protei | 94.22 | |
| 1sui_A | 247 | Caffeoyl-COA O-methyltransferase; rossmann fold, p | 94.16 | |
| 4df3_A | 233 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 94.13 | |
| 1g8a_A | 227 | Fibrillarin-like PRE-rRNA processing protein; rRNA | 94.12 | |
| 3bgv_A | 313 | MRNA CAP guanine-N7 methyltransferase; alternative | 94.06 | |
| 3mcz_A | 352 | O-methyltransferase; adomet_mtases, S-adenosylmeth | 94.06 | |
| 2vdw_A | 302 | Vaccinia virus capping enzyme D1 subunit; nucleoti | 94.0 | |
| 1xdz_A | 240 | Methyltransferase GIDB; MCSG, protein structure in | 93.9 | |
| 3tfw_A | 248 | Putative O-methyltransferase; PSI-biology, nysgrc, | 93.9 | |
| 2pt6_A | 321 | Spermidine synthase; transferase, structural genom | 93.88 | |
| 1i1n_A | 226 | Protein-L-isoaspartate O-methyltransferase; S-aden | 93.84 | |
| 3g07_A | 292 | 7SK snRNA methylphosphate capping enzyme; structur | 93.84 | |
| 2ar0_A | 541 | M.ecoki, type I restriction enzyme ecoki M protein | 93.84 | |
| 2b3t_A | 276 | Protein methyltransferase HEMK; translation termin | 93.82 | |
| 3ggd_A | 245 | SAM-dependent methyltransferase; YP_325210.1, stru | 93.77 | |
| 1ej0_A | 180 | FTSJ; methyltransferase, adoMet, adenosyl methioni | 93.76 | |
| 1mjf_A | 281 | Spermidine synthase; spermidine synthetase, struct | 93.74 | |
| 1nt2_A | 210 | Fibrillarin-like PRE-rRNA processing protein; adeM | 93.71 | |
| 3ckk_A | 235 | TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- | 93.7 | |
| 3cbg_A | 232 | O-methyltransferase; cyanobacterium; HET: SAH FER | 93.69 | |
| 1dl5_A | 317 | Protein-L-isoaspartate O-methyltransferase; isoasp | 93.68 | |
| 4azs_A | 569 | Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 | 93.67 | |
| 2h00_A | 254 | Methyltransferase 10 domain containing protein; st | 93.65 | |
| 3lst_A | 348 | CALO1 methyltransferase; calicheamicin, enediyne, | 93.62 | |
| 1nv8_A | 284 | HEMK protein; class I adoMet-dependent methyltrans | 93.61 | |
| 1af7_A | 274 | Chemotaxis receptor methyltransferase CHER; chemot | 93.61 | |
| 2vdv_E | 246 | TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl | 93.47 | |
| 3dmg_A | 381 | Probable ribosomal RNA small subunit methyltransf; | 93.46 | |
| 2cmg_A | 262 | Spermidine synthase; transferase, putrescine amino | 93.45 | |
| 2plw_A | 201 | Ribosomal RNA methyltransferase, putative; malaria | 93.3 | |
| 3tm4_A | 373 | TRNA (guanine N2-)-methyltransferase TRM14; rossma | 93.27 | |
| 2p8j_A | 209 | S-adenosylmethionine-dependent methyltransferase; | 93.26 | |
| 1yb2_A | 275 | Hypothetical protein TA0852; structural genomics, | 93.23 | |
| 2fpo_A | 202 | Methylase YHHF; structural genomics, putative meth | 93.19 | |
| 2ipx_A | 233 | RRNA 2'-O-methyltransferase fibrillarin; FBL, stru | 93.06 | |
| 2pjd_A | 343 | Ribosomal RNA small subunit methyltransferase C; g | 93.02 | |
| 3bzb_A | 281 | Uncharacterized protein; RED ALGA, protein structu | 93.0 | |
| 2r3s_A | 335 | Uncharacterized protein; methyltransferase domain, | 92.91 | |
| 2nxc_A | 254 | L11 mtase, ribosomal protein L11 methyltransferase | 92.9 | |
| 2ift_A | 201 | Putative methylase HI0767; NESG, Y767_haein, struc | 92.89 | |
| 2ip2_A | 334 | Probable phenazine-specific methyltransferase; pyo | 92.82 | |
| 2y1w_A | 348 | Histone-arginine methyltransferase CARM1; histone | 92.82 | |
| 3g89_A | 249 | Ribosomal RNA small subunit methyltransferase G; 1 | 92.63 | |
| 2bm8_A | 236 | Cephalosporin hydroxylase CMCI; cephamycin biosynt | 92.48 | |
| 3lpm_A | 259 | Putative methyltransferase; structural genomics, p | 92.47 | |
| 2a14_A | 263 | Indolethylamine N-methyltransferase; SGC,INMT, str | 92.44 | |
| 3fpf_A | 298 | Mtnas, putative uncharacterized protein; thermonic | 92.42 | |
| 1fp1_D | 372 | Isoliquiritigenin 2'-O-methyltransferase; protein- | 92.38 | |
| 3reo_A | 368 | (ISO)eugenol O-methyltransferase; directed evoluti | 92.31 | |
| 3id6_C | 232 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 92.3 | |
| 2i62_A | 265 | Nicotinamide N-methyltransferase; structural genom | 92.18 | |
| 3ufb_A | 530 | Type I restriction-modification system methyltran | 92.16 | |
| 1fp2_A | 352 | Isoflavone O-methyltransferase; protein-product co | 92.08 | |
| 2fyt_A | 340 | Protein arginine N-methyltransferase 3; structural | 92.0 | |
| 3s1s_A | 878 | Restriction endonuclease bpusi; PD--(D/E)XK cataly | 92.0 | |
| 3p2e_A | 225 | 16S rRNA methylase; methyltransferase, transferase | 91.98 | |
| 1yub_A | 245 | Ermam, rRNA methyltransferase; MLS antibiotics; NM | 91.93 | |
| 3r3h_A | 242 | O-methyltransferase, SAM-dependent; structural gen | 91.92 | |
| 3kr9_A | 225 | SAM-dependent methyltransferase; class I rossmann- | 91.91 | |
| 4hg2_A | 257 | Methyltransferase type 11; structural genomics, PS | 91.85 | |
| 3opn_A | 232 | Putative hemolysin; structural genomics, PSI-2, pr | 91.52 | |
| 3lec_A | 230 | NADB-rossmann superfamily protein; PSI, MCSG, stru | 91.12 | |
| 2nyu_A | 196 | Putative ribosomal RNA methyltransferase 2; SAM, s | 91.1 | |
| 3p9c_A | 364 | Caffeic acid O-methyltransferase; S-adenosylmethio | 91.04 | |
| 3gnl_A | 244 | Uncharacterized protein, DUF633, LMOF2365_1472; st | 90.83 | |
| 3r0q_C | 376 | Probable protein arginine N-methyltransferase 4.2; | 90.73 | |
| 2qfm_A | 364 | Spermine synthase; spermidine aminopropyltransfera | 90.71 | |
| 3frh_A | 253 | 16S rRNA methylase; methyltransferase domain, heli | 90.65 | |
| 3tma_A | 354 | Methyltransferase; thump domain; 2.05A {Thermus th | 90.65 | |
| 1zg3_A | 358 | Isoflavanone 4'-O-methyltransferase; rossman fold, | 90.44 | |
| 3ldu_A | 385 | Putative methylase; structural genomics, PSI-2, pr | 90.42 | |
| 3dp7_A | 363 | SAM-dependent methyltransferase; structural genomi | 90.31 | |
| 3ajd_A | 274 | Putative methyltransferase MJ0026; tRNA, M5C, ross | 90.11 | |
| 1g6q_1 | 328 | HnRNP arginine N-methyltransferase; SAM-binding do | 90.1 | |
| 3k0b_A | 393 | Predicted N6-adenine-specific DNA methylase; methy | 90.03 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 89.97 | |
| 4hc4_A | 376 | Protein arginine N-methyltransferase 6; HRMT1L6, S | 89.91 | |
| 3q7e_A | 349 | Protein arginine N-methyltransferase 1; HET: SAH; | 89.59 | |
| 2qe6_A | 274 | Uncharacterized protein TFU_2867; putative methylt | 89.53 | |
| 2k4m_A | 153 | TR8_protein, UPF0146 protein MTH_1000; alpha+beta, | 89.16 | |
| 3ua3_A | 745 | Protein arginine N-methyltransferase 5; TIM-barrel | 88.99 | |
| 2g72_A | 289 | Phenylethanolamine N-methyltransferase; HET: SAM F | 88.91 | |
| 3ldg_A | 384 | Putative uncharacterized protein SMU.472; YPSC, me | 88.91 | |
| 1vlm_A | 219 | SAM-dependent methyltransferase; possible histamin | 88.89 | |
| 1m6y_A | 301 | S-adenosyl-methyltransferase MRAW; SAM-dependent m | 88.33 | |
| 3b3j_A | 480 | Histone-arginine methyltransferase CARM1; protein | 88.3 | |
| 3a27_A | 272 | TYW2, uncharacterized protein MJ1557; wybutosine m | 88.05 | |
| 2igt_A | 332 | SAM dependent methyltransferase; alpha-beta sandwi | 87.89 | |
| 2frn_A | 278 | Hypothetical protein PH0793; structural genomics, | 87.66 | |
| 1uwv_A | 433 | 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m | 87.65 | |
| 2zig_A | 297 | TTHA0409, putative modification methylase; methylt | 87.59 | |
| 2zfu_A | 215 | Nucleomethylin, cerebral protein 1; nucleolar prot | 87.55 | |
| 3dou_A | 191 | Ribosomal RNA large subunit methyltransferase J; c | 87.12 | |
| 4a6d_A | 353 | Hydroxyindole O-methyltransferase; melatonin, circ | 86.29 | |
| 2qy6_A | 257 | UPF0209 protein YFCK; structural genomics, unknown | 86.22 | |
| 3lcv_B | 281 | Sisomicin-gentamicin resistance methylase SGM; ant | 85.03 | |
| 2jjq_A | 425 | Uncharacterized RNA methyltransferase pyrab10780; | 84.98 | |
| 3hp7_A | 291 | Hemolysin, putative; structural genomics, APC64019 | 84.71 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 84.48 | |
| 1ixk_A | 315 | Methyltransferase; open beta sheet; 1.90A {Pyrococ | 84.15 | |
| 3bt7_A | 369 | TRNA (uracil-5-)-methyltransferase; methyluridine, | 82.7 | |
| 3o4f_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 81.25 | |
| 1wxx_A | 382 | TT1595, hypothetical protein TTHA1280; thermus the | 81.17 | |
| 1sqg_A | 429 | SUN protein, FMU protein; rossmann-fold, mixed bet | 80.58 |
| >1zkd_A DUF185; NESG, RPR58, structural genomics, PSI, protein structure INI northeast structural genomics consortium, unknown function; 2.10A {Rhodopseudomonas palustris} SCOP: c.66.1.52 | Back alignment and structure |
|---|
Probab=100.00 E-value=6.8e-60 Score=463.22 Aligned_cols=197 Identities=40% Similarity=0.789 Sum_probs=177.4
Q ss_pred chHHHHHHHHHHHHhcCCcccHHHHHHHhhcCCCCcccCCCCCCCCCCCeecCCChhHHHHHHHHHHHHHHHHHcCCCCc
Q 020840 82 LESELVKHLKGIIKFRGGPISVAEYMEEVLTNPKAGFYINRDVFGAEGDFITSPEVSQMFGEMVGVWAMCLWEQMGQPNR 161 (320)
Q Consensus 82 ~~~~L~~~i~~~I~~~~GpIsf~dfM~~aLY~P~~GYY~~~~~~G~~GDFiTSpEIsp~FGe~IA~~i~~~w~~~g~p~~ 161 (320)
+++.|.++|+++|+.+ |||||++||++|||||++|||+++++||+.|||||||||||+|||+||+|++++|+.+|.|.+
T Consensus 3 ~~~~L~~~i~~~I~~~-G~i~f~~fM~~aLy~P~~GYY~~~~~~G~~GDF~Tapeis~~FGe~la~~~~~~w~~~g~p~~ 81 (387)
T 1zkd_A 3 DQTALATEIKRLIKAA-GPMPVWRYMELCLGHPEHGYYVTRDPLGREGDFTTSPEISQMFGELLGLWSASVWKAADEPQT 81 (387)
T ss_dssp CSSHHHHHHHHHHHHH-CSEEHHHHHHHHHHCTTTCTTTCC--------CCSHHHHCHHHHHHHHHHHHHHHHHTTCCSS
T ss_pred chHHHHHHHHHHHHhc-CCeeHHHHHHHHhcCCCCcccCCCCCCCCCCCeeCCCchHHHHHHHHHHHHHHHHHHcCCCCC
Confidence 3567999999999986 899999999999999999999998899999999999999999999999999999999999999
Q ss_pred ceEEEecCCchhHHHHHHHHHhcCcCcccceeEEEEecChhhHHHHHHhccccccCCcCcccchhhhcccCCCCeEeecc
Q 020840 162 VNLVELGPGRGTLMADLLRGASKFKNFTESLHIHLVECSPTLQKLQHHNLKCMDENNANDNVEERTISSLAGTPVSWHAA 241 (320)
Q Consensus 162 l~IvEiGaG~GtLa~DIL~~l~~~p~~~~~l~y~iVE~Sp~Lr~~Q~e~L~~~~~~~~~~~~~~~~~~~~~~~~i~W~~s 241 (320)
++|||+|||+|+||.|||++++..|+++.+++|+|||+||.|+++|+++|+.. .+|.|+++
T Consensus 82 ~~ivElGaG~GtLa~diL~~l~~~p~~~~~~~y~iVE~Sp~Lr~~Q~~~L~~~-------------------~~v~W~~~ 142 (387)
T 1zkd_A 82 LRLIEIGPGRGTMMADALRALRVLPILYQSLSVHLVEINPVLRQKQQTLLAGI-------------------RNIHWHDS 142 (387)
T ss_dssp EEEEEECCTTSHHHHHHHHHHTTSHHHHTTEEEEEECCCHHHHHHHHHHSTTC-------------------SSEEEESS
T ss_pred cEEEEECCCcchHHHHHHHHHHhCCccccccEEEEEecCHHHHHHHHHHhcCC-------------------CCeEEeCC
Confidence 99999999999999999999998899999999999999999999999999741 16999999
Q ss_pred cccCCCCCCEEEEEecccccccceeEEEeCCeeEEEEEEEcCCCceEEEeecCCCccc
Q 020840 242 LEQVPSGFPTIIVAHEFYDALPVHQFQKTTRGWCEKLVDIAEDSSLHQQLSFCCSAAS 299 (320)
Q Consensus 242 leelp~~~~~~iiANE~fDALPv~~f~~~~~~w~E~~V~v~~~g~f~~v~~p~~~~~~ 299 (320)
++++|.+ +|||||||||||||||+|++++++|+|++|+++++|+|.|+..|.+++..
T Consensus 143 l~~lp~~-~~~viANE~fDAlPv~~~~~~~~~w~E~~V~~~~~g~~~~~~~~~~~~~~ 199 (387)
T 1zkd_A 143 FEDVPEG-PAVILANEYFDVLPIHQAIKRETGWHERVIEIGASGELVFGVAADPIPGF 199 (387)
T ss_dssp GGGSCCS-SEEEEEESSGGGSCCEEEEEETTEEEEEEEEECTTSCEEEEECSSCCTTC
T ss_pred hhhcCCC-CeEEEeccccccCceEEEEecCCeEEEEEEEECCCCcEEEecCCCCchhh
Confidence 9999987 99999999999999999999999999999999888889999998777643
|
| >4f3n_A Uncharacterized ACR, COG1565 superfamily; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.75A {Burkholderia thailandensis} PDB: 4g67_A* | Back alignment and structure |
|---|
| >4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* | Back alignment and structure |
|---|
| >1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* | Back alignment and structure |
|---|
| >3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* | Back alignment and structure |
|---|
| >3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} | Back alignment and structure |
|---|
| >2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* | Back alignment and structure |
|---|
| >2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 | Back alignment and structure |
|---|
| >4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* | Back alignment and structure |
|---|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* | Back alignment and structure |
|---|
| >4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* | Back alignment and structure |
|---|
| >3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* | Back alignment and structure |
|---|
| >3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A | Back alignment and structure |
|---|
| >3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 | Back alignment and structure |
|---|
| >3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A | Back alignment and structure |
|---|
| >1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A | Back alignment and structure |
|---|
| >3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* | Back alignment and structure |
|---|
| >1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* | Back alignment and structure |
|---|
| >3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* | Back alignment and structure |
|---|
| >3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A | Back alignment and structure |
|---|
| >1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* | Back alignment and structure |
|---|
| >1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 | Back alignment and structure |
|---|
| >3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* | Back alignment and structure |
|---|
| >3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 | Back alignment and structure |
|---|
| >3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* | Back alignment and structure |
|---|
| >1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A | Back alignment and structure |
|---|
| >2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* | Back alignment and structure |
|---|
| >1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* | Back alignment and structure |
|---|
| >3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* | Back alignment and structure |
|---|
| >1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* | Back alignment and structure |
|---|
| >4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A | Back alignment and structure |
|---|
| >3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* | Back alignment and structure |
|---|
| >2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* | Back alignment and structure |
|---|
| >1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* | Back alignment and structure |
|---|
| >1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* | Back alignment and structure |
|---|
| >1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* | Back alignment and structure |
|---|
| >1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* | Back alignment and structure |
|---|
| >3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... | Back alignment and structure |
|---|
| >3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* | Back alignment and structure |
|---|
| >3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} | Back alignment and structure |
|---|
| >2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 | Back alignment and structure |
|---|
| >1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 | Back alignment and structure |
|---|
| >2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* | Back alignment and structure |
|---|
| >1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* | Back alignment and structure |
|---|
| >3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* | Back alignment and structure |
|---|
| >2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* | Back alignment and structure |
|---|
| >2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* | Back alignment and structure |
|---|
| >1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* | Back alignment and structure |
|---|
| >3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* | Back alignment and structure |
|---|
| >2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A | Back alignment and structure |
|---|
| >3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* | Back alignment and structure |
|---|
| >2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* | Back alignment and structure |
|---|
| >3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* | Back alignment and structure |
|---|
| >1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A | Back alignment and structure |
|---|
| >3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} | Back alignment and structure |
|---|
| >2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} | Back alignment and structure |
|---|
| >1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A | Back alignment and structure |
|---|
| >2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} | Back alignment and structure |
|---|
| >4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* | Back alignment and structure |
|---|
| >2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A | Back alignment and structure |
|---|
| >1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* | Back alignment and structure |
|---|
| >4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A | Back alignment and structure |
|---|
| >3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* | Back alignment and structure |
|---|
| >3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} | Back alignment and structure |
|---|
| >1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* | Back alignment and structure |
|---|
| >1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* | Back alignment and structure |
|---|
| >3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* | Back alignment and structure |
|---|
| >2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* | Back alignment and structure |
|---|
| >1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* | Back alignment and structure |
|---|
| >1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 | Back alignment and structure |
|---|
| >3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} | Back alignment and structure |
|---|
| >1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 | Back alignment and structure |
|---|
| >4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* | Back alignment and structure |
|---|
| >2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 | Back alignment and structure |
|---|
| >3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* | Back alignment and structure |
|---|
| >1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* | Back alignment and structure |
|---|
| >2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E | Back alignment and structure |
|---|
| >3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* | Back alignment and structure |
|---|
| >2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A | Back alignment and structure |
|---|
| >2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* | Back alignment and structure |
|---|
| >2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* | Back alignment and structure |
|---|
| >2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A | Back alignment and structure |
|---|
| >3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* | Back alignment and structure |
|---|
| >2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* | Back alignment and structure |
|---|
| >3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 | Back alignment and structure |
|---|
| >3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* | Back alignment and structure |
|---|
| >1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* | Back alignment and structure |
|---|
| >3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* | Back alignment and structure |
|---|
| >3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* | Back alignment and structure |
|---|
| >2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* | Back alignment and structure |
|---|
| >3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* | Back alignment and structure |
|---|
| >2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* | Back alignment and structure |
|---|
| >3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} | Back alignment and structure |
|---|
| >3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* | Back alignment and structure |
|---|
| >1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* | Back alignment and structure |
|---|
| >4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} | Back alignment and structure |
|---|
| >3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* | Back alignment and structure |
|---|
| >3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* | Back alignment and structure |
|---|
| >3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* | Back alignment and structure |
|---|
| >3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A | Back alignment and structure |
|---|
| >1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 | Back alignment and structure |
|---|
| >3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} | Back alignment and structure |
|---|
| >3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* | Back alignment and structure |
|---|
| >2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} | Back alignment and structure |
|---|
| >2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} | Back alignment and structure |
|---|
| >3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A | Back alignment and structure |
|---|
| >2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... | Back alignment and structure |
|---|
| >3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* | Back alignment and structure |
|---|
| >3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 | Back alignment and structure |
|---|
| >2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* | Back alignment and structure |
|---|
| >2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A | Back alignment and structure |
|---|
| >2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* | Back alignment and structure |
|---|
| >2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* | Back alignment and structure |
|---|
| >2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* | Back alignment and structure |
|---|
| >3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} | Back alignment and structure |
|---|
| >3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* | Back alignment and structure |
|---|
| >1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 320 | ||||
| d1zkda1 | 365 | c.66.1.52 (A:2-366) Hypothetical protein RPA4359 { | 1e-43 |
| >d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]} Length = 365 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: RPA4359-like domain: Hypothetical protein RPA4359 species: Rhodopseudomonas palustris [TaxId: 1076]
Score = 151 bits (382), Expect = 1e-43
Identities = 79/213 (37%), Positives = 120/213 (56%), Gaps = 21/213 (9%)
Query: 83 ESELVKHLKGIIKFRGGPISVAEYMEEVLTNPKAGFYINRDVFGAEGDFITSPEVSQMFG 142
++ L +K +IK GP+ V YME L +P+ G+Y+ RD G EGDF TSPE+SQMFG
Sbjct: 3 QTALATEIKRLIK-AAGPMPVWRYMELCLGHPEHGYYVTRDPLGREGDFTTSPEISQMFG 61
Query: 143 EMVGVWAMCLWEQMGQPNRVNLVELGPGRGTLMADLLRGASKFKNFTESLHIHLVECSPT 202
E++G+W+ +W+ +P + L+E+GPGRGT+MAD LR +SL +HLVE +P
Sbjct: 62 ELLGLWSASVWKAADEPQTLRLIEIGPGRGTMMADALRALRVLPILYQSLSVHLVEINPV 121
Query: 203 LQKLQHHNLKCMDENNANDNVEERTISSLAGTPVSWHAALEQVPSGFPTIIVAHEFYDAL 262
L++ Q L + + WH + E VP G P +I+A+E++D L
Sbjct: 122 LRQKQQTLLAGIR-------------------NIHWHDSFEDVPEG-PAVILANEYFDVL 161
Query: 263 PVHQFQKTTRGWCEKLVDIAEDSSLHQQLSFCC 295
P+HQ K GW E++++I L ++
Sbjct: 162 PIHQAIKRETGWHERVIEIGASGELVFGVAADP 194
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 320 | |||
| d1zkda1 | 365 | Hypothetical protein RPA4359 {Rhodopseudomonas pal | 100.0 | |
| d1qama_ | 235 | rRNA adenine dimethylase {Bacillus subtilis, Ermc' | 97.35 | |
| d1im8a_ | 225 | Hypothetical protein HI0319 (YecO) {Haemophilus in | 97.31 | |
| d1wzna1 | 251 | Hypothetical methyltransferase PH1305 {Archaeon Py | 97.25 | |
| d1wy7a1 | 201 | Hypothetical protein PH1948 {Archaeon Pyrococcus h | 97.24 | |
| d2o57a1 | 282 | Putative sarcosine dimethylglycine methyltransfera | 97.22 | |
| d1jqea_ | 280 | Histamine methyltransferase {Human (Homo sapiens) | 97.15 | |
| d1vl5a_ | 231 | Hypothetical protein BH2331 {Bacillus halodurans [ | 97.03 | |
| d1ne2a_ | 197 | Hypothetical protein Ta1320 {Archaeon Thermoplasma | 96.95 | |
| d1ve3a1 | 226 | Hypothetical protein PH0226 {Archaeon Pyrococcus h | 96.86 | |
| d1pjza_ | 201 | Thiopurine S-methyltransferase {Pseudomonas syring | 96.85 | |
| d1zq9a1 | 278 | Probable dimethyladenosine transferase {Human (Hom | 96.62 | |
| d1yuba_ | 245 | rRNA adenine dimethylase {Streptococcus pneumoniae | 96.54 | |
| d2f8la1 | 328 | Hypothetical protein Lmo1582 {Listeria monocytogen | 96.53 | |
| d2gh1a1 | 281 | Methyltransferase BC2162 {Bacillus cereus [TaxId: | 96.5 | |
| d1dusa_ | 194 | Hypothetical protein MJ0882 {Archaeon Methanococcu | 96.41 | |
| d1xxla_ | 234 | Hypothetical protein YcgJ {Bacillus subtilis [TaxI | 96.35 | |
| d2ex4a1 | 222 | Adrenal gland protein AD-003 (C9orf32) {Human (Hom | 96.3 | |
| d2i6ga1 | 198 | Putative methyltransferase TehB {Salmonella typhim | 96.3 | |
| d1xtpa_ | 254 | Hypothetical protein Lmaj004091aaa (LmjF30.0810) { | 96.28 | |
| d1nkva_ | 245 | Hypothetical Protein YjhP {Escherichia coli [TaxId | 96.12 | |
| d2p7ia1 | 225 | Hypothetical protein ECA1738 {Erwinia carotovora [ | 96.12 | |
| d1zx0a1 | 229 | Guanidinoacetate methyltransferase {Human (Homo sa | 96.03 | |
| d2avna1 | 246 | Hypothetical methyltransferase TM1389 {Thermotoga | 95.93 | |
| d1qyra_ | 252 | High level kasugamycin resistance protein KsgA {Es | 95.92 | |
| d1i4wa_ | 322 | Transcription factor sc-mtTFB {Baker's yeast (Sacc | 95.84 | |
| d1p91a_ | 268 | rRNA methyltransferase RlmA {Escherichia coli [Tax | 95.8 | |
| d1r18a_ | 223 | Protein-L-isoaspartyl O-methyltransferase {Fruit f | 95.8 | |
| d1xvaa_ | 292 | Glycine N-methyltransferase {Rat (Rattus norvegicu | 95.79 | |
| d2fk8a1 | 280 | Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri | 95.67 | |
| d1u2za_ | 406 | Catalytic, N-terminal domain of histone methyltran | 95.61 | |
| d1y8ca_ | 246 | Putative methyltransferase CAC2371 {Clostridium ac | 95.6 | |
| d1dl5a1 | 213 | Protein-L-isoaspartyl O-methyltransferase {Thermot | 95.55 | |
| d1i1na_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Human ( | 95.5 | |
| d1yb2a1 | 250 | Hypothetical protein Ta0852 {Thermoplasma acidophi | 95.36 | |
| d2bzga1 | 229 | Thiopurine S-methyltransferase {Human (Homo sapien | 95.28 | |
| d1qzza2 | 256 | Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu | 95.24 | |
| d1g8sa_ | 230 | Fibrillarin homologue {Archaeon Methanococcus jann | 95.11 | |
| d1o54a_ | 266 | Hypothetical protein TM0748 {Thermotoga maritima [ | 95.01 | |
| d2nxca1 | 254 | PrmA-like protein TTHA0656 (TT0836) {Thermus therm | 94.98 | |
| d1i9ga_ | 264 | Probable methyltransferase Rv2118c {Mycobacterium | 94.91 | |
| d1g8aa_ | 227 | Fibrillarin homologue {Archaeon Pyrococcus horikos | 94.73 | |
| d1tw3a2 | 253 | Carminomycin 4-O-methyltransferase {Streptomyces p | 94.72 | |
| d1l3ia_ | 186 | Precorrin-6Y methyltransferase (CbiT) {Archaeon Me | 94.65 | |
| d1nw3a_ | 328 | Catalytic, N-terminal domain of histone methyltran | 94.61 | |
| d1kpia_ | 291 | CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | 94.6 | |
| d2b3ta1 | 274 | N5-glutamine methyltransferase, HemK {Escherichia | 94.53 | |
| d1vbfa_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Sulfolo | 94.47 | |
| d1nt2a_ | 209 | Fibrillarin homologue {Archaeon Archaeoglobus fulg | 94.32 | |
| d1ri5a_ | 252 | mRNA cap (Guanine N-7) methyltransferase {Fungus ( | 94.04 | |
| d1jg1a_ | 215 | Protein-L-isoaspartyl O-methyltransferase {Archaeo | 94.02 | |
| d2b25a1 | 324 | Hypothetical protein FLJ20628 {Human (Homo sapiens | 93.93 | |
| d1vlma_ | 208 | Possible histamine N-methyltransferase TM1293 {The | 93.91 | |
| d2okca1 | 425 | Type I restriction enzyme StySJI M protein {Bacter | 93.51 | |
| d2cl5a1 | 214 | Catechol O-methyltransferase, COMT {Rat (Rattus no | 93.08 | |
| d2g72a1 | 263 | Phenylethanolamine N-methyltransferase, PNMTase {H | 92.96 | |
| d2ih2a1 | 223 | DNA methylase TaqI, N-terminal domain {Thermus aqu | 92.69 | |
| d1ws6a1 | 171 | Methyltransferase TTHA0928 {Thermus thermophilus [ | 92.41 | |
| d2a14a1 | 257 | Indolethylamine N-methyltransferase, INMT {Human ( | 92.09 | |
| d2fcaa1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil | 91.8 | |
| d1kpga_ | 285 | CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | 91.32 | |
| d2esra1 | 152 | Putative methyltransferase SPy1538 {Streptococcus | 91.31 | |
| d1yzha1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep | 91.29 | |
| d2avda1 | 219 | COMT domain-containing protein 1, COMTD1 {Human (H | 91.22 | |
| d2fyta1 | 311 | Protein arginine N-methyltransferase 3, PRMT3 {Hum | 91.1 | |
| d1nv8a_ | 271 | N5-glutamine methyltransferase, HemK {Thermotoga m | 90.74 | |
| d2h00a1 | 250 | Methyltransferase 10 domain containing protein MET | 89.66 | |
| d1oria_ | 316 | Protein arginine N-methyltransferase 1, PRMT1 {Rat | 88.62 | |
| d2ar0a1 | 524 | M.EcoKI {Escherichia coli [TaxId: 562]} | 87.71 | |
| d1uira_ | 312 | Spermidine synthase {Thermus thermophilus [TaxId: | 87.51 | |
| d1g6q1_ | 328 | Arginine methyltransferase, HMT1 {Baker's yeast (S | 87.03 | |
| d2fpoa1 | 183 | Methylase YhhF {Escherichia coli [TaxId: 562]} | 85.97 | |
| d1susa1 | 227 | Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag | 84.77 | |
| d1fp1d2 | 244 | Chalcone O-methyltransferase {Alfalfa (Medicago sa | 84.7 | |
| d1kyza2 | 243 | Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra | 84.31 | |
| d1iy9a_ | 274 | Spermidine synthase {Bacillus subtilis [TaxId: 142 | 83.49 | |
| d1inla_ | 295 | Spermidine synthase {Thermotoga maritima [TaxId: 2 | 81.64 | |
| d1mjfa_ | 276 | Putative spermidine synthetase PF0127 (SpeE) {Arch | 81.39 | |
| d2o07a1 | 285 | Spermidine synthase {Human (Homo sapiens) [TaxId: | 80.49 |
| >d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: RPA4359-like domain: Hypothetical protein RPA4359 species: Rhodopseudomonas palustris [TaxId: 1076]
Probab=100.00 E-value=5e-57 Score=434.82 Aligned_cols=198 Identities=40% Similarity=0.789 Sum_probs=176.2
Q ss_pred hHHHHHHHHHHHHhcCCcccHHHHHHHhhcCCCCcccCCCCCCCCCCCeecCCChhHHHHHHHHHHHHHHHHHcCCCCcc
Q 020840 83 ESELVKHLKGIIKFRGGPISVAEYMEEVLTNPKAGFYINRDVFGAEGDFITSPEVSQMFGEMVGVWAMCLWEQMGQPNRV 162 (320)
Q Consensus 83 ~~~L~~~i~~~I~~~~GpIsf~dfM~~aLY~P~~GYY~~~~~~G~~GDFiTSpEIsp~FGe~IA~~i~~~w~~~g~p~~l 162 (320)
.+.|.+.|+++|++. |||||++||++|||||++|||+++.+||++||||||||+||+||++||+|+.+.|+.++.|.++
T Consensus 3 ~~~L~~~i~~~i~~~-G~i~f~~fM~~~LY~p~~GYY~~~~~iG~~GDF~Tsp~is~~Fg~~ia~~~~~~~~~~~~~~~~ 81 (365)
T d1zkda1 3 QTALATEIKRLIKAA-GPMPVWRYMELCLGHPEHGYYVTRDPLGREGDFTTSPEISQMFGELLGLWSASVWKAADEPQTL 81 (365)
T ss_dssp SSHHHHHHHHHHHHH-CSEEHHHHHHHHHHCTTTCTTTCC--------CCSHHHHCHHHHHHHHHHHHHHHHHTTCCSSE
T ss_pred ccHHHHHHHHHHHhc-CCccHHHHHHHHcCCCCccccCCCCCCCCCCCeECCCchHHHHHHHHHHHHHHHHHHhCCCccc
Confidence 368999999999987 9999999999999999999999888999999999999999999999999999999999999999
Q ss_pred eEEEecCCchhHHHHHHHHHhcCcCcccceeEEEEecChhhHHHHHHhccccccCCcCcccchhhhcccCCCCeEeeccc
Q 020840 163 NLVELGPGRGTLMADLLRGASKFKNFTESLHIHLVECSPTLQKLQHHNLKCMDENNANDNVEERTISSLAGTPVSWHAAL 242 (320)
Q Consensus 163 ~IvEiGaG~GtLa~DIL~~l~~~p~~~~~l~y~iVE~Sp~Lr~~Q~e~L~~~~~~~~~~~~~~~~~~~~~~~~i~W~~sl 242 (320)
+|||+|||+|+||+|||++++..|.++..++|++||+||.|++.|+++|... .++.|+.++
T Consensus 82 ~ivE~GaG~G~La~dil~~l~~~~~~~~~~~~~~vE~s~~L~~~Q~~~l~~~-------------------~~i~w~~~~ 142 (365)
T d1zkda1 82 RLIEIGPGRGTMMADALRALRVLPILYQSLSVHLVEINPVLRQKQQTLLAGI-------------------RNIHWHDSF 142 (365)
T ss_dssp EEEEECCTTSHHHHHHHHHHTTSHHHHTTEEEEEECCCHHHHHHHHHHSTTC-------------------SSEEEESSG
T ss_pred eEEecCCcccHHHHhhhhhhcccccccccceEEEeccchhHHHHHHHHhccc-------------------ccceeccCh
Confidence 9999999999999999999998899999999999999999999999998741 368999999
Q ss_pred ccCCCCCCEEEEEecccccccceeEEEeCCeeEEEEEEEcCCCceEEEeecCCCccchh
Q 020840 243 EQVPSGFPTIIVAHEFYDALPVHQFQKTTRGWCEKLVDIAEDSSLHQQLSFCCSAASGL 301 (320)
Q Consensus 243 eelp~~~~~~iiANE~fDALPv~~f~~~~~~w~E~~V~v~~~g~f~~v~~p~~~~~~~~ 301 (320)
+++|.. |+||||||||||||||+|++++++|+|++|.+++++.|.+...+...+....
T Consensus 143 ~~~~~~-~g~iiaNE~fDAlPv~~~~~~~~~~~E~~V~~~~~~~~~~~~~~~~~~~~~~ 200 (365)
T d1zkda1 143 EDVPEG-PAVILANEYFDVLPIHQAIKRETGWHERVIEIGASGELVFGVAADPIPGFEA 200 (365)
T ss_dssp GGSCCS-SEEEEEESSGGGSCCEEEEEETTEEEEEEEEECTTSCEEEEECSSCCTTCGG
T ss_pred hhcccC-CeEEEecccCccccceEEEEcCccceeeeeeecccceeEEeeccccchhHHh
Confidence 999876 8999999999999999999999999999999988888988887766665443
|
| >d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} | Back information, alignment and structure |
|---|
| >d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} | Back information, alignment and structure |
|---|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} | Back information, alignment and structure |
|---|
| >d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|