Citrus Sinensis ID: 020840


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320
MQLRKLSLQPSSPLRVLSSKYPFPLLQKWSRFSSSSSSESQIPNSHSVEPLDDNRSEHASTAISIDRSGLYNPPEHSHERKLESELVKHLKGIIKFRGGPISVAEYMEEVLTNPKAGFYINRDVFGAEGDFITSPEVSQMFGEMVGVWAMCLWEQMGQPNRVNLVELGPGRGTLMADLLRGASKFKNFTESLHIHLVECSPTLQKLQHHNLKCMDENNANDNVEERTISSLAGTPVSWHAALEQVPSGFPTIIVAHEFYDALPVHQFQKTTRGWCEKLVDIAEDSSLHQQLSFCCSAASGLQIKNWRSLSTLRFVQKRWS
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcHHHHHHHHHHHHHHHHccccccHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccEEEEEccccccHHHHHHHHHHHccccccccEEEEccccHHHHHHHHHHcccccccccccccHHHHHcccccccEEEEEccccccccccEEEEEcccccccccEEEEEEccEEEEEEEEEcccccccEEccccccccccHHHHcccccccccHHHHccc
cHHHHHHHcccHHHHHHHcccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHccccccEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHHHHccHHHHHcEEEEEEccHHHHHHHHHHHcccccccccccccEEEccccccccEEEcccHHHccccccEEEEEHHHHHccccHEEEEccccEEEEEEEEcccccEEEEEccccccHHHHHHccHHHHHHHHHHHHHcc
mqlrklslqpssplrvlsskypfpllqkwsrfssssssesqipnshsveplddnrsehaSTAIsidrsglynppehsherKLESELVKHLKGIIKFRGGPISVAEYMEEVltnpkagfyinrdvfgaegdfitspevSQMFGEMVGVWAMCLWEqmgqpnrvnlvelgpgrgtLMADLLRGASKFKNFTESLHIHLVecsptlqklqhhnlkcmdennandnveertisslagtpvswhaaleqvpsgfptIIVAHEFydalpvhqfqkttRGWCEKLVDIAEDSSLHQQLSFCCsaasglqiknwrsLSTLRFVQKRWS
mqlrklslqpssplrvlssKYPFPLLQKWSRFSSSSSSESQIPNSHSVEPLDDNRSEHASTAISIDRSGLYNPPEHSHERKLESELVKHLKGIIKFRGGPISVAEYMEEVLTNPKAGFYINRDVFGAEGDFITSPEVSQMFGEMVGVWAMCLWEQMGQPNRVNLVELGPGRGTLMADLLRGASKFKNFTESLHIHLVECSPTLQKLQHHNLKCMDENNANDNVEERTISSLAGTPVSWHAALEQVPSGFPTIIVAHEFYDALPVHQFQKTTRGWCEKLVDIAEDSSLHQQLSFCCSAasglqiknwrslstlrfvqkrws
MQLRKLSLQPSSPLRVLSSKYPFPLLQKWsrfssssssesqipnshsVEPLDDNRSEHASTAISIDRSGLYNPPEHSHERKLESELVKHLKGIIKFRGGPISVAEYMEEVLTNPKAGFYINRDVFGAEGDFITSPEVSQMFGEMVGVWAMCLWEQMGQPNRVNLVELGPGRGTLMADLLRGASKFKNFTESLHIHLVECSPTLQKLQHHNLKCMDENNANDNVEERTISSLAGTPVSWHAALEQVPSGFPTIIVAHEFYDALPVHQFQKTTRGWCEKLVDIAEDSSLHQQLSFCCSAASGLQIKNWRSLSTLRFVQKRWS
*************************************************************************************LVKHLKGIIKFRGGPISVAEYMEEVLTNPKAGFYINRDVFGAEGDFITSPEVSQMFGEMVGVWAMCLWEQMGQPNRVNLVELGPGRGTLMADLLRGASKFKNFTESLHIHLVECSPTLQKLQHHNLKCM*************ISSLAGTPVSWHAALEQVPSGFPTIIVAHEFYDALPVHQFQKTTRGWCEKLVDIAEDSSLHQQLSFCCSAASGLQIKNWRSLSTLRFVQ****
****************************************************************************************HLKGIIKFRGGPISVAEYMEEVLTNPKAGFYINRDVFGAEGDFITSPEVSQMFGEMVGVWAMCLWEQMGQPNRVNLVELGPGRGTLMADLLRGASKFKNFTESLHIHLVECSPTLQKLQHHNLKCMDENNANDNVEERTISSLAGTPVSWHAALEQVPSGFPTIIVAHEFYDALPVHQFQKTTRGWCEKLVDIAEDSSLHQQLSFCCSAASGLQIKNWRSLSTLR*******
MQLRKLSLQPSSPLRVLSSKYPFPLLQKWS****************************ASTAISIDRSGLY**********LESELVKHLKGIIKFRGGPISVAEYMEEVLTNPKAGFYINRDVFGAEGDFITSPEVSQMFGEMVGVWAMCLWEQMGQPNRVNLVELGPGRGTLMADLLRGASKFKNFTESLHIHLVECSPTLQKLQHHNLKCMDENNANDNVEERTISSLAGTPVSWHAALEQVPSGFPTIIVAHEFYDALPVHQFQKTTRGWCEKLVDIAEDSSLHQQLSFCCSAASGLQIKNWRSLSTLRFVQKRWS
*******LQPSSPLRVLSSKYPFPLLQKW*****************************************************ESELVKHLKGIIKFRGGPISVAEYMEEVLTNPKAGFYINRDVFGAEGDFITSPEVSQMFGEMVGVWAMCLWEQMGQPNRVNLVELGPGRGTLMADLLRGASKFKNFTESLHIHLVECSPTLQKLQHHNLKCMDENNANDNVEERTISSLAGTPVSWHAALEQVPSGFPTIIVAHEFYDALPVHQFQKTTRGWCEKLVDIAEDSSLHQQLSFCCSAASGLQIKNWRSLSTLRFVQKRWS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQLRKLSLQPSSPLRVLSSKYPFPLLQKWSRFSSSSSSESQIPNSHSVEPLDDNRSEHASTAISIDRSGLYNPPEHSHERKLESELVKHLKGIIKFRGGPISVAEYMEEVLTNPKAGFYINRDVFGAEGDFITSPEVSQMFGEMVGVWAMCLWEQMGQPNRVNLVELGPGRGTLMADLLRGASKFKNFTESLHIHLVECSPTLQKLQHHNLKCMDENNANDNVEERTISSLAGTPVSWHAALEQVPSGFPTIIVAHEFYDALPVHQFQKTTRGWCEKLVDIAEDSSLHQQLSFCCSAASGLQIKNWRSLSTLRFVQKRWS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query320 2.2.26 [Sep-21-2011]
Q54S83 484 NADH dehydrogenase [ubiqu yes no 0.818 0.541 0.414 1e-56
Q9VGR2 437 NADH dehydrogenase [ubiqu yes no 0.675 0.494 0.480 6e-51
Q08BY0 422 NADH dehydrogenase [ubiqu yes no 0.609 0.462 0.470 1e-48
Q6GQ37 437 NADH dehydrogenase [ubiqu N/A no 0.706 0.517 0.436 3e-48
Q2KHV5 441 NADH dehydrogenase [ubiqu yes no 0.731 0.530 0.437 4e-48
Q5BKM6 430 NADH dehydrogenase [ubiqu yes no 0.637 0.474 0.471 3e-47
Q9CWG8 436 NADH dehydrogenase [ubiqu yes no 0.743 0.545 0.431 7e-47
Q7L592 441 NADH dehydrogenase [ubiqu yes no 0.659 0.478 0.438 1e-46
Q5XI79 436 NADH dehydrogenase [ubiqu yes no 0.768 0.564 0.424 2e-45
Q09644 426 NADH dehydrogenase [ubiqu yes no 0.625 0.469 0.4 2e-37
>sp|Q54S83|NDUF7_DICDI NADH dehydrogenase [ubiquinone] complex I, assembly factor 7 OS=Dictyostelium discoideum GN=midA PE=1 SV=1 Back     alignment and function desciption
 Score =  220 bits (560), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 118/285 (41%), Positives = 170/285 (59%), Gaps = 23/285 (8%)

Query: 32  FSSSSSSESQIPNSHSVEPLDDNRSEHASTA--------ISIDRSGLYNPPEHSHERKLE 83
           F ++S S +   N + ++   D   EH   A        +S D+SGL   P+   + +  
Sbjct: 28  FINNSLSYTTTSNENDIK---DKNEEHDHRAKGKGRELLLSFDKSGLAQFPKQVFKNRKY 84

Query: 84  --SELVKHLKGIIKFRGGPISVAEYMEEVLTNPKAGFYINRDVFGAEGDFITSPEVSQMF 141
             ++  K+L+ I K RG P+S+  +++EVLTNPK G+Y+N+DVFG  GDFIT+PEVSQ+F
Sbjct: 85  PITDFEKYLQDITKVRG-PMSIDTFIKEVLTNPKYGYYMNKDVFGKGGDFITAPEVSQLF 143

Query: 142 GEMVGVWAMCLWEQMGQPNRVNLVELGPGRGTLMADLLRGASKFKNFTESLHIHLVECSP 201
           GEM+G+W +  WE MG+P ++ +VE+GPGRGTLM D+LR    FK F +S+ +HLVE SP
Sbjct: 144 GEMIGIWCVATWEAMGKPKKLQIVEMGPGRGTLMKDILRSTKVFKEFYDSISVHLVEASP 203

Query: 202 TLQKLQHHNLKCMDENNANDNVEERTISSLA-GTPVSWHAALEQVPSGFPTIIVAHEFYD 260
             +K Q  NL    +     N + +TI     G  V+W   LE+VP+  PT+ +A EF+D
Sbjct: 204 ANKKTQKQNLLYFKDKAI--NFDHKTIGETPNGIKVTWVGKLEEVPTDIPTLFLAQEFFD 261

Query: 261 ALPVH--QFQKTTRGWCEKLVDIAEDSSLHQQ--LSFCCSAASGL 301
           ALP+H  +F +    WCE LVD  ED + H +  L F  S    L
Sbjct: 262 ALPIHVFRFSREKNDWCEVLVD--EDITEHGEYYLRFVQSKGPTL 304




Involved in mitochondrial function. Cells lacking midA have lower levels of ATP and no glycogen.
Dictyostelium discoideum (taxid: 44689)
>sp|Q9VGR2|NDUF7_DROME NADH dehydrogenase [ubiquinone] complex I, assembly factor 7 homolog OS=Drosophila melanogaster GN=CG17726 PE=1 SV=1 Back     alignment and function description
>sp|Q08BY0|NDUF7_DANRE NADH dehydrogenase [ubiquinone] complex I, assembly factor 7 OS=Danio rerio GN=ndufaf7 PE=2 SV=1 Back     alignment and function description
>sp|Q6GQ37|NDUF7_XENLA NADH dehydrogenase [ubiquinone] complex I, assembly factor 7 OS=Xenopus laevis GN=ndufaf7 PE=2 SV=1 Back     alignment and function description
>sp|Q2KHV5|NDUF7_BOVIN NADH dehydrogenase [ubiquinone] complex I, assembly factor 7 OS=Bos taurus GN=NDUFAF7 PE=2 SV=2 Back     alignment and function description
>sp|Q5BKM6|NDUF7_XENTR NADH dehydrogenase [ubiquinone] complex I, assembly factor 7 OS=Xenopus tropicalis GN=ndufaf7 PE=2 SV=1 Back     alignment and function description
>sp|Q9CWG8|NDUF7_MOUSE NADH dehydrogenase [ubiquinone] complex I, assembly factor 7 OS=Mus musculus GN=Ndufaf7 PE=2 SV=4 Back     alignment and function description
>sp|Q7L592|NDUF7_HUMAN NADH dehydrogenase [ubiquinone] complex I, assembly factor 7 OS=Homo sapiens GN=NDUFAF7 PE=1 SV=1 Back     alignment and function description
>sp|Q5XI79|NDUF7_RAT NADH dehydrogenase [ubiquinone] complex I, assembly factor 7 OS=Rattus norvegicus GN=Ndufaf7 PE=2 SV=1 Back     alignment and function description
>sp|Q09644|NDUF7_CAEEL NADH dehydrogenase [ubiquinone] complex I, assembly factor 7 homolog OS=Caenorhabditis elegans GN=ZK1128.1 PE=3 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query320
255552842 490 conserved hypothetical protein [Ricinus 0.784 0.512 0.801 1e-119
225452686 483 PREDICTED: protein midA, mitochondrial [ 0.778 0.515 0.808 1e-118
357473955 449 MidA-like protein [Medicago truncatula] 0.759 0.541 0.786 1e-114
217074438 449 unknown [Medicago truncatula] 0.759 0.541 0.781 1e-114
449505855 493 PREDICTED: protein midA, mitochondrial-l 0.787 0.511 0.75 1e-112
449461913 493 PREDICTED: protein midA, mitochondrial-l 0.787 0.511 0.75 1e-112
356538547 464 PREDICTED: protein midA, mitochondrial-l 0.728 0.502 0.819 1e-112
297815160 471 hypothetical protein ARALYDRAFT_905140 [ 0.725 0.492 0.792 1e-111
42565270 471 uncharacterized protein [Arabidopsis tha 0.725 0.492 0.792 1e-110
334185683 471 uncharacterized protein [Arabidopsis tha 0.725 0.492 0.792 1e-110
>gi|255552842|ref|XP_002517464.1| conserved hypothetical protein [Ricinus communis] gi|223543475|gb|EEF45006.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  432 bits (1111), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 202/252 (80%), Positives = 227/252 (90%), Gaps = 1/252 (0%)

Query: 41  QIPNSHSVEPLDDNRSEHASTAISIDRSGLYNPPEHSHERKLESELVKHLKGIIKFRGGP 100
           +IP+S+ VE L+DN  + +ST +S+DRSGLYNPPEHSHE   ESEL KHLKGIIKFRGGP
Sbjct: 49  EIPHSNLVEQLEDNNVQ-SSTTVSVDRSGLYNPPEHSHEPNSESELFKHLKGIIKFRGGP 107

Query: 101 ISVAEYMEEVLTNPKAGFYINRDVFGAEGDFITSPEVSQMFGEMVGVWAMCLWEQMGQPN 160
           I+VAEYMEEVLTNPKAGFYINRDVFGAEGDFITSPEVSQMFGEMVGVWA+CLWEQM QP 
Sbjct: 108 ITVAEYMEEVLTNPKAGFYINRDVFGAEGDFITSPEVSQMFGEMVGVWALCLWEQMEQPK 167

Query: 161 RVNLVELGPGRGTLMADLLRGASKFKNFTESLHIHLVECSPTLQKLQHHNLKCMDENNAN 220
            VNLVELGPGRGTLMADLLRGASKFK+FTESLHIH+VECSP LQKLQHHNLKC+D+NN+ 
Sbjct: 168 SVNLVELGPGRGTLMADLLRGASKFKSFTESLHIHMVECSPALQKLQHHNLKCVDDNNSC 227

Query: 221 DNVEERTISSLAGTPVSWHAALEQVPSGFPTIIVAHEFYDALPVHQFQKTTRGWCEKLVD 280
            + EERTIS+LAGTP+SWH +LEQVP+G PTII+AHEFYDALPVHQFQ+ +RGWCEK+VD
Sbjct: 228 GSGEERTISTLAGTPISWHTSLEQVPTGSPTIIIAHEFYDALPVHQFQRASRGWCEKMVD 287

Query: 281 IAEDSSLHQQLS 292
           +AEDS     LS
Sbjct: 288 VAEDSMFRFVLS 299




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225452686|ref|XP_002276826.1| PREDICTED: protein midA, mitochondrial [Vitis vinifera] gi|296087782|emb|CBI35038.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357473955|ref|XP_003607262.1| MidA-like protein [Medicago truncatula] gi|355508317|gb|AES89459.1| MidA-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|217074438|gb|ACJ85579.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|449505855|ref|XP_004162586.1| PREDICTED: protein midA, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449461913|ref|XP_004148686.1| PREDICTED: protein midA, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356538547|ref|XP_003537764.1| PREDICTED: protein midA, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|297815160|ref|XP_002875463.1| hypothetical protein ARALYDRAFT_905140 [Arabidopsis lyrata subsp. lyrata] gi|297321301|gb|EFH51722.1| hypothetical protein ARALYDRAFT_905140 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|42565270|ref|NP_189511.2| uncharacterized protein [Arabidopsis thaliana] gi|95147286|gb|ABF57278.1| At3g28700 [Arabidopsis thaliana] gi|332643957|gb|AEE77478.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334185683|ref|NP_001189995.1| uncharacterized protein [Arabidopsis thaliana] gi|332643958|gb|AEE77479.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query320
TAIR|locus:2095527 471 AT3G28700 [Arabidopsis thalian 0.868 0.590 0.694 1.4e-103
DICTYBASE|DDB_G0282615 484 midA "DUF185 family protein" [ 0.690 0.456 0.467 1.7e-52
FB|FBgn0037880 437 CG17726 [Drosophila melanogast 0.671 0.491 0.486 3.2e-49
UNIPROTKB|Q6GQ37 437 ndufaf7 "NADH dehydrogenase [u 0.706 0.517 0.436 1.4e-46
UNIPROTKB|Q2KHV5 441 NDUFAF7 "NADH dehydrogenase [u 0.690 0.501 0.449 3.8e-46
RGD|1311578 436 Ndufaf7 "NADH dehydrogenase (u 0.740 0.543 0.431 4.7e-46
ZFIN|ZDB-GENE-060929-628 422 zgc:153989 "zgc:153989" [Danio 0.609 0.462 0.475 6.2e-46
UNIPROTKB|Q5BKM6 430 ndufaf7 "NADH dehydrogenase [u 0.712 0.530 0.439 1e-45
UNIPROTKB|F1MJQ5 441 C11H2orf56 "Uncharacterized pr 0.690 0.501 0.444 2.7e-45
MGI|MGI:1920944 436 Ndufaf7 "NADH dehydrogenase (u 0.715 0.525 0.443 5.6e-45
TAIR|locus:2095527 AT3G28700 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1026 (366.2 bits), Expect = 1.4e-103, P = 1.4e-103
 Identities = 202/291 (69%), Positives = 226/291 (77%)

Query:     3 LRKLSLQPSSPLRVLSSKYPFPLLQKWXXXXXXXXXXXXXXXXXXVEPLDDNRS-EHAST 61
             LRKL  Q SS  R+L S  P PL  K                     P  ++ + EH  T
Sbjct:     2 LRKLLTQTSSR-RLLFSGVP-PLFSK------STISPFSSLSSSPEPPSSESPAVEHPGT 53

Query:    62 AISIDRSGLYNPPEHSHERKLESELVKHLKGIIKFRGGPISVAEYMEEVLTNPKAGFYIN 121
              ISIDRS LY PP+HSHE   +SELVKHLK IIKFRGGPISVAEYMEEVLTNPKAGFY+N
Sbjct:    54 TISIDRSSLYTPPDHSHESTPDSELVKHLKSIIKFRGGPISVAEYMEEVLTNPKAGFYMN 113

Query:   122 RDVFGAEGDFITSPEVSQMFGEMVGVWAMCLWEQMGQPNRVNLVELGPGRGTLMADLLRG 181
             RDVFGA+GDFITSPEVSQMFGEM+GVW +CLWEQMG+P RVNLVELGPGRGTLMADLLRG
Sbjct:   114 RDVFGAQGDFITSPEVSQMFGEMIGVWTVCLWEQMGRPERVNLVELGPGRGTLMADLLRG 173

Query:   182 ASKFKNFTESLHIHLVECSPTLQKLQHHNLKCMDENNANDNVEERTISSLAGTPVSWHAA 241
              SKFKNFTESLHIHLVECSP LQKLQH NLKC DE+++    E++ +SSLAGTPV WHA 
Sbjct:   174 TSKFKNFTESLHIHLVECSPALQKLQHQNLKCTDESSS----EKKAVSSLAGTPVHWHAT 229

Query:   242 LEQVPSGFPTIIVAHEFYDALPVHQFQKTTRGWCEKLVDIAEDSSLHQQLS 292
             L++VPSG PT+I+AHEFYDALPVHQFQK+TRGWCEK+VD+ EDS     LS
Sbjct:   230 LQEVPSGVPTLIIAHEFYDALPVHQFQKSTRGWCEKMVDVGEDSKFRFVLS 280




GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0008270 "zinc ion binding" evidence=IDA
GO:0015979 "photosynthesis" evidence=RCA
GO:0045333 "cellular respiration" evidence=RCA
DICTYBASE|DDB_G0282615 midA "DUF185 family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
FB|FBgn0037880 CG17726 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q6GQ37 ndufaf7 "NADH dehydrogenase [ubiquinone] complex I, assembly factor 7" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KHV5 NDUFAF7 "NADH dehydrogenase [ubiquinone] complex I, assembly factor 7" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1311578 Ndufaf7 "NADH dehydrogenase (ubiquinone) complex I, assembly factor 7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060929-628 zgc:153989 "zgc:153989" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5BKM6 ndufaf7 "NADH dehydrogenase [ubiquinone] complex I, assembly factor 7" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|F1MJQ5 C11H2orf56 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1920944 Ndufaf7 "NADH dehydrogenase (ubiquinone) 1 alpha subcomplex assembly factor 7" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query320
COG1565 370 COG1565, COG1565, Uncharacterized conserved protei 1e-55
pfam02636241 pfam02636, Methyltransf_28, Putative S-adenosyl-L- 4e-42
>gnl|CDD|224481 COG1565, COG1565, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
 Score =  184 bits (470), Expect = 1e-55
 Identities = 68/183 (37%), Positives = 108/183 (59%), Gaps = 19/183 (10%)

Query: 98  GGPISVAEYMEEVLTNPKAGFYINRDVFGAEGDFITSPEVSQMFGEMVGVWAMCLWEQMG 157
           GGPIS +++ME  L +P+ G+Y +    G +GDFIT+PE+SQ+FGE++    + LW+++G
Sbjct: 15  GGPISFSDFMELALYDPEHGYYSSAVKIGRKGDFITAPELSQLFGELLAEQFLQLWQELG 74

Query: 158 QPNRVNLVELGPGRGTLMADLLRGASK-FKNFTESLHIHLVECSPTLQKLQHHNLKCMDE 216
           +P  + LVE+G GRGTL +D+LR   + +    E+L  +++E SP L+  Q   LK    
Sbjct: 75  RPAPLKLVEIGAGRGTLASDILRTLRRLYPELYEALSYYIIEPSPELRARQKETLK---- 130

Query: 217 NNANDNVEERTISSLAGTPVSWHAALEQVPSGFPTIIVAHEFYDALPVHQFQKTTRGWCE 276
               D              + W   +E +P  FP I+V++E +DALPV QF +T   + E
Sbjct: 131 -ATED-------------LIRWVEWVEDLPKKFPGIVVSNELFDALPVEQFIRTKGLFVE 176

Query: 277 KLV 279
           ++V
Sbjct: 177 RVV 179


Length = 370

>gnl|CDD|217158 pfam02636, Methyltransf_28, Putative S-adenosyl-L-methionine-dependent methyltransferase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 320
COG1565 370 Uncharacterized conserved protein [Function unknow 100.0
KOG2901 415 consensus Uncharacterized conserved protein [Funct 100.0
PF02636252 Methyltransf_28: Putative S-adenosyl-L-methionine- 100.0
PHA03412241 putative methyltransferase; Provisional 97.19
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 97.03
TIGR00740239 methyltransferase, putative. A simple BLAST search 96.96
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 96.64
PLN02244340 tocopherol O-methyltransferase 96.58
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 96.55
PF00398262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 96.53
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 96.49
PRK06202232 hypothetical protein; Provisional 96.43
TIGR03438301 probable methyltransferase. This model represents 96.41
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 96.41
smart00650169 rADc Ribosomal RNA adenine dimethylases. 96.39
PHA03411279 putative methyltransferase; Provisional 96.31
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylati 96.3
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 96.28
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 96.16
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 96.15
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 96.14
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 96.14
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 96.0
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 95.88
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 95.86
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 95.85
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 95.85
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 95.8
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 95.72
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 95.67
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 95.58
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 95.53
PRK08317241 hypothetical protein; Provisional 95.4
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 95.39
PF13679141 Methyltransf_32: Methyltransferase domain 95.38
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 95.34
PF05185 448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 95.33
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 95.27
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 95.25
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 95.19
PTZ00338 294 dimethyladenosine transferase-like protein; Provis 95.17
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 95.01
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 95.01
TIGR02987 524 met_A_Alw26 type II restriction m6 adenine DNA met 94.88
COG2263198 Predicted RNA methylase [Translation, ribosomal st 94.83
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 94.82
TIGR00536284 hemK_fam HemK family putative methylases. The gene 94.8
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 94.77
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 94.74
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 94.71
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 94.7
PRK07402196 precorrin-6B methylase; Provisional 94.69
PF07757112 AdoMet_MTase: Predicted AdoMet-dependent methyltra 94.67
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 94.67
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 94.6
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 94.57
KOG0820 315 consensus Ribosomal RNA adenine dimethylase [RNA p 94.55
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 94.53
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 94.52
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 94.51
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 94.46
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 94.45
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 94.45
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 94.44
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 94.4
PRK14967223 putative methyltransferase; Provisional 94.31
PF02384 311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 94.29
PRK10258251 biotin biosynthesis protein BioC; Provisional 94.2
PRK00811283 spermidine synthase; Provisional 94.2
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 94.16
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 94.11
KOG2904328 consensus Predicted methyltransferase [General fun 94.09
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 94.06
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 93.83
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 93.82
COG2890280 HemK Methylase of polypeptide chain release factor 93.51
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 93.5
PRK05785226 hypothetical protein; Provisional 93.46
PRK11207197 tellurite resistance protein TehB; Provisional 93.43
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 93.36
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 93.31
PRK04457262 spermidine synthase; Provisional 93.22
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 92.93
PLN02233261 ubiquinone biosynthesis methyltransferase 92.86
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 92.68
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 92.64
COG4123248 Predicted O-methyltransferase [General function pr 92.58
PLN02585315 magnesium protoporphyrin IX methyltransferase 92.46
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 92.32
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 92.22
PF05206259 TRM13: Methyltransferase TRM13; InterPro: IPR00787 92.12
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 92.09
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 91.98
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 91.94
PRK14968188 putative methyltransferase; Provisional 91.88
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 91.85
PLN02336475 phosphoethanolamine N-methyltransferase 91.75
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 91.67
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 91.34
COG4106257 Tam Trans-aconitate methyltransferase [General fun 91.22
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 91.21
PRK04266226 fibrillarin; Provisional 91.14
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 91.07
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 91.05
TIGR00438188 rrmJ cell division protein FtsJ. 90.99
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 90.73
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 90.61
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 90.47
PLN02366308 spermidine synthase 90.3
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 90.07
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 89.95
PRK12335287 tellurite resistance protein TehB; Provisional 89.9
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 89.9
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 89.83
PLN02490340 MPBQ/MSBQ methyltransferase 89.36
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 89.14
PRK01581374 speE spermidine synthase; Validated 89.01
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 88.93
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 88.82
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 88.75
PRK06922 677 hypothetical protein; Provisional 88.74
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 88.65
KOG0822 649 consensus Protein kinase inhibitor [Cell cycle con 88.59
TIGR00452314 methyltransferase, putative. Known examples to dat 88.55
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 88.46
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 88.42
PRK14121 390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 88.34
PLN02823336 spermine synthase 87.89
COG0421282 SpeE Spermidine synthase [Amino acid transport and 87.57
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 87.55
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 87.51
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 87.48
PLN02336 475 phosphoethanolamine N-methyltransferase 87.07
PRK03612521 spermidine synthase; Provisional 87.0
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 86.64
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 86.54
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 86.39
PRK04148134 hypothetical protein; Provisional 86.14
PTZ00146293 fibrillarin; Provisional 85.83
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 85.68
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 85.58
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 84.99
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 84.85
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 84.5
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 84.42
KOG4300252 consensus Predicted methyltransferase [General fun 84.14
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 83.33
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 83.32
PF09243274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 83.29
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 83.24
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 83.15
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 82.49
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 82.12
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 81.55
KOG2361264 consensus Predicted methyltransferase [General fun 81.25
PF03291 331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 80.05
>COG1565 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
Probab=100.00  E-value=2e-53  Score=411.65  Aligned_cols=186  Identities=37%  Similarity=0.695  Sum_probs=170.7

Q ss_pred             HHHHHHHHHHHhcCCcccHHHHHHHhhcCCCCcccCCCCCCCCCCCeecCCChhHHHHHHHHHHHHHHHHHcCCCCcceE
Q 020840           85 ELVKHLKGIIKFRGGPISVAEYMEEVLTNPKAGFYINRDVFGAEGDFITSPEVSQMFGEMVGVWAMCLWEQMGQPNRVNL  164 (320)
Q Consensus        85 ~L~~~i~~~I~~~~GpIsf~dfM~~aLY~P~~GYY~~~~~~G~~GDFiTSpEIsp~FGe~IA~~i~~~w~~~g~p~~l~I  164 (320)
                      .+..+|++.|+.. |||||++||++|||+|++|||++..+||+.||||||||||++|||+||.|++++|++.|.|.++.|
T Consensus         3 ~~~~~~~~~i~~~-g~i~f~~fM~~~L~~p~~GYYs~~~~~G~~GDFiTApels~lFGella~~~~~~wq~~g~p~~~~l   81 (370)
T COG1565           3 LLALIIRALIAQG-GPISFSDFMELALYDPEHGYYSSAVKIGRKGDFITAPELSQLFGELLAEQFLQLWQELGRPAPLKL   81 (370)
T ss_pred             cHHHHHHHHHhcC-CCccHHHHHHHHHcCCCCcccccchhccccCCeeechhHHHHHHHHHHHHHHHHHHHhcCCCCceE
Confidence            3566778888875 999999999999999999999998889999999999999999999999999999999999999999


Q ss_pred             EEecCCchhHHHHHHHHHh-cCcCcccceeEEEEecChhhHHHHHHhccccccCCcCcccchhhhcccCCCCeEeecccc
Q 020840          165 VELGPGRGTLMADLLRGAS-KFKNFTESLHIHLVECSPTLQKLQHHNLKCMDENNANDNVEERTISSLAGTPVSWHAALE  243 (320)
Q Consensus       165 vEiGaG~GtLa~DIL~~l~-~~p~~~~~l~y~iVE~Sp~Lr~~Q~e~L~~~~~~~~~~~~~~~~~~~~~~~~i~W~~sle  243 (320)
                      ||||||+|+||.|||++++ ..|++|+.++|+|||+||.|+++||++|+...                  ..+.|...++
T Consensus        82 vEiGaG~G~l~~DiL~~l~~L~P~~~~~~~~~iiE~s~~L~~~Qk~~L~~~~------------------~~~~~~~~~e  143 (370)
T COG1565          82 VEIGAGRGTLASDILRTLRRLYPELYEALSYYIIEPSPELRARQKETLKATE------------------DLIRWVEWVE  143 (370)
T ss_pred             EEeCCCcChHHHHHHHHHHHhCHHHHhcceEEEEecCHHHHHHHHHHHhccc------------------cchhHHHHHH
Confidence            9999999999999999995 57999999999999999999999999998631                  3678888889


Q ss_pred             cCCCCCCEEEEEecccccccceeEEEeCCeeEEEEEEEcCCCceEE
Q 020840          244 QVPSGFPTIIVAHEFYDALPVHQFQKTTRGWCEKLVDIAEDSSLHQ  289 (320)
Q Consensus       244 elp~~~~~~iiANE~fDALPv~~f~~~~~~w~E~~V~v~~~g~f~~  289 (320)
                      ++|.+.++|||+|||||||||++|.+++++|+|++|.-+.++++.+
T Consensus       144 ~~p~~~~~i~~~NElfDAlPv~q~~~~~~~~~Er~~~~~~~~~~~~  189 (370)
T COG1565         144 DLPKKFPGIVVSNELFDALPVEQFIRTKGLFVERVVVLDAEGRLVF  189 (370)
T ss_pred             hccccCceEEEechhhccccceeEeccCceEEEEeeccCcccceee
Confidence            9999889999999999999999999999999999996445566655



>KOG2901 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02636 Methyltransf_28: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR003788 This entry describes proteins of unknown function Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PF07757 AdoMet_MTase: Predicted AdoMet-dependent methyltransferase; InterPro: IPR011671 tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [] Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PF05206 TRM13: Methyltransferase TRM13; InterPro: IPR007871 This entry consists of eukaryotic and bacterial proteins that specifically methylates guanosine-4 in various tRNAs with a Gly(CCG), His or Pro signatures [] Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>KOG0822 consensus Protein kinase inhibitor [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query320
1zkd_A 387 X-ray Structure Of The Putative Protein Q6n1p6 From 7e-37
4f3n_A 432 High Resolution Native Crystal Structure Of An Unch 5e-10
>pdb|1ZKD|A Chain A, X-ray Structure Of The Putative Protein Q6n1p6 From Rhodopseudomonas Palustris At The Resolution 2.1 A , Northeast Structural Genomics Consortium Target Rpr58 Length = 387 Back     alignment and structure

Iteration: 1

Score = 150 bits (380), Expect = 7e-37, Method: Compositional matrix adjust. Identities = 76/205 (37%), Positives = 113/205 (55%), Gaps = 21/205 (10%) Query: 83 ESELVKHLKGIIKFRGGPISVAEYMEEVLTNPKAGFYINRDVFGAEGDFITSPEVSQMFG 142 ++ L +K +IK GP V Y E L +P+ G+Y+ RD G EGDF TSPE+SQ FG Sbjct: 4 QTALATEIKRLIK-AAGPXPVWRYXELCLGHPEHGYYVTRDPLGREGDFTTSPEISQXFG 62 Query: 143 EMVGVWAMCLWEQMGQPNRVNLVELGPGRGTLMADLLRGASKFKNFTESLHIHLVECSPT 202 E++G+W+ +W+ +P + L+E+GPGRGT AD LR +SL +HLVE +P Sbjct: 63 ELLGLWSASVWKAADEPQTLRLIEIGPGRGTXXADALRALRVLPILYQSLSVHLVEINPV 122 Query: 203 LQKLQHHNLKCMDENNANDNVEERTISSLAGTPVSWHAALEQVPSGFPTIIVAHEFYDAL 262 L++ Q L + + WH + E VP G P +I+A+E++D L Sbjct: 123 LRQKQQTLLAGIRN-------------------IHWHDSFEDVPEG-PAVILANEYFDVL 162 Query: 263 PVHQFQKTTRGWCEKLVDIAEDSSL 287 P+HQ K GW E++++I L Sbjct: 163 PIHQAIKRETGWHERVIEIGASGEL 187
>pdb|4F3N|A Chain A, High Resolution Native Crystal Structure Of An Uncharacterized Acr, Cog1565 Superfamily Protein From Burkholderia Thailandensis, Solved By Iodide Ion Sad Length = 432 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query320
1zkd_A 387 DUF185; NESG, RPR58, structural genomics, PSI, pro 3e-87
4f3n_A 432 Uncharacterized ACR, COG1565 superfamily; structur 2e-74
>1zkd_A DUF185; NESG, RPR58, structural genomics, PSI, protein structure INI northeast structural genomics consortium, unknown function; 2.10A {Rhodopseudomonas palustris} SCOP: c.66.1.52 Length = 387 Back     alignment and structure
 Score =  266 bits (681), Expect = 3e-87
 Identities = 79/210 (37%), Positives = 120/210 (57%), Gaps = 21/210 (10%)

Query: 83  ESELVKHLKGIIKFRGGPISVAEYMEEVLTNPKAGFYINRDVFGAEGDFITSPEVSQMFG 142
           ++ L   +K +IK   GP+ V  YME  L +P+ G+Y+ RD  G EGDF TSPE+SQMFG
Sbjct: 4   QTALATEIKRLIK-AAGPMPVWRYMELCLGHPEHGYYVTRDPLGREGDFTTSPEISQMFG 62

Query: 143 EMVGVWAMCLWEQMGQPNRVNLVELGPGRGTLMADLLRGASKFKNFTESLHIHLVECSPT 202
           E++G+W+  +W+   +P  + L+E+GPGRGT+MAD LR         +SL +HLVE +P 
Sbjct: 63  ELLGLWSASVWKAADEPQTLRLIEIGPGRGTMMADALRALRVLPILYQSLSVHLVEINPV 122

Query: 203 LQKLQHHNLKCMDENNANDNVEERTISSLAGTPVSWHAALEQVPSGFPTIIVAHEFYDAL 262
           L++ Q   L  +                     + WH + E VP G P +I+A+E++D L
Sbjct: 123 LRQKQQTLLAGIR-------------------NIHWHDSFEDVPEG-PAVILANEYFDVL 162

Query: 263 PVHQFQKTTRGWCEKLVDIAEDSSLHQQLS 292
           P+HQ  K   GW E++++I     L   ++
Sbjct: 163 PIHQAIKRETGWHERVIEIGASGELVFGVA 192


>4f3n_A Uncharacterized ACR, COG1565 superfamily; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.75A {Burkholderia thailandensis} Length = 432 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query320
1zkd_A 387 DUF185; NESG, RPR58, structural genomics, PSI, pro 100.0
4f3n_A 432 Uncharacterized ACR, COG1565 superfamily; structur 100.0
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 97.76
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 96.89
3fut_A271 Dimethyladenosine transferase; methyltransferase, 96.88
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 96.85
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 96.83
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 96.77
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 96.7
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 96.68
3gjy_A317 Spermidine synthase; APC62791, structural genomics 96.67
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 96.63
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 96.62
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 96.51
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 96.49
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 96.4
3hnr_A220 Probable methyltransferase BT9727_4108; structural 96.36
3lcc_A235 Putative methyl chloride transferase; halide methy 96.34
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 96.26
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 96.24
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 96.23
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 96.2
3dtn_A234 Putative methyltransferase MM_2633; structural gen 96.16
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 96.16
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 96.13
1wzn_A252 SAM-dependent methyltransferase; structural genomi 96.12
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 96.11
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 96.09
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 96.08
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 96.07
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 96.06
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 96.05
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 96.04
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 96.03
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 96.03
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 96.02
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 96.0
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 95.98
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 95.95
3i9f_A170 Putative type 11 methyltransferase; structural gen 95.91
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 95.9
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 95.88
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 95.88
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 95.87
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 95.87
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 95.79
1ne2_A200 Hypothetical protein TA1320; structural genomics, 95.78
2p7i_A250 Hypothetical protein; putative methyltransferase, 95.78
3lkd_A 542 Type I restriction-modification system methyltrans 95.78
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 95.76
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 95.75
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 95.75
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 95.73
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 95.72
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 95.72
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 95.7
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 95.7
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 95.69
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 95.67
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 95.67
1jsx_A207 Glucose-inhibited division protein B; methyltransf 95.67
3f4k_A257 Putative methyltransferase; structural genomics, P 95.62
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 95.62
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 95.61
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 95.6
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 95.6
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 95.59
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 95.58
3khk_A 544 Type I restriction-modification system methylation 95.54
2okc_A 445 Type I restriction enzyme stysji M protein; NP_813 95.54
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 95.53
3dh0_A219 SAM dependent methyltransferase; cystal structure, 95.53
1zq9_A 285 Probable dimethyladenosine transferase; SGC, struc 95.53
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 95.53
1qyr_A252 KSGA, high level kasugamycin resistance protein, S 95.51
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 95.5
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 95.49
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 95.46
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 95.45
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 95.42
3m70_A286 Tellurite resistance protein TEHB homolog; structu 95.42
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 95.41
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 95.33
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 95.31
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 95.22
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 95.21
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 95.21
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 95.2
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 95.16
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 95.15
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 95.15
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 95.11
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 95.11
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 95.1
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 95.08
1vl5_A260 Unknown conserved protein BH2331; putative methylt 95.07
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 95.05
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 95.03
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 95.03
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 95.02
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 95.0
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 94.99
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 94.97
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 94.95
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 94.95
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 94.91
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 94.91
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 94.9
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 94.9
3m33_A226 Uncharacterized protein; structural genomics, PSI- 94.88
1ws6_A171 Methyltransferase; structural genomics, riken stru 94.88
3uwp_A 438 Histone-lysine N-methyltransferase, H3 lysine-79; 94.86
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 94.81
3ocj_A305 Putative exported protein; structural genomics, PS 94.79
2esr_A177 Methyltransferase; structural genomics, hypothetic 94.78
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 94.76
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 94.75
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 94.74
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 94.72
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 94.71
2avd_A229 Catechol-O-methyltransferase; structural genomics, 94.71
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 94.69
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 94.68
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 94.66
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 94.66
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 94.64
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 94.6
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 94.57
1xxl_A239 YCGJ protein; structural genomics, protein structu 94.54
2b25_A336 Hypothetical protein; structural genomics, methyl 94.53
2o07_A304 Spermidine synthase; structural genomics, structur 94.51
2i7c_A283 Spermidine synthase; transferase, structural genom 94.49
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 94.49
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 94.48
2kw5_A202 SLR1183 protein; structural genomics, northeast st 94.47
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 94.47
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 94.46
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 94.45
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 94.43
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 94.43
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 94.4
3ege_A261 Putative methyltransferase from antibiotic biosyn 94.38
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 94.37
3duw_A223 OMT, O-methyltransferase, putative; alternating of 94.36
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 94.36
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 94.35
2h1r_A 299 Dimethyladenosine transferase, putative; SGC toron 94.35
1i4w_A 353 Mitochondrial replication protein MTF1; mitochondr 94.34
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 94.33
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 94.32
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 94.32
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 94.29
3cc8_A230 Putative methyltransferase; structural genomics, j 94.28
4gqb_A 637 Protein arginine N-methyltransferase 5; TIM barrel 94.27
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 94.25
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 94.23
1xj5_A334 Spermidine synthase 1; structural genomics, protei 94.22
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 94.16
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 94.13
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 94.12
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative 94.06
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 94.06
2vdw_A 302 Vaccinia virus capping enzyme D1 subunit; nucleoti 94.0
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 93.9
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 93.9
2pt6_A321 Spermidine synthase; transferase, structural genom 93.88
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 93.84
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 93.84
2ar0_A 541 M.ecoki, type I restriction enzyme ecoki M protein 93.84
2b3t_A276 Protein methyltransferase HEMK; translation termin 93.82
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 93.77
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 93.76
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 93.74
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 93.71
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 93.7
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 93.69
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 93.68
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 93.67
2h00_A254 Methyltransferase 10 domain containing protein; st 93.65
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 93.62
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 93.61
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 93.61
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 93.47
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 93.46
2cmg_A262 Spermidine synthase; transferase, putrescine amino 93.45
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 93.3
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 93.27
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 93.26
1yb2_A275 Hypothetical protein TA0852; structural genomics, 93.23
2fpo_A202 Methylase YHHF; structural genomics, putative meth 93.19
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 93.06
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 93.02
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 93.0
2r3s_A335 Uncharacterized protein; methyltransferase domain, 92.91
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 92.9
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 92.89
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 92.82
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 92.82
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 92.63
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 92.48
3lpm_A259 Putative methyltransferase; structural genomics, p 92.47
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 92.44
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 92.42
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 92.38
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 92.31
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 92.3
2i62_A265 Nicotinamide N-methyltransferase; structural genom 92.18
3ufb_A 530 Type I restriction-modification system methyltran 92.16
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 92.08
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 92.0
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 92.0
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 91.98
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 91.93
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 91.92
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 91.91
4hg2_A257 Methyltransferase type 11; structural genomics, PS 91.85
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 91.52
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 91.12
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 91.1
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 91.04
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 90.83
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 90.73
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 90.71
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 90.65
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 90.65
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 90.44
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 90.42
3dp7_A363 SAM-dependent methyltransferase; structural genomi 90.31
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 90.11
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 90.1
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 90.03
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 89.97
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 89.91
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 89.59
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 89.53
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 89.16
3ua3_A 745 Protein arginine N-methyltransferase 5; TIM-barrel 88.99
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 88.91
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 88.91
1vlm_A219 SAM-dependent methyltransferase; possible histamin 88.89
1m6y_A 301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 88.33
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 88.3
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 88.05
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 87.89
2frn_A278 Hypothetical protein PH0793; structural genomics, 87.66
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 87.65
2zig_A297 TTHA0409, putative modification methylase; methylt 87.59
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 87.55
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 87.12
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 86.29
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 86.22
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 85.03
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 84.98
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 84.71
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 84.48
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 84.15
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 82.7
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 81.25
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 81.17
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 80.58
>1zkd_A DUF185; NESG, RPR58, structural genomics, PSI, protein structure INI northeast structural genomics consortium, unknown function; 2.10A {Rhodopseudomonas palustris} SCOP: c.66.1.52 Back     alignment and structure
Probab=100.00  E-value=6.8e-60  Score=463.22  Aligned_cols=197  Identities=40%  Similarity=0.789  Sum_probs=177.4

Q ss_pred             chHHHHHHHHHHHHhcCCcccHHHHHHHhhcCCCCcccCCCCCCCCCCCeecCCChhHHHHHHHHHHHHHHHHHcCCCCc
Q 020840           82 LESELVKHLKGIIKFRGGPISVAEYMEEVLTNPKAGFYINRDVFGAEGDFITSPEVSQMFGEMVGVWAMCLWEQMGQPNR  161 (320)
Q Consensus        82 ~~~~L~~~i~~~I~~~~GpIsf~dfM~~aLY~P~~GYY~~~~~~G~~GDFiTSpEIsp~FGe~IA~~i~~~w~~~g~p~~  161 (320)
                      +++.|.++|+++|+.+ |||||++||++|||||++|||+++++||+.|||||||||||+|||+||+|++++|+.+|.|.+
T Consensus         3 ~~~~L~~~i~~~I~~~-G~i~f~~fM~~aLy~P~~GYY~~~~~~G~~GDF~Tapeis~~FGe~la~~~~~~w~~~g~p~~   81 (387)
T 1zkd_A            3 DQTALATEIKRLIKAA-GPMPVWRYMELCLGHPEHGYYVTRDPLGREGDFTTSPEISQMFGELLGLWSASVWKAADEPQT   81 (387)
T ss_dssp             CSSHHHHHHHHHHHHH-CSEEHHHHHHHHHHCTTTCTTTCC--------CCSHHHHCHHHHHHHHHHHHHHHHHTTCCSS
T ss_pred             chHHHHHHHHHHHHhc-CCeeHHHHHHHHhcCCCCcccCCCCCCCCCCCeeCCCchHHHHHHHHHHHHHHHHHHcCCCCC
Confidence            3567999999999986 899999999999999999999998899999999999999999999999999999999999999


Q ss_pred             ceEEEecCCchhHHHHHHHHHhcCcCcccceeEEEEecChhhHHHHHHhccccccCCcCcccchhhhcccCCCCeEeecc
Q 020840          162 VNLVELGPGRGTLMADLLRGASKFKNFTESLHIHLVECSPTLQKLQHHNLKCMDENNANDNVEERTISSLAGTPVSWHAA  241 (320)
Q Consensus       162 l~IvEiGaG~GtLa~DIL~~l~~~p~~~~~l~y~iVE~Sp~Lr~~Q~e~L~~~~~~~~~~~~~~~~~~~~~~~~i~W~~s  241 (320)
                      ++|||+|||+|+||.|||++++..|+++.+++|+|||+||.|+++|+++|+..                   .+|.|+++
T Consensus        82 ~~ivElGaG~GtLa~diL~~l~~~p~~~~~~~y~iVE~Sp~Lr~~Q~~~L~~~-------------------~~v~W~~~  142 (387)
T 1zkd_A           82 LRLIEIGPGRGTMMADALRALRVLPILYQSLSVHLVEINPVLRQKQQTLLAGI-------------------RNIHWHDS  142 (387)
T ss_dssp             EEEEEECCTTSHHHHHHHHHHTTSHHHHTTEEEEEECCCHHHHHHHHHHSTTC-------------------SSEEEESS
T ss_pred             cEEEEECCCcchHHHHHHHHHHhCCccccccEEEEEecCHHHHHHHHHHhcCC-------------------CCeEEeCC
Confidence            99999999999999999999998899999999999999999999999999741                   16999999


Q ss_pred             cccCCCCCCEEEEEecccccccceeEEEeCCeeEEEEEEEcCCCceEEEeecCCCccc
Q 020840          242 LEQVPSGFPTIIVAHEFYDALPVHQFQKTTRGWCEKLVDIAEDSSLHQQLSFCCSAAS  299 (320)
Q Consensus       242 leelp~~~~~~iiANE~fDALPv~~f~~~~~~w~E~~V~v~~~g~f~~v~~p~~~~~~  299 (320)
                      ++++|.+ +|||||||||||||||+|++++++|+|++|+++++|+|.|+..|.+++..
T Consensus       143 l~~lp~~-~~~viANE~fDAlPv~~~~~~~~~w~E~~V~~~~~g~~~~~~~~~~~~~~  199 (387)
T 1zkd_A          143 FEDVPEG-PAVILANEYFDVLPIHQAIKRETGWHERVIEIGASGELVFGVAADPIPGF  199 (387)
T ss_dssp             GGGSCCS-SEEEEEESSGGGSCCEEEEEETTEEEEEEEEECTTSCEEEEECSSCCTTC
T ss_pred             hhhcCCC-CeEEEeccccccCceEEEEecCCeEEEEEEEECCCCcEEEecCCCCchhh
Confidence            9999987 99999999999999999999999999999999888889999998777643



>4f3n_A Uncharacterized ACR, COG1565 superfamily; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.75A {Burkholderia thailandensis} PDB: 4g67_A* Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 320
d1zkda1 365 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 { 1e-43
>d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]} Length = 365 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: RPA4359-like
domain: Hypothetical protein RPA4359
species: Rhodopseudomonas palustris [TaxId: 1076]
 Score =  151 bits (382), Expect = 1e-43
 Identities = 79/213 (37%), Positives = 120/213 (56%), Gaps = 21/213 (9%)

Query: 83  ESELVKHLKGIIKFRGGPISVAEYMEEVLTNPKAGFYINRDVFGAEGDFITSPEVSQMFG 142
           ++ L   +K +IK   GP+ V  YME  L +P+ G+Y+ RD  G EGDF TSPE+SQMFG
Sbjct: 3   QTALATEIKRLIK-AAGPMPVWRYMELCLGHPEHGYYVTRDPLGREGDFTTSPEISQMFG 61

Query: 143 EMVGVWAMCLWEQMGQPNRVNLVELGPGRGTLMADLLRGASKFKNFTESLHIHLVECSPT 202
           E++G+W+  +W+   +P  + L+E+GPGRGT+MAD LR         +SL +HLVE +P 
Sbjct: 62  ELLGLWSASVWKAADEPQTLRLIEIGPGRGTMMADALRALRVLPILYQSLSVHLVEINPV 121

Query: 203 LQKLQHHNLKCMDENNANDNVEERTISSLAGTPVSWHAALEQVPSGFPTIIVAHEFYDAL 262
           L++ Q   L  +                     + WH + E VP G P +I+A+E++D L
Sbjct: 122 LRQKQQTLLAGIR-------------------NIHWHDSFEDVPEG-PAVILANEYFDVL 161

Query: 263 PVHQFQKTTRGWCEKLVDIAEDSSLHQQLSFCC 295
           P+HQ  K   GW E++++I     L   ++   
Sbjct: 162 PIHQAIKRETGWHERVIEIGASGELVFGVAADP 194


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query320
d1zkda1 365 Hypothetical protein RPA4359 {Rhodopseudomonas pal 100.0
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 97.35
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 97.31
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 97.25
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 97.24
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 97.22
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 97.15
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 97.03
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 96.95
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 96.86
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 96.85
d1zq9a1 278 Probable dimethyladenosine transferase {Human (Hom 96.62
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 96.54
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 96.53
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 96.5
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 96.41
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 96.35
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 96.3
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 96.3
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 96.28
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 96.12
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 96.12
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 96.03
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 95.93
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 95.92
d1i4wa_ 322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 95.84
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 95.8
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 95.8
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 95.79
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 95.67
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 95.61
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 95.6
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 95.55
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 95.5
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 95.36
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 95.28
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 95.24
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 95.11
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 95.01
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 94.98
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 94.91
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 94.73
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 94.72
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 94.65
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 94.61
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 94.6
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 94.53
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 94.47
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 94.32
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 94.04
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 94.02
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 93.93
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 93.91
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 93.51
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 93.08
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 92.96
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 92.69
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 92.41
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 92.09
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 91.8
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 91.32
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 91.31
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 91.29
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 91.22
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 91.1
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 90.74
d2h00a1250 Methyltransferase 10 domain containing protein MET 89.66
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 88.62
d2ar0a1 524 M.EcoKI {Escherichia coli [TaxId: 562]} 87.71
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 87.51
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 87.03
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 85.97
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 84.77
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 84.7
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 84.31
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 83.49
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 81.64
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 81.39
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 80.49
>d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: RPA4359-like
domain: Hypothetical protein RPA4359
species: Rhodopseudomonas palustris [TaxId: 1076]
Probab=100.00  E-value=5e-57  Score=434.82  Aligned_cols=198  Identities=40%  Similarity=0.789  Sum_probs=176.2

Q ss_pred             hHHHHHHHHHHHHhcCCcccHHHHHHHhhcCCCCcccCCCCCCCCCCCeecCCChhHHHHHHHHHHHHHHHHHcCCCCcc
Q 020840           83 ESELVKHLKGIIKFRGGPISVAEYMEEVLTNPKAGFYINRDVFGAEGDFITSPEVSQMFGEMVGVWAMCLWEQMGQPNRV  162 (320)
Q Consensus        83 ~~~L~~~i~~~I~~~~GpIsf~dfM~~aLY~P~~GYY~~~~~~G~~GDFiTSpEIsp~FGe~IA~~i~~~w~~~g~p~~l  162 (320)
                      .+.|.+.|+++|++. |||||++||++|||||++|||+++.+||++||||||||+||+||++||+|+.+.|+.++.|.++
T Consensus         3 ~~~L~~~i~~~i~~~-G~i~f~~fM~~~LY~p~~GYY~~~~~iG~~GDF~Tsp~is~~Fg~~ia~~~~~~~~~~~~~~~~   81 (365)
T d1zkda1           3 QTALATEIKRLIKAA-GPMPVWRYMELCLGHPEHGYYVTRDPLGREGDFTTSPEISQMFGELLGLWSASVWKAADEPQTL   81 (365)
T ss_dssp             SSHHHHHHHHHHHHH-CSEEHHHHHHHHHHCTTTCTTTCC--------CCSHHHHCHHHHHHHHHHHHHHHHHTTCCSSE
T ss_pred             ccHHHHHHHHHHHhc-CCccHHHHHHHHcCCCCccccCCCCCCCCCCCeECCCchHHHHHHHHHHHHHHHHHHhCCCccc
Confidence            368999999999987 9999999999999999999999888999999999999999999999999999999999999999


Q ss_pred             eEEEecCCchhHHHHHHHHHhcCcCcccceeEEEEecChhhHHHHHHhccccccCCcCcccchhhhcccCCCCeEeeccc
Q 020840          163 NLVELGPGRGTLMADLLRGASKFKNFTESLHIHLVECSPTLQKLQHHNLKCMDENNANDNVEERTISSLAGTPVSWHAAL  242 (320)
Q Consensus       163 ~IvEiGaG~GtLa~DIL~~l~~~p~~~~~l~y~iVE~Sp~Lr~~Q~e~L~~~~~~~~~~~~~~~~~~~~~~~~i~W~~sl  242 (320)
                      +|||+|||+|+||+|||++++..|.++..++|++||+||.|++.|+++|...                   .++.|+.++
T Consensus        82 ~ivE~GaG~G~La~dil~~l~~~~~~~~~~~~~~vE~s~~L~~~Q~~~l~~~-------------------~~i~w~~~~  142 (365)
T d1zkda1          82 RLIEIGPGRGTMMADALRALRVLPILYQSLSVHLVEINPVLRQKQQTLLAGI-------------------RNIHWHDSF  142 (365)
T ss_dssp             EEEEECCTTSHHHHHHHHHHTTSHHHHTTEEEEEECCCHHHHHHHHHHSTTC-------------------SSEEEESSG
T ss_pred             eEEecCCcccHHHHhhhhhhcccccccccceEEEeccchhHHHHHHHHhccc-------------------ccceeccCh
Confidence            9999999999999999999998899999999999999999999999998741                   368999999


Q ss_pred             ccCCCCCCEEEEEecccccccceeEEEeCCeeEEEEEEEcCCCceEEEeecCCCccchh
Q 020840          243 EQVPSGFPTIIVAHEFYDALPVHQFQKTTRGWCEKLVDIAEDSSLHQQLSFCCSAASGL  301 (320)
Q Consensus       243 eelp~~~~~~iiANE~fDALPv~~f~~~~~~w~E~~V~v~~~g~f~~v~~p~~~~~~~~  301 (320)
                      +++|.. |+||||||||||||||+|++++++|+|++|.+++++.|.+...+...+....
T Consensus       143 ~~~~~~-~g~iiaNE~fDAlPv~~~~~~~~~~~E~~V~~~~~~~~~~~~~~~~~~~~~~  200 (365)
T d1zkda1         143 EDVPEG-PAVILANEYFDVLPIHQAIKRETGWHERVIEIGASGELVFGVAADPIPGFEA  200 (365)
T ss_dssp             GGSCCS-SEEEEEESSGGGSCCEEEEEETTEEEEEEEEECTTSCEEEEECSSCCTTCGG
T ss_pred             hhcccC-CeEEEecccCccccceEEEEcCccceeeeeeecccceeEEeeccccchhHHh
Confidence            999876 8999999999999999999999999999999988888988887766665443



>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure