Citrus Sinensis ID: 020914
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 320 | ||||||
| 255552073 | 330 | heat shock protein 70 (HSP70)-interactin | 0.987 | 0.957 | 0.832 | 1e-159 | |
| 224099829 | 334 | predicted protein [Populus trichocarpa] | 0.981 | 0.940 | 0.821 | 1e-158 | |
| 449455294 | 331 | PREDICTED: RNA polymerase II-associated | 0.971 | 0.939 | 0.826 | 1e-156 | |
| 224111122 | 334 | predicted protein [Populus trichocarpa] | 0.981 | 0.940 | 0.808 | 1e-155 | |
| 225432762 | 330 | PREDICTED: serine/threonine-protein phos | 0.993 | 0.963 | 0.792 | 1e-154 | |
| 297737096 | 329 | unnamed protein product [Vitis vinifera] | 0.993 | 0.966 | 0.792 | 1e-154 | |
| 356537369 | 325 | PREDICTED: RNA polymerase II-associated | 1.0 | 0.984 | 0.790 | 1e-153 | |
| 449516834 | 338 | PREDICTED: LOW QUALITY PROTEIN: RNA poly | 0.971 | 0.920 | 0.805 | 1e-152 | |
| 359806614 | 324 | uncharacterized protein LOC100790717 [Gl | 0.981 | 0.969 | 0.802 | 1e-152 | |
| 15219673 | 328 | tetratricopeptide repeat-containing prot | 0.981 | 0.957 | 0.767 | 1e-146 |
| >gi|255552073|ref|XP_002517081.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] gi|223543716|gb|EEF45244.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 566 bits (1459), Expect = e-159, Method: Compositional matrix adjust.
Identities = 263/316 (83%), Positives = 292/316 (92%)
Query: 5 AEEMSLKDKGNEFFKAGNYLKAAALYTQAIKQDPSNPTLFSNRAAAFLHLVKLNKALADA 64
EE+SLKDKGNEFFKAGNYLKAAALYTQAIK DPSNPTL+SNRAAAFL LVKLNKALADA
Sbjct: 15 GEEVSLKDKGNEFFKAGNYLKAAALYTQAIKLDPSNPTLYSNRAAAFLQLVKLNKALADA 74
Query: 65 ETTISLNPQWEKGYFRKGCILEAMEQYDDALSAFQTALQYNPQSAEVSRKIKRVSQLAKD 124
E TI+LNPQWEKGYFRKGC+LEAME+YDDA +AFQTAL+YNPQS+EVSRKIKR+SQLAK+
Sbjct: 75 EMTITLNPQWEKGYFRKGCVLEAMERYDDASAAFQTALKYNPQSSEVSRKIKRISQLAKE 134
Query: 125 KKRAQEVENIRSNVDMVQHLDEFKSEMSEKYGAEECWKHVFSFVVETMETAVKSWHETSK 184
KKRAQEVE++RSNVD+ +H D+ KSEMSEK G+EEC K +FSF+VETME AVKSWHETSK
Sbjct: 135 KKRAQEVESMRSNVDLAKHFDKLKSEMSEKIGSEECLKEIFSFLVETMEMAVKSWHETSK 194
Query: 185 VDAKVYFLLDKEKTDTEKYAPIVNVDKAFESPHTHGSCFQFLRQYADDSFSSAACLVAPK 244
VD +VYFLLDKEKT ++KYAP VN+DKAFESPHTH SCF FLRQYA++SFS AACLVAPK
Sbjct: 195 VDPRVYFLLDKEKTQSDKYAPAVNIDKAFESPHTHSSCFTFLRQYAEESFSKAACLVAPK 254
Query: 245 SIISYPQVWRGQGLRKWRHSQQDGFFVQFESPLLRKLWFIPSSNEKGKTLCRDPEVLDIS 304
SIISYPQVW+GQG RKW+H Q DGFFVQFESP LRKLWFI S+NEKG+TLCRDPE+LDIS
Sbjct: 255 SIISYPQVWKGQGSRKWKHGQHDGFFVQFESPCLRKLWFISSTNEKGQTLCRDPEMLDIS 314
Query: 305 AHEVFPRLFKEKLSNS 320
AHEVFPRLFKEKL NS
Sbjct: 315 AHEVFPRLFKEKLPNS 330
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224099829|ref|XP_002311636.1| predicted protein [Populus trichocarpa] gi|222851456|gb|EEE89003.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449455294|ref|XP_004145388.1| PREDICTED: RNA polymerase II-associated protein 3-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224111122|ref|XP_002315755.1| predicted protein [Populus trichocarpa] gi|222864795|gb|EEF01926.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225432762|ref|XP_002283155.1| PREDICTED: serine/threonine-protein phosphatase 5-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297737096|emb|CBI26297.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356537369|ref|XP_003537200.1| PREDICTED: RNA polymerase II-associated protein 3-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449516834|ref|XP_004165451.1| PREDICTED: LOW QUALITY PROTEIN: RNA polymerase II-associated protein 3-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|359806614|ref|NP_001241273.1| uncharacterized protein LOC100790717 [Glycine max] gi|255644906|gb|ACU22953.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|15219673|ref|NP_171915.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana] gi|19423984|gb|AAL87273.1| unknown protein [Arabidopsis thaliana] gi|21281239|gb|AAM45091.1| unknown protein [Arabidopsis thaliana] gi|332189547|gb|AEE27668.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 320 | ||||||
| TAIR|locus:2020240 | 328 | TPR3 "tetratricopeptide repeat | 0.987 | 0.963 | 0.766 | 3.3e-134 | |
| FB|FBgn0024352 | 490 | Hop "Hsp70/Hsp90 organizing pr | 0.434 | 0.283 | 0.395 | 3e-20 | |
| WB|WBGene00019983 | 320 | sti-1 [Caenorhabditis elegans | 0.375 | 0.375 | 0.388 | 2.6e-19 | |
| TAIR|locus:2026197 | 571 | Hop2 "Hop2" [Arabidopsis thali | 0.353 | 0.197 | 0.412 | 5.4e-19 | |
| ZFIN|ZDB-GENE-041121-17 | 542 | stip1 "stress-induced-phosphop | 0.437 | 0.258 | 0.370 | 5.5e-17 | |
| UNIPROTKB|Q43468 | 569 | STI "Heat shock protein STI" [ | 0.353 | 0.198 | 0.403 | 8.5e-17 | |
| TAIR|locus:2034620 | 572 | Hop1 "Hop1" [Arabidopsis thali | 0.353 | 0.197 | 0.385 | 1.3e-16 | |
| TAIR|locus:2139109 | 558 | Hop3 "AT4G12400" [Arabidopsis | 0.459 | 0.263 | 0.346 | 2.2e-16 | |
| UNIPROTKB|Q3ZBZ8 | 543 | STIP1 "Stress-induced-phosphop | 0.437 | 0.257 | 0.364 | 1.9e-15 | |
| UNIPROTKB|P31948 | 543 | STIP1 "Stress-induced-phosphop | 0.403 | 0.237 | 0.372 | 1.9e-15 |
| TAIR|locus:2020240 TPR3 "tetratricopeptide repeat 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1315 (468.0 bits), Expect = 3.3e-134, P = 3.3e-134
Identities = 243/317 (76%), Positives = 279/317 (88%)
Query: 4 EAEEMSLKDKGNEFFKAGNYLKAAALYTQAIKQDPSNPTLFSNRAAAFLHLVKLNKALAD 63
EAE+ SLK+KGNEFFKAGN+LKAAALYTQAIK DPSN TL+SNRAAAFL LVKL+KALAD
Sbjct: 13 EAEK-SLKEKGNEFFKAGNFLKAAALYTQAIKLDPSNATLYSNRAAAFLSLVKLSKALAD 71
Query: 64 AETTISLNPQWEKGYFRKGCILEAMEQYDDALSAFQTALQYNPQSAEVSRKIKRVSQLAK 123
AETTI LNPQWEKGYFRKGC+LEAME+Y+DAL+AF+ ALQYNPQS EVSRKIKR+ QL K
Sbjct: 72 AETTIKLNPQWEKGYFRKGCVLEAMEKYEDALAAFEMALQYNPQSTEVSRKIKRLGQLQK 131
Query: 124 DKKRAQEVENIRSNVDMVQHLDEFKSEMSEKYGAEECWKHVFSFVVETMETAVKSWHETS 183
+K+RAQE+EN+RSNVDM +HL+ FKSEMSE YG EECWK +FSF+VETMETAVKSWHETS
Sbjct: 132 EKQRAQELENLRSNVDMAKHLESFKSEMSENYGTEECWKEMFSFIVETMETAVKSWHETS 191
Query: 184 KVDAKVYFLLDKEKTDTEKYAPIVNVDKAFESPHTHGSCFQFLRQYADDSFSSAACLVAP 243
KVD +VYFLLDKEKT T+KYAP VN+DKAF+SP TH +CF +LRQYA++SFS AACLV P
Sbjct: 192 KVDTRVYFLLDKEKTQTDKYAPAVNIDKAFQSPDTHSNCFTYLRQYAEESFSKAACLVTP 251
Query: 244 KSIISYPQVWRGQGLRKWRHSQQDGFFVQFESPLLRKLWFIPSSNEKGKTLCRDPEVLDI 303
KS ISYPQVW+G G RKW+ DG FVQFESP LRK+WFI SS EKG+TLCR+P+ LDI
Sbjct: 252 KSSISYPQVWKGVGSRKWKLGPNDGIFVQFESPSLRKVWFISSSKEKGQTLCREPQALDI 311
Query: 304 SAHEVFPRLFKEKLSNS 320
AHE+ PR+FKEK +S
Sbjct: 312 GAHEILPRIFKEKSKSS 328
|
|
| FB|FBgn0024352 Hop "Hsp70/Hsp90 organizing protein homolog" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00019983 sti-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2026197 Hop2 "Hop2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-041121-17 stip1 "stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q43468 STI "Heat shock protein STI" [Glycine max (taxid:3847)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2034620 Hop1 "Hop1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2139109 Hop3 "AT4G12400" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3ZBZ8 STIP1 "Stress-induced-phosphoprotein 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P31948 STIP1 "Stress-induced-phosphoprotein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_fgenesh4_pm.C_LG_VIII0670 | hypothetical protein (334 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 320 | |||
| cd00189 | 100 | cd00189, TPR, Tetratricopeptide repeat domain; typ | 1e-22 | |
| PLN03088 | 356 | PLN03088, PLN03088, SGT1, suppressor of G2 allele | 8e-16 | |
| pfam13414 | 69 | pfam13414, TPR_11, TPR repeat | 6e-13 | |
| TIGR00990 | 615 | TIGR00990, 3a0801s09, mitochondrial precursor prot | 2e-09 | |
| TIGR02917 | 899 | TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system | 3e-06 | |
| TIGR02917 | 899 | TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system | 3e-05 | |
| pfam13432 | 65 | pfam13432, TPR_16, Tetratricopeptide repeat | 4e-05 | |
| COG0457 | 291 | COG0457, NrfG, FOG: TPR repeat [General function p | 7e-05 | |
| pfam00515 | 34 | pfam00515, TPR_1, Tetratricopeptide repeat | 2e-04 | |
| TIGR03939 | 800 | TIGR03939, PGA_TPR_OMP, poly-beta-1,6 N-acetyl-D-g | 2e-04 | |
| smart00028 | 34 | smart00028, TPR, Tetratricopeptide repeats | 3e-04 | |
| pfam07719 | 34 | pfam07719, TPR_2, Tetratricopeptide repeat | 7e-04 | |
| COG0457 | 291 | COG0457, NrfG, FOG: TPR repeat [General function p | 0.002 | |
| COG0457 | 291 | COG0457, NrfG, FOG: TPR repeat [General function p | 0.002 | |
| pfam13414 | 69 | pfam13414, TPR_11, TPR repeat | 0.003 | |
| TIGR00990 | 615 | TIGR00990, 3a0801s09, mitochondrial precursor prot | 0.003 | |
| TIGR03302 | 235 | TIGR03302, OM_YfiO, outer membrane assembly lipopr | 0.003 |
| >gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here | Back alignment and domain information |
|---|
Score = 89.7 bits (223), Expect = 1e-22
Identities = 34/98 (34%), Positives = 56/98 (57%)
Query: 10 LKDKGNEFFKAGNYLKAAALYTQAIKQDPSNPTLFSNRAAAFLHLVKLNKALADAETTIS 69
L + GN ++K G+Y +A Y +A++ DP N + N AAA+ L K +AL D E +
Sbjct: 3 LLNLGNLYYKLGDYDEALEYYEKALELDPDNADAYYNLAAAYYKLGKYEEALEDYEKALE 62
Query: 70 LNPQWEKGYFRKGCILEAMEQYDDALSAFQTALQYNPQ 107
L+P K Y+ G + +Y++AL A++ AL+ +P
Sbjct: 63 LDPDNAKAYYNLGLAYYKLGKYEEALEAYEKALELDPN 100
|
Length = 100 |
| >gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222112 pfam13414, TPR_11, TPR repeat | Back alignment and domain information |
|---|
| >gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|234406 TIGR03939, PGA_TPR_OMP, poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA | Back alignment and domain information |
|---|
| >gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|222112 pfam13414, TPR_11, TPR repeat | Back alignment and domain information |
|---|
| >gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >gnl|CDD|234164 TIGR03302, OM_YfiO, outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 320 | |||
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 100.0 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 99.97 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 99.93 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 99.93 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 99.91 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 99.9 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 99.9 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 99.9 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 99.89 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 99.88 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 99.88 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 99.87 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 99.87 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 99.87 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 99.87 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 99.85 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 99.83 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 99.83 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 99.82 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 99.82 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 99.82 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 99.82 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 99.82 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 99.82 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 99.82 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 99.81 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 99.81 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 99.81 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 99.81 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 99.81 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 99.79 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 99.78 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 99.78 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 99.78 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 99.76 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 99.75 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 99.74 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 99.74 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 99.73 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 99.73 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 99.73 | |
| PLN02789 | 320 | farnesyltranstransferase | 99.72 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 99.71 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 99.71 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 99.7 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 99.7 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 99.69 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 99.69 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 99.69 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.68 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 99.67 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 99.66 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 99.66 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 99.66 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 99.65 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 99.64 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 99.64 | |
| PLN02789 | 320 | farnesyltranstransferase | 99.63 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 99.63 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 99.62 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 99.62 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 99.61 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 99.61 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 99.6 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 99.58 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 99.58 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 99.57 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 99.57 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 99.56 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 99.56 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 99.56 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 99.55 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 99.55 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 99.54 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 99.54 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 99.54 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 99.53 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 99.52 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 99.52 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 99.52 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 99.51 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 99.51 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 99.51 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 99.5 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 99.49 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 99.49 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 99.49 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.48 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 99.47 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 99.47 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 99.47 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 99.46 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 99.45 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 99.45 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 99.44 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 99.44 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 99.43 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 99.43 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 99.41 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 99.4 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 99.39 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 99.38 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 99.37 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 99.37 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 99.36 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 99.36 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 99.36 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 99.36 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 99.36 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 99.35 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 99.34 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 99.34 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 99.33 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 99.32 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 99.31 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 99.28 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 99.27 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 99.24 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 99.22 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 99.21 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 99.2 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 99.2 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 99.2 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 99.2 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 99.19 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 99.19 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 99.18 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 99.17 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 99.16 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 99.16 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 99.15 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 99.15 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 99.15 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 99.14 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 99.14 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 99.14 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 99.14 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 99.13 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 99.13 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 99.12 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 99.11 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 99.1 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 99.09 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 99.09 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 99.08 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 99.07 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 99.07 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 99.06 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 99.05 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 99.05 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 99.05 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 99.04 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 99.04 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 99.04 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 99.03 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 99.03 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 99.01 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 98.97 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 98.96 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 98.95 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 98.93 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 98.92 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 98.91 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 98.9 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 98.89 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 98.89 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 98.89 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 98.87 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 98.86 | |
| KOG0551 | 390 | consensus Hsp90 co-chaperone CNS1 (contains TPR re | 98.84 | |
| KOG1915 | 677 | consensus Cell cycle control protein (crooked neck | 98.82 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 98.8 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 98.77 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 98.76 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 98.73 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 98.72 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 98.71 | |
| COG4700 | 251 | Uncharacterized protein conserved in bacteria cont | 98.69 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 98.69 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 98.61 | |
| KOG1308 | 377 | consensus Hsp70-interacting protein Hip/Transient | 98.61 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 98.61 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 98.6 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 98.6 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 98.59 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 98.57 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 98.56 | |
| COG0457 | 291 | NrfG FOG: TPR repeat [General function prediction | 98.55 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 98.55 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 98.55 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 98.54 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 98.51 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 98.46 | |
| KOG2047 | 835 | consensus mRNA splicing factor [RNA processing and | 98.46 | |
| COG0457 | 291 | NrfG FOG: TPR repeat [General function prediction | 98.45 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 98.45 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 98.44 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 98.43 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 98.38 | |
| COG4700 | 251 | Uncharacterized protein conserved in bacteria cont | 98.37 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 98.36 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 98.31 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 98.31 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 98.3 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 98.3 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 98.28 | |
| KOG2610 | 491 | consensus Uncharacterized conserved protein [Funct | 98.25 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 98.24 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 98.24 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 98.22 | |
| KOG2047 | 835 | consensus mRNA splicing factor [RNA processing and | 98.19 | |
| KOG1915 | 677 | consensus Cell cycle control protein (crooked neck | 98.17 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 98.17 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 98.17 | |
| KOG1585 | 308 | consensus Protein required for fusion of vesicles | 98.14 | |
| KOG1308 | 377 | consensus Hsp70-interacting protein Hip/Transient | 98.09 | |
| KOG2796 | 366 | consensus Uncharacterized conserved protein [Funct | 98.02 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 98.02 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 97.98 | |
| KOG2796 | 366 | consensus Uncharacterized conserved protein [Funct | 97.97 | |
| KOG3081 | 299 | consensus Vesicle coat complex COPI, epsilon subun | 97.96 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 97.91 | |
| KOG2471 | 696 | consensus TPR repeat-containing protein [General f | 97.91 | |
| KOG0551 | 390 | consensus Hsp90 co-chaperone CNS1 (contains TPR re | 97.86 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 97.86 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 97.79 | |
| KOG3081 | 299 | consensus Vesicle coat complex COPI, epsilon subun | 97.79 | |
| COG2976 | 207 | Uncharacterized protein conserved in bacteria [Fun | 97.78 | |
| KOG1310 | 758 | consensus WD40 repeat protein [General function pr | 97.78 | |
| KOG4507 | 886 | consensus Uncharacterized conserved protein, conta | 97.77 | |
| PRK10941 | 269 | hypothetical protein; Provisional | 97.74 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 97.72 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 97.69 | |
| PF04781 | 111 | DUF627: Protein of unknown function (DUF627); Inte | 97.69 | |
| PF12968 | 144 | DUF3856: Domain of Unknown Function (DUF3856); Int | 97.69 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 97.67 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 97.64 | |
| KOG1585 | 308 | consensus Protein required for fusion of vesicles | 97.63 | |
| PRK10941 | 269 | hypothetical protein; Provisional | 97.62 | |
| KOG3824 | 472 | consensus Huntingtin interacting protein HYPE [Gen | 97.61 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 97.61 | |
| PF10300 | 468 | DUF3808: Protein of unknown function (DUF3808); In | 97.6 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 97.6 | |
| PF04184 | 539 | ST7: ST7 protein; InterPro: IPR007311 The ST7 (for | 97.6 | |
| PF10300 | 468 | DUF3808: Protein of unknown function (DUF3808); In | 97.58 | |
| PF13281 | 374 | DUF4071: Domain of unknown function (DUF4071) | 97.57 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 97.55 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 97.54 | |
| KOG3824 | 472 | consensus Huntingtin interacting protein HYPE [Gen | 97.51 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 97.49 | |
| PF09613 | 160 | HrpB1_HrpK: Bacterial type III secretion protein ( | 97.46 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 97.42 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 97.41 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 97.39 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 97.38 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 97.36 | |
| PF08424 | 321 | NRDE-2: NRDE-2, necessary for RNA interference; In | 97.35 | |
| KOG2396 | 568 | consensus HAT (Half-A-TPR) repeat-containing prote | 97.31 | |
| PF14561 | 90 | TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S | 97.31 | |
| PF14561 | 90 | TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S | 97.22 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 97.21 | |
| PF02259 | 352 | FAT: FAT domain; InterPro: IPR003151 The FAT domai | 97.19 | |
| KOG2471 | 696 | consensus TPR repeat-containing protein [General f | 97.08 | |
| KOG1464 | 440 | consensus COP9 signalosome, subunit CSN2 [Posttran | 97.07 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 97.05 | |
| TIGR02561 | 153 | HrpB1_HrpK type III secretion protein HrpB1/HrpK. | 97.01 | |
| KOG2610 | 491 | consensus Uncharacterized conserved protein [Funct | 96.97 | |
| PF08631 | 278 | SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: | 96.97 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 96.9 | |
| COG3898 | 531 | Uncharacterized membrane-bound protein [Function u | 96.87 | |
| KOG0546 | 372 | consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos | 96.86 | |
| PF10602 | 177 | RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 | 96.83 | |
| PF04781 | 111 | DUF627: Protein of unknown function (DUF627); Inte | 96.82 | |
| PF15015 | 569 | NYD-SP12_N: Spermatogenesis-associated, N-terminal | 96.78 | |
| PF13281 | 374 | DUF4071: Domain of unknown function (DUF4071) | 96.77 | |
| PF04184 | 539 | ST7: ST7 protein; InterPro: IPR007311 The ST7 (for | 96.75 | |
| KOG0530 | 318 | consensus Protein farnesyltransferase, alpha subun | 96.7 | |
| PF04910 | 360 | Tcf25: Transcriptional repressor TCF25; InterPro: | 96.64 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 96.63 | |
| KOG2300 | 629 | consensus Uncharacterized conserved protein [Funct | 96.63 | |
| KOG2449 | 157 | consensus Methylmalonate semialdehyde dehydrogenas | 96.61 | |
| KOG4507 | 886 | consensus Uncharacterized conserved protein, conta | 96.58 | |
| KOG1550 | 552 | consensus Extracellular protein SEL-1 and related | 96.57 | |
| KOG4814 | 872 | consensus Uncharacterized conserved protein [Funct | 96.51 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 96.5 | |
| PF08424 | 321 | NRDE-2: NRDE-2, necessary for RNA interference; In | 96.5 | |
| COG5191 | 435 | Uncharacterized conserved protein, contains HAT (H | 96.5 | |
| KOG2300 | 629 | consensus Uncharacterized conserved protein [Funct | 96.48 | |
| KOG3364 | 149 | consensus Membrane protein involved in organellar | 96.45 | |
| COG2912 | 269 | Uncharacterized conserved protein [Function unknow | 96.45 | |
| COG2976 | 207 | Uncharacterized protein conserved in bacteria [Fun | 96.45 | |
| KOG1258 | 577 | consensus mRNA processing protein [RNA processing | 96.42 | |
| PF09613 | 160 | HrpB1_HrpK: Bacterial type III secretion protein ( | 96.42 | |
| KOG1839 | 1236 | consensus Uncharacterized protein CLU1/cluA/TIF31 | 96.34 | |
| COG2912 | 269 | Uncharacterized conserved protein [Function unknow | 96.32 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 96.25 | |
| COG3914 | 620 | Spy Predicted O-linked N-acetylglucosamine transfe | 96.2 | |
| KOG1550 | 552 | consensus Extracellular protein SEL-1 and related | 96.15 | |
| KOG3364 | 149 | consensus Membrane protein involved in organellar | 96.13 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 96.11 | |
| COG2909 | 894 | MalT ATP-dependent transcriptional regulator [Tran | 96.01 | |
| COG0790 | 292 | FOG: TPR repeat, SEL1 subfamily [General function | 96.01 | |
| PF10516 | 38 | SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat | 96.01 | |
| PF02259 | 352 | FAT: FAT domain; InterPro: IPR003151 The FAT domai | 95.86 | |
| PRK13184 | 932 | pknD serine/threonine-protein kinase; Reviewed | 95.75 | |
| KOG1839 | 1236 | consensus Uncharacterized protein CLU1/cluA/TIF31 | 95.62 | |
| KOG0529 | 421 | consensus Protein geranylgeranyltransferase type I | 95.6 | |
| KOG1464 | 440 | consensus COP9 signalosome, subunit CSN2 [Posttran | 95.47 | |
| PF12862 | 94 | Apc5: Anaphase-promoting complex subunit 5 | 95.41 | |
| PF10373 | 278 | EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP | 95.38 | |
| KOG3616 | 1636 | consensus Selective LIM binding factor [Transcript | 95.32 | |
| PF07720 | 36 | TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 | 95.29 | |
| KOG1914 | 656 | consensus mRNA cleavage and polyadenylation factor | 95.25 | |
| PF10579 | 80 | Rapsyn_N: Rapsyn N-terminal myristoylation and lin | 95.1 | |
| KOG4151 | 748 | consensus Myosin assembly protein/sexual cycle pro | 95.09 | |
| PF10516 | 38 | SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat | 95.08 | |
| COG3914 | 620 | Spy Predicted O-linked N-acetylglucosamine transfe | 95.04 | |
| PF04910 | 360 | Tcf25: Transcriptional repressor TCF25; InterPro: | 95.03 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 95.02 | |
| PF10579 | 80 | Rapsyn_N: Rapsyn N-terminal myristoylation and lin | 94.97 | |
| KOG4814 | 872 | consensus Uncharacterized conserved protein [Funct | 94.96 | |
| PF07079 | 549 | DUF1347: Protein of unknown function (DUF1347); In | 94.96 | |
| PF12862 | 94 | Apc5: Anaphase-promoting complex subunit 5 | 94.95 | |
| TIGR02561 | 153 | HrpB1_HrpK type III secretion protein HrpB1/HrpK. | 94.88 | |
| KOG2396 | 568 | consensus HAT (Half-A-TPR) repeat-containing prote | 94.73 | |
| KOG0530 | 318 | consensus Protein farnesyltransferase, alpha subun | 94.68 | |
| KOG1258 | 577 | consensus mRNA processing protein [RNA processing | 94.68 | |
| KOG1310 | 758 | consensus WD40 repeat protein [General function pr | 94.65 | |
| PF07720 | 36 | TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 | 94.62 | |
| PF12968 | 144 | DUF3856: Domain of Unknown Function (DUF3856); Int | 94.59 | |
| COG3898 | 531 | Uncharacterized membrane-bound protein [Function u | 94.51 | |
| PF07721 | 26 | TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 | 94.31 | |
| KOG0985 | 1666 | consensus Vesicle coat protein clathrin, heavy cha | 94.31 | |
| COG3629 | 280 | DnrI DNA-binding transcriptional activator of the | 94.26 | |
| PF07721 | 26 | TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 | 94.25 | |
| PF08631 | 278 | SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: | 94.24 | |
| PF10602 | 177 | RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 | 94.22 | |
| COG3629 | 280 | DnrI DNA-binding transcriptional activator of the | 94.03 | |
| COG5191 | 435 | Uncharacterized conserved protein, contains HAT (H | 94.0 | |
| KOG0985 | 1666 | consensus Vesicle coat protein clathrin, heavy cha | 93.9 | |
| COG3947 | 361 | Response regulator containing CheY-like receiver a | 93.49 | |
| PF11207 | 203 | DUF2989: Protein of unknown function (DUF2989); In | 93.39 | |
| PF10373 | 278 | EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP | 93.36 | |
| PF07079 | 549 | DUF1347: Protein of unknown function (DUF1347); In | 93.35 | |
| PF15015 | 569 | NYD-SP12_N: Spermatogenesis-associated, N-terminal | 93.29 | |
| PRK15180 | 831 | Vi polysaccharide biosynthesis protein TviD; Provi | 93.04 | |
| KOG0529 | 421 | consensus Protein geranylgeranyltransferase type I | 92.97 | |
| smart00386 | 33 | HAT HAT (Half-A-TPR) repeats. Present in several R | 92.97 | |
| COG2909 | 894 | MalT ATP-dependent transcriptional regulator [Tran | 92.91 | |
| KOG2041 | 1189 | consensus WD40 repeat protein [General function pr | 92.57 | |
| COG3947 | 361 | Response regulator containing CheY-like receiver a | 92.21 | |
| COG5159 | 421 | RPN6 26S proteasome regulatory complex component [ | 92.11 | |
| PF10345 | 608 | Cohesin_load: Cohesin loading factor; InterPro: IP | 91.96 | |
| cd02682 | 75 | MIT_AAA_Arch MIT: domain contained within Microtub | 91.86 | |
| PF14863 | 141 | Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB | 91.78 | |
| PF10345 | 608 | Cohesin_load: Cohesin loading factor; InterPro: IP | 91.74 | |
| PF10255 | 404 | Paf67: RNA polymerase I-associated factor PAF67; I | 91.48 | |
| PF11207 | 203 | DUF2989: Protein of unknown function (DUF2989); In | 91.37 | |
| KOG0890 | 2382 | consensus Protein kinase of the PI-3 kinase family | 91.12 | |
| smart00386 | 33 | HAT HAT (Half-A-TPR) repeats. Present in several R | 90.75 | |
| PRK15180 | 831 | Vi polysaccharide biosynthesis protein TviD; Provi | 90.61 | |
| COG0790 | 292 | FOG: TPR repeat, SEL1 subfamily [General function | 90.55 | |
| KOG1914 | 656 | consensus mRNA cleavage and polyadenylation factor | 90.31 | |
| KOG3807 | 556 | consensus Predicted membrane protein ST7 (tumor su | 90.2 | |
| PF10255 | 404 | Paf67: RNA polymerase I-associated factor PAF67; I | 90.03 | |
| KOG0890 | 2382 | consensus Protein kinase of the PI-3 kinase family | 89.85 | |
| PF11817 | 247 | Foie-gras_1: Foie gras liver health family 1; Inte | 89.67 | |
| KOG2422 | 665 | consensus Uncharacterized conserved protein [Funct | 89.52 | |
| KOG0686 | 466 | consensus COP9 signalosome, subunit CSN1 [Posttran | 89.14 | |
| PRK13184 | 932 | pknD serine/threonine-protein kinase; Reviewed | 89.13 | |
| PF14863 | 141 | Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB | 89.1 | |
| KOG0546 | 372 | consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos | 89.01 | |
| cd02682 | 75 | MIT_AAA_Arch MIT: domain contained within Microtub | 89.01 | |
| KOG2041 | 1189 | consensus WD40 repeat protein [General function pr | 88.95 | |
| COG4941 | 415 | Predicted RNA polymerase sigma factor containing a | 88.87 | |
| PF10952 | 140 | DUF2753: Protein of unknown function (DUF2753); In | 88.85 | |
| KOG2581 | 493 | consensus 26S proteasome regulatory complex, subun | 88.68 | |
| PF04053 | 443 | Coatomer_WDAD: Coatomer WD associated region ; Int | 88.57 | |
| KOG2422 | 665 | consensus Uncharacterized conserved protein [Funct | 88.15 | |
| COG4455 | 273 | ImpE Protein of avirulence locus involved in tempe | 87.93 | |
| PRK15490 | 578 | Vi polysaccharide biosynthesis protein TviE; Provi | 87.84 | |
| KOG3616 | 1636 | consensus Selective LIM binding factor [Transcript | 87.57 | |
| PF09670 | 379 | Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 | 87.02 | |
| TIGR03504 | 44 | FimV_Cterm FimV C-terminal domain. This protein is | 86.75 | |
| COG4455 | 273 | ImpE Protein of avirulence locus involved in tempe | 86.49 | |
| TIGR03504 | 44 | FimV_Cterm FimV C-terminal domain. This protein is | 85.66 | |
| PF04212 | 69 | MIT: MIT (microtubule interacting and transport) d | 85.54 | |
| cd02681 | 76 | MIT_calpain7_1 MIT: domain contained within Microt | 85.5 | |
| cd02683 | 77 | MIT_1 MIT: domain contained within Microtubule Int | 85.32 | |
| PF04212 | 69 | MIT: MIT (microtubule interacting and transport) d | 85.27 | |
| cd02681 | 76 | MIT_calpain7_1 MIT: domain contained within Microt | 85.06 | |
| cd02679 | 79 | MIT_spastin MIT: domain contained within Microtubu | 84.86 | |
| PF11817 | 247 | Foie-gras_1: Foie gras liver health family 1; Inte | 84.59 | |
| PF09797 | 365 | NatB_MDM20: N-acetyltransferase B complex (NatB) n | 83.29 | |
| PHA02537 | 230 | M terminase endonuclease subunit; Provisional | 83.02 | |
| cd02680 | 75 | MIT_calpain7_2 MIT: domain contained within Microt | 82.47 | |
| KOG3783 | 546 | consensus Uncharacterized conserved protein [Funct | 81.77 | |
| PF12854 | 34 | PPR_1: PPR repeat | 81.15 | |
| KOG2561 | 568 | consensus Adaptor protein NUB1, contains UBA domai | 81.12 | |
| COG5107 | 660 | RNA14 Pre-mRNA 3'-end processing (cleavage and pol | 80.11 |
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.9e-34 Score=245.78 Aligned_cols=280 Identities=13% Similarity=0.122 Sum_probs=246.3
Q ss_pred cchHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHccCHHHHHHHHHHHHhcCCCCHHHHHHH
Q 020914 2 AAEAEEMSLKDKGNEFFKAGNYLKAAALYTQAIKQDPSNPTLFSNRAAAFLHLVKLNKALADAETTISLNPQWEKGYFRK 81 (320)
Q Consensus 2 ~~p~~a~~~~~~g~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~l~p~~~~~~~~l 81 (320)
+.|.-+.+|.++|.++..+|+...||..|++|+.++|+...+|+++|.+|...+.++.|+.+|.+|+.+.|+++.++-++
T Consensus 213 ~qp~fAiawsnLg~~f~~~Gei~~aiq~y~eAvkldP~f~dAYiNLGnV~ke~~~~d~Avs~Y~rAl~lrpn~A~a~gNl 292 (966)
T KOG4626|consen 213 TQPCFAIAWSNLGCVFNAQGEIWLAIQHYEEAVKLDPNFLDAYINLGNVYKEARIFDRAVSCYLRALNLRPNHAVAHGNL 292 (966)
T ss_pred hCCceeeeehhcchHHhhcchHHHHHHHHHHhhcCCCcchHHHhhHHHHHHHHhcchHHHHHHHHHHhcCCcchhhccce
Confidence 46777889999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHccCHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHhHHHHHHHHhhhhcchhhh
Q 020914 82 GCILEAMEQYDDALSAFQTALQYNPQSAEVSRKIKRVSQLAKDKKRAQEVENIRSNVDMVQHLDEFKSEMSEKYGAEECW 161 (320)
Q Consensus 82 g~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 161 (320)
|.+|..+|..+-||.+|++||++.|+.++++.+++..+...|+..+|...+. .+..+.+..+....++|+++..
T Consensus 293 a~iYyeqG~ldlAI~~Ykral~~~P~F~~Ay~NlanALkd~G~V~ea~~cYn------kaL~l~p~hadam~NLgni~~E 366 (966)
T KOG4626|consen 293 ACIYYEQGLLDLAIDTYKRALELQPNFPDAYNNLANALKDKGSVTEAVDCYN------KALRLCPNHADAMNNLGNIYRE 366 (966)
T ss_pred EEEEeccccHHHHHHHHHHHHhcCCCchHHHhHHHHHHHhccchHHHHHHHH------HHHHhCCccHHHHHHHHHHHHH
Confidence 9999999999999999999999999999999999999999999999977752 2233334455566677888887
Q ss_pred hhHHHHHHHHHHHHHHhHhhccccChh---HHhhhcChhHHHHhhhhhhccccCcCCccc-hhhHHHHhhHH--HHHHHH
Q 020914 162 KHVFSFVVETMETAVKSWHETSKVDAK---VYFLLDKEKTDTEKYAPIVNVDKAFESPHT-HGSCFQFLRQY--ADDSFS 235 (320)
Q Consensus 162 ~~~~~~a~~~~~~a~~~~~~~~~~~~~---~~~~lg~~~~A~~~~~~a~~~~~~~~~~~~-~g~~~~~~~~~--A~~~~~ 235 (320)
.|.++.|...|.+|++.++.-..-..+ +|..+|++++|+..|+.++.|+|.+..... +|..|..+|+. |+.+|+
T Consensus 367 ~~~~e~A~~ly~~al~v~p~~aaa~nNLa~i~kqqgnl~~Ai~~YkealrI~P~fAda~~NmGnt~ke~g~v~~A~q~y~ 446 (966)
T KOG4626|consen 367 QGKIEEATRLYLKALEVFPEFAAAHNNLASIYKQQGNLDDAIMCYKEALRIKPTFADALSNMGNTYKEMGDVSAAIQCYT 446 (966)
T ss_pred hccchHHHHHHHHHHhhChhhhhhhhhHHHHHHhcccHHHHHHHHHHHHhcCchHHHHHHhcchHHHHhhhHHHHHHHHH
Confidence 787888888887777777665444443 999999999999999999999999866655 99999999998 999999
Q ss_pred HHhchhCCCCCCChhHhhhcccccccccCcccchhhhcccccccccccccccccccc
Q 020914 236 SAACLVAPKSIISYPQVWRGQGLRKWRHSQQDGFFVQFESPLLRKLWFIPSSNEKGK 292 (320)
Q Consensus 236 ~al~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 292 (320)
+||.. +|.++++..|+|+.+...|...+++..+++++..++.|..+..+...
T Consensus 447 rAI~~-----nPt~AeAhsNLasi~kDsGni~~AI~sY~~aLklkPDfpdA~cNllh 498 (966)
T KOG4626|consen 447 RAIQI-----NPTFAEAHSNLASIYKDSGNIPEAIQSYRTALKLKPDFPDAYCNLLH 498 (966)
T ss_pred HHHhc-----CcHHHHHHhhHHHHhhccCCcHHHHHHHHHHHccCCCCchhhhHHHH
Confidence 99999 99999999999999999999999999999999888887766666543
|
|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG0457 NrfG FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >KOG2047 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG0457 NrfG FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG2610 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2047 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2796 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >KOG2796 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2471 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG2976 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG1310 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PRK10941 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK10941 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene | Back alignment and domain information |
|---|
| >PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans | Back alignment and domain information |
|---|
| >PF13281 DUF4071: Domain of unknown function (DUF4071) | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B | Back alignment and domain information |
|---|
| >PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases | Back alignment and domain information |
|---|
| >KOG2471 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK | Back alignment and domain information |
|---|
| >KOG2610 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >COG3898 Uncharacterized membrane-bound protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome | Back alignment and domain information |
|---|
| >PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal | Back alignment and domain information |
|---|
| >PF13281 DUF4071: Domain of unknown function (DUF4071) | Back alignment and domain information |
|---|
| >PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene | Back alignment and domain information |
|---|
| >KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2300 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2449 consensus Methylmalonate semialdehyde dehydrogenase [Amino acid transport and metabolism; Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4814 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2300 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >COG2912 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG2976 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG1258 consensus mRNA processing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia | Back alignment and domain information |
|---|
| >KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] | Back alignment and domain information |
|---|
| >COG2912 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >COG2909 MalT ATP-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases | Back alignment and domain information |
|---|
| >PRK13184 pknD serine/threonine-protein kinase; Reviewed | Back alignment and domain information |
|---|
| >KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12862 Apc5: Anaphase-promoting complex subunit 5 | Back alignment and domain information |
|---|
| >PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] | Back alignment and domain information |
|---|
| >KOG3616 consensus Selective LIM binding factor [Transcription] | Back alignment and domain information |
|---|
| >PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] | Back alignment and domain information |
|---|
| >KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane | Back alignment and domain information |
|---|
| >KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane | Back alignment and domain information |
|---|
| >KOG4814 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length | Back alignment and domain information |
|---|
| >PF12862 Apc5: Anaphase-promoting complex subunit 5 | Back alignment and domain information |
|---|
| >TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK | Back alignment and domain information |
|---|
| >KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1258 consensus mRNA processing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1310 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] | Back alignment and domain information |
|---|
| >PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT | Back alignment and domain information |
|---|
| >COG3898 Uncharacterized membrane-bound protein [Function unknown] | Back alignment and domain information |
|---|
| >PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models | Back alignment and domain information |
|---|
| >KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models | Back alignment and domain information |
|---|
| >PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] | Back alignment and domain information |
|---|
| >PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome | Back alignment and domain information |
|---|
| >COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed | Back alignment and domain information |
|---|
| >PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] | Back alignment and domain information |
|---|
| >PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length | Back alignment and domain information |
|---|
| >PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal | Back alignment and domain information |
|---|
| >PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional | Back alignment and domain information |
|---|
| >KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00386 HAT HAT (Half-A-TPR) repeats | Back alignment and domain information |
|---|
| >COG2909 MalT ATP-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >KOG2041 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi | Back alignment and domain information |
|---|
| >cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A | Back alignment and domain information |
|---|
| >PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi | Back alignment and domain information |
|---|
| >PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] | Back alignment and domain information |
|---|
| >PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed | Back alignment and domain information |
|---|
| >KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >smart00386 HAT HAT (Half-A-TPR) repeats | Back alignment and domain information |
|---|
| >PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional | Back alignment and domain information |
|---|
| >COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] | Back alignment and domain information |
|---|
| >PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] | Back alignment and domain information |
|---|
| >KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] | Back alignment and domain information |
|---|
| >KOG2422 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK13184 pknD serine/threonine-protein kinase; Reviewed | Back alignment and domain information |
|---|
| >PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A | Back alignment and domain information |
|---|
| >KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >KOG2041 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] | Back alignment and domain information |
|---|
| >PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins | Back alignment and domain information |
|---|
| >KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >KOG2422 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15490 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >KOG3616 consensus Selective LIM binding factor [Transcription] | Back alignment and domain information |
|---|
| >PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) | Back alignment and domain information |
|---|
| >TIGR03504 FimV_Cterm FimV C-terminal domain | Back alignment and domain information |
|---|
| >COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03504 FimV_Cterm FimV C-terminal domain | Back alignment and domain information |
|---|
| >PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking | Back alignment and domain information |
|---|
| >cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking | Back alignment and domain information |
|---|
| >cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >cd02679 MIT_spastin MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] | Back alignment and domain information |
|---|
| >PF09797 NatB_MDM20: N-acetyltransferase B complex (NatB) non catalytic subunit; InterPro: IPR019183 This is the non-catalytic subunit of the N-terminal acetyltransferase B complex (NatB) | Back alignment and domain information |
|---|
| >PHA02537 M terminase endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >cd02680 MIT_calpain7_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >KOG3783 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12854 PPR_1: PPR repeat | Back alignment and domain information |
|---|
| >KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 320 | ||||
| 4gco_A | 126 | Central Domain Of Stress-Induced Protein-1 (Sti-1) | 1e-19 | ||
| 2lni_A | 133 | Solution Nmr Structure Of Stress-Induced-Phosphopro | 2e-18 | ||
| 1wao_1 | 477 | Pp5 Structure Length = 477 | 1e-14 | ||
| 1elw_A | 118 | Crystal Structure Of The Tpr1 Domain Of Hop In Comp | 2e-14 | ||
| 1a17_A | 166 | Tetratricopeptide Repeats Of Protein Phosphatase 5 | 1e-13 | ||
| 2bug_A | 140 | Solution Structure Of The Tpr Domain From Protein P | 8e-13 | ||
| 2vyi_A | 131 | Crystal Structure Of The Tpr Domain Of Human Sgt Le | 3e-12 | ||
| 2c2l_A | 281 | Crystal Structure Of The Chip U-Box E3 Ubiquitin Li | 1e-10 | ||
| 3q47_B | 137 | Crystal Structure Of Tpr Domain Of Chip Complexed W | 2e-10 | ||
| 3sz7_A | 164 | Crystal Structure Of The Sgt2 Tpr Domain From Asper | 2e-09 | ||
| 3kd7_A | 125 | Designed Tpr Module (Ctpr390) In Complex With Its P | 1e-08 | ||
| 3upv_A | 126 | Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = | 2e-08 | ||
| 3uq3_A | 258 | Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = | 2e-08 | ||
| 3lca_A | 533 | Structure Of Tom71 Complexed With Hsp70 Ssa1 C Term | 3e-08 | ||
| 3fp2_A | 537 | Crystal Structure Of Tom71 Complexed With Hsp82 C-T | 3e-08 | ||
| 2dba_A | 148 | The Solution Structure Of The Tetratrico Peptide Re | 3e-07 | ||
| 1na0_A | 125 | Design Of Stable Alpha-Helical Arrays From An Ideal | 3e-07 | ||
| 2fo7_A | 136 | Crystal Structure Of An 8 Repeat Consensus Tpr Supe | 2e-06 | ||
| 1kt0_A | 457 | Structure Of The Large Fkbp-like Protein, Fkbp51, I | 2e-06 | ||
| 1kt1_A | 457 | Structure Of The Large Fkbp-Like Protein, Fkbp51, I | 6e-06 | ||
| 2gw1_A | 514 | Crystal Structure Of The Yeast Tom70 Length = 514 | 2e-05 | ||
| 3ieg_A | 359 | Crystal Structure Of P58(Ipk) Tpr Domain At 2.5 A L | 4e-05 | ||
| 2wqh_A | 125 | Crystal Structure Of Ctpr3y3 Length = 125 | 4e-05 | ||
| 2y4t_A | 450 | Crystal Structure Of The Human Co-Chaperone P58(Ipk | 6e-05 | ||
| 2l6j_A | 111 | Tah1 Complexed By Meevd Length = 111 | 6e-05 | ||
| 3pe3_A | 723 | Structure Of Human O-Glcnac Transferase And Its Com | 1e-04 | ||
| 2y4u_A | 450 | Crystal Structure Of Human P58(Ipk) In Space Group | 1e-04 | ||
| 1w3b_A | 388 | The Superhelical Tpr Domain Of O-Linked Glcnac Tran | 3e-04 |
| >pdb|4GCO|A Chain A, Central Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 126 | Back alignment and structure |
|
| >pdb|2LNI|A Chain A, Solution Nmr Structure Of Stress-Induced-Phosphoprotein 1 Sti1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4403e Length = 133 | Back alignment and structure |
| >pdb|1WAO|1 Chain 1, Pp5 Structure Length = 477 | Back alignment and structure |
| >pdb|1ELW|A Chain A, Crystal Structure Of The Tpr1 Domain Of Hop In Complex With A Hsc70 Peptide Length = 118 | Back alignment and structure |
| >pdb|1A17|A Chain A, Tetratricopeptide Repeats Of Protein Phosphatase 5 Length = 166 | Back alignment and structure |
| >pdb|2VYI|A Chain A, Crystal Structure Of The Tpr Domain Of Human Sgt Length = 131 | Back alignment and structure |
| >pdb|2C2L|A Chain A, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase Length = 281 | Back alignment and structure |
| >pdb|3Q47|B Chain B, Crystal Structure Of Tpr Domain Of Chip Complexed With Pseudophosphorylated Smad1 Peptide Length = 137 | Back alignment and structure |
| >pdb|3SZ7|A Chain A, Crystal Structure Of The Sgt2 Tpr Domain From Aspergillus Fumigatus Length = 164 | Back alignment and structure |
| >pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 | Back alignment and structure |
| >pdb|3UPV|A Chain A, Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = 126 | Back alignment and structure |
| >pdb|3UQ3|A Chain A, Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = 258 | Back alignment and structure |
| >pdb|3LCA|A Chain A, Structure Of Tom71 Complexed With Hsp70 Ssa1 C Terminal Tail Indicating Conformational Plasticity Length = 533 | Back alignment and structure |
| >pdb|3FP2|A Chain A, Crystal Structure Of Tom71 Complexed With Hsp82 C-Terminal Fragment Length = 537 | Back alignment and structure |
| >pdb|2DBA|A Chain A, The Solution Structure Of The Tetratrico Peptide Repeat Of Human Smooth Muscle Cell Associated Protein-1, Isoform 2 Length = 148 | Back alignment and structure |
| >pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 | Back alignment and structure |
| >pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 | Back alignment and structure |
| >pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 | Back alignment and structure |
| >pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 | Back alignment and structure |
| >pdb|2GW1|A Chain A, Crystal Structure Of The Yeast Tom70 Length = 514 | Back alignment and structure |
| >pdb|3IEG|A Chain A, Crystal Structure Of P58(Ipk) Tpr Domain At 2.5 A Length = 359 | Back alignment and structure |
| >pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 | Back alignment and structure |
| >pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 | Back alignment and structure |
| >pdb|2L6J|A Chain A, Tah1 Complexed By Meevd Length = 111 | Back alignment and structure |
| >pdb|3PE3|A Chain A, Structure Of Human O-Glcnac Transferase And Its Complex With A Peptide Substrate Length = 723 | Back alignment and structure |
| >pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 | Back alignment and structure |
| >pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha. Length = 388 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 320 | |||
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 8e-45 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 3e-44 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 6e-44 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 7e-44 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 4e-43 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 4e-43 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 5e-43 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 5e-42 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 8e-42 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 4e-39 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 8e-35 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 5e-34 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 2e-32 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 5e-32 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 1e-28 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 2e-21 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 4e-15 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 4e-15 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 5e-10 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 2e-06 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 5e-28 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 9e-25 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 1e-21 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 4e-13 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 4e-13 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 5e-12 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 2e-27 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 7e-19 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 1e-18 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 4e-18 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 6e-17 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 4e-15 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 1e-11 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 7e-08 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 2e-27 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 1e-24 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 3e-21 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 8e-13 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 3e-12 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 4e-11 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 2e-10 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 5e-05 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 6e-25 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 8e-19 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 2e-17 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 6e-17 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 1e-15 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 1e-14 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 1e-12 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 3e-12 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 7e-10 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 6e-09 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 2e-24 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 2e-24 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 2e-22 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 5e-20 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 3e-19 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 3e-19 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 8e-19 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 6e-18 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 9e-18 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 2e-17 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 4e-17 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 6e-17 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 2e-09 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 3e-19 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 5e-19 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 8e-12 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 6e-19 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 2e-17 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 2e-15 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 5e-15 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 1e-11 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 1e-07 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 1e-05 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 3e-18 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 7e-17 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 1e-16 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 1e-16 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 4e-10 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 4e-18 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 6e-18 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 6e-15 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 5e-14 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 2e-13 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 6e-13 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 1e-11 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 5e-08 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 7e-07 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 8e-06 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 6e-17 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 4e-11 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 4e-05 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 7e-17 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 1e-15 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 4e-15 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 2e-12 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 2e-12 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 2e-10 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 9e-07 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 8e-17 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 4e-12 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 9e-17 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 4e-16 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 4e-16 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 3e-11 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 3e-05 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 3e-16 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 9e-14 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 3e-10 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 1e-09 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 1e-08 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 4e-06 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 2e-04 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 7e-16 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 6e-09 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 9e-16 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 9e-16 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 1e-15 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 1e-15 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 2e-15 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 6e-15 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 1e-14 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 4e-14 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 4e-14 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 4e-13 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 8e-13 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 1e-09 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 1e-15 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 5e-14 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 2e-13 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 6e-13 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 6e-10 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 2e-15 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 6e-12 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 4e-07 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 2e-15 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 2e-15 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 5e-13 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 5e-12 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 1e-11 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 2e-10 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 3e-09 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 2e-15 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 1e-14 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 5e-13 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 1e-12 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 3e-10 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 6e-05 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 3e-15 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 2e-14 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 3e-14 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 6e-05 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 3e-15 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 4e-09 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 5e-07 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 4e-15 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 8e-15 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 8e-09 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 6e-15 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 3e-14 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 3e-09 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 8e-07 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 6e-14 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 1e-04 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 9e-14 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 4e-13 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-12 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-12 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 9e-12 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 1e-11 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 1e-11 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-11 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 7e-11 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 1e-10 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-10 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-10 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 4e-10 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 1e-09 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 1e-09 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 1e-09 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-08 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-07 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 6e-06 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-04 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 5e-04 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 6e-04 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 1e-13 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 2e-13 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 2e-12 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 1e-11 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 2e-08 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 2e-13 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 8e-13 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 4e-12 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 2e-09 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 1e-11 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 7e-11 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 2e-10 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 2e-10 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 4e-11 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 1e-06 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 5e-11 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 1e-10 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 2e-10 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 6e-10 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 2e-09 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 2e-06 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 5e-05 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 3e-10 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 2e-08 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 7e-07 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 1e-06 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 9e-10 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 8e-09 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 2e-08 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 2e-07 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 2e-06 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 1e-04 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 5e-09 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 3e-07 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 2e-08 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 1e-06 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 5e-08 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 2e-07 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 3e-04 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 7e-08 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 2e-07 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 1e-06 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 4e-05 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 4e-06 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 5e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-05 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 2e-04 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 3e-04 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 4e-04 |
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 | Back alignment and structure |
|---|
Score = 149 bits (378), Expect = 8e-45
Identities = 44/153 (28%), Positives = 77/153 (50%), Gaps = 2/153 (1%)
Query: 3 AEAEEMSLKDKGNEFFKAGNYLKAAALYTQAIKQDPSNPTLFSNRAAAFLHLVKLNKALA 62
AEE LK + N++FKA +Y A Y+QAI+ +PSN + NR+ A+L AL
Sbjct: 11 KRAEE--LKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALG 68
Query: 63 DAETTISLNPQWEKGYFRKGCILEAMEQYDDALSAFQTALQYNPQSAEVSRKIKRVSQLA 122
DA I L+ ++ KGY+R+ A+ ++ AL ++T ++ P + K + +++
Sbjct: 69 DATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIV 128
Query: 123 KDKKRAQEVENIRSNVDMVQHLDEFKSEMSEKY 155
K K + + +V LD + ++Y
Sbjct: 129 KQKAFERAIAGDEHKRSVVDSLDIESMTIEDEY 161
|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176 | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 320 | |||
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 99.96 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 99.96 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 99.95 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 99.95 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 99.95 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 99.95 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 99.95 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 99.95 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 99.95 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 99.95 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 99.94 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 99.94 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 99.93 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 99.93 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 99.93 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 99.93 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 99.93 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 99.92 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 99.92 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 99.92 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 99.91 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 99.91 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 99.91 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 99.91 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 99.91 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 99.91 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 99.91 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 99.91 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.91 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 99.9 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 99.9 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 99.9 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 99.9 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 99.9 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 99.9 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 99.9 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 99.9 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 99.89 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 99.89 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 99.89 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.88 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 99.88 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 99.88 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 99.87 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 99.87 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 99.86 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 99.86 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 99.86 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 99.86 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 99.86 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 99.86 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 99.85 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 99.85 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 99.85 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 99.85 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 99.85 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 99.85 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 99.85 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 99.85 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 99.84 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 99.84 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.84 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 99.83 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 99.83 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 99.83 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 99.83 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 99.83 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 99.83 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 99.82 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 99.82 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.82 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 99.82 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 99.82 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 99.81 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 99.81 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 99.8 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 99.8 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 99.8 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 99.8 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 99.8 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 99.8 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 99.8 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 99.8 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 99.8 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 99.79 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 99.79 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 99.79 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 99.79 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 99.79 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 99.78 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 99.78 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 99.78 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 99.78 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 99.77 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 99.77 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 99.76 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 99.76 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 99.76 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 99.76 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 99.75 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 99.75 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 99.75 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 99.75 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.75 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 99.75 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 99.74 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 99.74 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 99.74 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 99.74 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 99.73 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 99.73 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 99.72 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 99.72 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 99.72 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 99.72 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 99.71 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 99.71 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 99.71 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 99.71 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.7 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 99.7 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 99.7 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 99.7 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 99.7 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 99.69 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 99.68 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 99.68 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 99.68 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 99.68 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 99.67 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 99.66 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 99.66 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 99.65 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 99.64 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 99.64 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 99.64 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 99.64 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 99.63 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 99.63 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 99.63 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 99.63 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 99.62 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 99.62 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.61 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 99.6 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 99.6 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 99.6 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.59 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 99.59 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 99.59 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 99.58 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 99.58 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 99.57 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 99.57 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 99.56 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 99.56 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 99.54 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 99.54 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 99.54 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 99.53 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 99.53 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 99.53 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 99.52 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 99.52 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 99.52 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 99.52 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 99.51 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 99.51 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 99.5 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 99.5 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 99.48 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 99.48 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 99.48 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 99.47 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 99.47 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 99.47 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 99.47 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 99.46 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 99.44 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 99.43 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 99.43 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 99.42 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 99.42 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 99.41 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 99.41 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 99.4 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 99.4 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 99.4 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 99.39 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 99.36 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 99.36 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 99.34 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 99.3 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 99.3 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 99.26 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 99.25 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 99.2 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 99.19 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 99.16 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 99.13 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 99.13 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 99.09 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 99.08 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 99.07 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 99.06 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 99.06 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 99.02 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 99.01 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 98.99 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 98.98 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 98.98 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 98.94 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 98.88 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 98.74 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 98.68 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 98.62 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 98.6 | |
| 2uy1_A | 493 | Cleavage stimulation factor 77; RNA-binding protei | 98.35 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 98.35 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 98.31 | |
| 2uy1_A | 493 | Cleavage stimulation factor 77; RNA-binding protei | 98.13 | |
| 4h7y_A | 161 | Dual specificity protein kinase TTK; mitotic check | 98.11 | |
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 98.09 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 98.08 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 97.99 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 97.98 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 97.79 | |
| 3kae_A | 242 | CDC27, possible protein of nuclear scaffold; tetra | 97.7 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 97.7 | |
| 4h7y_A | 161 | Dual specificity protein kinase TTK; mitotic check | 97.68 | |
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 97.58 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 97.34 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 97.15 | |
| 1ya0_A | 497 | SMG-7 transcript variant 2; alpha-helical repeat, | 97.07 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 97.0 | |
| 1zbp_A | 273 | Hypothetical protein VPA1032; alpha-beta protein, | 96.69 | |
| 4gns_B | 754 | Protein CSD3, chitin biosynthesis protein CHS6; FN | 96.68 | |
| 1ya0_A | 497 | SMG-7 transcript variant 2; alpha-helical repeat, | 96.6 | |
| 4gns_B | 754 | Protein CSD3, chitin biosynthesis protein CHS6; FN | 96.51 | |
| 3txn_A | 394 | 26S proteasome regulatory complex subunit P42B; PC | 96.5 | |
| 3txn_A | 394 | 26S proteasome regulatory complex subunit P42B; PC | 95.68 | |
| 3mkq_B | 177 | Coatomer subunit alpha; beta-propeller, alpha-sole | 95.38 | |
| 4b4t_R | 429 | RPN7, 26S proteasome regulatory subunit RPN7; hydr | 95.31 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 95.1 | |
| 1zbp_A | 273 | Hypothetical protein VPA1032; alpha-beta protein, | 94.95 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 94.48 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 94.27 | |
| 3kae_A | 242 | CDC27, possible protein of nuclear scaffold; tetra | 94.27 | |
| 4b4t_P | 445 | 26S proteasome regulatory subunit RPN5; hydrolase, | 94.08 | |
| 3spa_A | 1134 | Mtrpol, DNA-directed RNA polymerase, mitochondrial | 93.11 | |
| 4fhn_B | 1139 | Nucleoporin NUP120; protein complex,structural pro | 92.66 | |
| 4fhn_B | 1139 | Nucleoporin NUP120; protein complex,structural pro | 92.51 | |
| 4b4t_S | 523 | RPN3, 26S proteasome regulatory subunit RPN3; hydr | 92.39 | |
| 4b4t_R | 429 | RPN7, 26S proteasome regulatory subunit RPN7; hydr | 92.16 | |
| 3mkq_B | 177 | Coatomer subunit alpha; beta-propeller, alpha-sole | 91.54 | |
| 1qsa_A | 618 | Protein (soluble lytic transglycosylase SLT70); al | 89.62 | |
| 3spa_A | 1134 | Mtrpol, DNA-directed RNA polymerase, mitochondrial | 87.5 | |
| 2vkj_A | 106 | TM1634; membrane protein, TPR motif joint center f | 86.76 | |
| 4b4t_S | 523 | RPN3, 26S proteasome regulatory subunit RPN3; hydr | 85.06 | |
| 4gq2_M | 950 | Nucleoporin NUP120; beta propeller alpha helical, | 84.88 | |
| 4a5x_A | 86 | MITD1, MIT domain-containing protein 1; protein tr | 84.79 | |
| 4b4t_P | 445 | 26S proteasome regulatory subunit RPN5; hydrolase, | 84.52 | |
| 2w2u_A | 83 | Hypothetical P60 katanin; hydrolase transport comp | 83.59 | |
| 3ax2_A | 73 | Mitochondrial import receptor subunit TOM20 homol; | 82.47 | |
| 2w2u_A | 83 | Hypothetical P60 katanin; hydrolase transport comp | 82.27 | |
| 1qsa_A | 618 | Protein (soluble lytic transglycosylase SLT70); al | 82.12 | |
| 1wy6_A | 172 | Hypothetical protein ST1625; helical repeat protei | 82.0 | |
| 3esl_A | 202 | Checkpoint serine/threonine-protein kinase BUB1; m | 81.55 | |
| 2v6y_A | 83 | AAA family ATPase, P60 katanin; MIT, VPS4, archaea | 81.48 | |
| 2crb_A | 97 | Nuclear receptor binding factor 2; NRBF-2, MIT dom | 80.24 | |
| 3t5x_A | 203 | PCI domain-containing protein 2; PCI, mRNA nuclear | 80.08 |
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
Probab=99.96 E-value=5e-30 Score=226.35 Aligned_cols=256 Identities=15% Similarity=0.160 Sum_probs=127.1
Q ss_pred hHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHccCHHHHHHHHHHHHhcCCCCHHHHHHHHH
Q 020914 4 EAEEMSLKDKGNEFFKAGNYLKAAALYTQAIKQDPSNPTLFSNRAAAFLHLVKLNKALADAETTISLNPQWEKGYFRKGC 83 (320)
Q Consensus 4 p~~a~~~~~~g~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~l~p~~~~~~~~lg~ 83 (320)
|.++.++..+|.++...|++++|+..|+++++++|+++.++.++|.++...|++++|+..|+++++++|++..++..+|.
T Consensus 64 p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~ 143 (388)
T 1w3b_A 64 PLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGN 143 (388)
T ss_dssp TTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHH
T ss_pred CCchHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCcchHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCcHHHHHHHHH
Confidence 33444444444444444444444444444444444444444444444444444444444444444444444444444444
Q ss_pred HHHHccCHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHhHHHHHHHHhhhhcchhhhhh
Q 020914 84 ILEAMEQYDDALSAFQTALQYNPQSAEVSRKIKRVSQLAKDKKRAQEVENIRSNVDMVQHLDEFKSEMSEKYGAEECWKH 163 (320)
Q Consensus 84 ~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 163 (320)
++..+|++++|++.|+++++.+|++..+|..+|.++...|++++|+..+. ..+.. .+.....+..+|.++...|
T Consensus 144 ~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~--~al~~----~p~~~~~~~~lg~~~~~~~ 217 (388)
T 1w3b_A 144 LLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFE--KAVTL----DPNFLDAYINLGNVLKEAR 217 (388)
T ss_dssp HHHTTSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHH--HHHHH----CTTCHHHHHHHHHHHHTTT
T ss_pred HHHHccCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHH--HHHhc----CCCcHHHHHHHHHHHHHcC
Confidence 44444444444444444444444444444444444444444444433321 11111 1111122222333333333
Q ss_pred HHHHHHHHHHHHHHhHhhccccChh----------HHhhhcChhHHHHhhhhhhccccCcCCccc-hhhHHHHhhHH--H
Q 020914 164 VFSFVVETMETAVKSWHETSKVDAK----------VYFLLDKEKTDTEKYAPIVNVDKAFESPHT-HGSCFQFLRQY--A 230 (320)
Q Consensus 164 ~~~~a~~~~~~a~~~~~~~~~~~~~----------~~~~lg~~~~A~~~~~~a~~~~~~~~~~~~-~g~~~~~~~~~--A 230 (320)
.+. +|+..+.+++.+.|. ++...|++++|+..|+++++++|.....+. +|.++...|++ |
T Consensus 218 ~~~-------~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A 290 (388)
T 1w3b_A 218 IFD-------RAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEA 290 (388)
T ss_dssp CTT-------HHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCHHHHHHHHHHHHHHSCHHHH
T ss_pred CHH-------HHHHHHHHHHhhCcCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHcCCHHHH
Confidence 333 333333333333332 566667777777777777777666543333 66666666666 7
Q ss_pred HHHHHHHhchhCCCCCCChhHhhhcccccccccCcccchhhhccccc
Q 020914 231 DDSFSSAACLVAPKSIISYPQVWRGQGLRKWRHSQQDGFFVQFESPL 277 (320)
Q Consensus 231 ~~~~~~al~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~ 277 (320)
++.|++++++ .|..+.+|.++|.++...|+++++...+++..
T Consensus 291 ~~~~~~al~~-----~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al 332 (388)
T 1w3b_A 291 EDCYNTALRL-----CPTHADSLNNLANIKREQGNIEEAVRLYRKAL 332 (388)
T ss_dssp HHHHHHHHHH-----CTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHT
T ss_pred HHHHHHHHhh-----CcccHHHHHHHHHHHHHcCCHHHHHHHHHHHH
Confidence 7777777766 55556667777777777777766665555433
|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B | Back alignment and structure |
|---|
| >4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A | Back alignment and structure |
|---|
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A | Back alignment and structure |
|---|
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 | Back alignment and structure |
|---|
| >4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A | Back alignment and structure |
|---|
| >3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A | Back alignment and structure |
|---|
| >3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} | Back alignment and structure |
|---|
| >4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} | Back alignment and structure |
|---|
| >4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* | Back alignment and structure |
|---|
| >3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2vkj_A TM1634; membrane protein, TPR motif joint center for structural GENO JCSG, structural genomics; 1.65A {Thermotoga maritima} PDB: 2vko_A* | Back alignment and structure |
|---|
| >4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B | Back alignment and structure |
|---|
| >4a5x_A MITD1, MIT domain-containing protein 1; protein transport, ESCRT, cytokinesis, midbody; HET: P15; 1.91A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >3ax2_A Mitochondrial import receptor subunit TOM20 homol; protein-protein complex, membrane protein-transport protein; 1.90A {Rattus norvegicus} PDB: 2v1s_A 3awr_A 2v1t_A 3ax5_A 3ax3_A | Back alignment and structure |
|---|
| >2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* | Back alignment and structure |
|---|
| >1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 | Back alignment and structure |
|---|
| >3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2v6y_A AAA family ATPase, P60 katanin; MIT, VPS4, archaea, AAA-ATPase, ATP-binding, microtubule INT and trafficking domain, nucleotide-binding; HET: SRT; 2.40A {Sulfolobus solfataricus} PDB: 2v6y_B* | Back alignment and structure |
|---|
| >2crb_A Nuclear receptor binding factor 2; NRBF-2, MIT domain, helix bundle, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.7.16.1 | Back alignment and structure |
|---|
| >3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 320 | ||||
| d2c2la1 | 201 | a.118.8.1 (A:24-224) STIP1 homology and U box-cont | 7e-17 | |
| d1elra_ | 128 | a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 | 4e-13 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 9e-13 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 1e-11 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 1e-11 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 4e-11 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 7e-09 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 8e-09 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 2e-05 | |
| d1elwa_ | 117 | a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 | 5e-12 | |
| d1hh8a_ | 192 | a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- | 1e-11 | |
| d1zbpa1 | 264 | e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V | 1e-11 | |
| d1kt1a1 | 168 | a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M | 2e-11 | |
| d1ihga1 | 169 | a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau | 4e-11 | |
| d1a17a_ | 159 | a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo | 3e-10 | |
| d2fbna1 | 153 | a.118.8.1 (A:22-174) Putative 70 kda peptidylproly | 5e-10 | |
| d1p5qa1 | 170 | a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d | 8e-09 | |
| d1fcha_ | 323 | a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting | 3e-08 | |
| d1ya0a1 | 497 | a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T | 2e-07 | |
| d1ya0a1 | 497 | a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T | 3e-04 | |
| d2hr2a1 | 156 | a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C | 2e-06 | |
| d2h6fa1 | 315 | a.118.6.1 (A:55-369) Protein farnesyltransferase a | 3e-06 | |
| d1dcea1 | 334 | a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr | 5e-06 | |
| d1nzna_ | 122 | a.118.8.1 (A:) Mitochondria fission protein Fis1 { | 1e-05 | |
| d1xnfa_ | 259 | a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli | 3e-05 | |
| d1xnfa_ | 259 | a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli | 0.001 | |
| d1hz4a_ | 366 | a.118.8.2 (A:) Transcription factor MalT domain II | 5e-04 | |
| d1qqea_ | 290 | a.118.8.1 (A:) Vesicular transport protein sec17 { | 9e-04 |
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: Tetratricopeptide repeat (TPR) domain: STIP1 homology and U box-containing protein 1, STUB1 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 75.4 bits (184), Expect = 7e-17
Identities = 43/159 (27%), Positives = 71/159 (44%), Gaps = 2/159 (1%)
Query: 4 EAEEMSLKDKGNEFFKAGNYLKAAALYTQAIKQDPSNPTLFSNRAAAFLHLVKLNKALAD 63
A+E LK++GN F Y +AAA Y +AI ++P ++NRA +L + + +ALAD
Sbjct: 3 SAQE--LKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALAD 60
Query: 64 AETTISLNPQWEKGYFRKGCILEAMEQYDDALSAFQTALQYNPQSAEVSRKIKRVSQLAK 123
+ L+ Q K +F G ME YD+A++ Q A + +
Sbjct: 61 CRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIA 120
Query: 124 DKKRAQEVENIRSNVDMVQHLDEFKSEMSEKYGAEECWK 162
KKR +E R + + H + +E+ E +
Sbjct: 121 KKKRWNSIEERRIHQESELHSYLTRLIAAERERELEECQ 159
|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 320 | |||
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 99.96 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 99.94 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.94 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 99.93 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 99.9 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.89 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.88 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 99.88 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 99.84 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 99.84 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 99.84 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 99.84 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 99.83 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 99.83 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 99.82 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 99.81 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 99.81 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 99.81 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.78 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 99.77 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 99.77 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.77 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 99.75 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 99.7 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.67 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 99.65 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 99.64 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.64 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 99.64 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 99.63 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.62 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 99.6 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 99.57 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 99.56 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 99.56 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 99.52 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 99.52 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 99.5 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 99.45 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 99.44 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 99.42 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 99.41 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 99.4 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 99.39 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 99.34 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 99.34 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 99.19 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 99.18 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 99.17 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 98.94 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 98.93 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 98.87 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 98.74 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 98.71 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 98.24 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 98.0 | |
| d2crba1 | 83 | Nuclear receptor binding factor 2, NRBF2, N-termin | 88.67 | |
| d1qsaa1 | 450 | 70 KDa soluble lytic transglycosylase (SLT70), sup | 88.43 | |
| d2crba1 | 83 | Nuclear receptor binding factor 2, NRBF2, N-termin | 87.95 | |
| d1qsaa1 | 450 | 70 KDa soluble lytic transglycosylase (SLT70), sup | 87.63 | |
| d1wfda_ | 93 | Hypothetical protein 1500032H18Rik {Mouse (Mus mus | 84.12 | |
| d1b89a_ | 336 | Clathrin heavy chain proximal leg segment {Cow (Bo | 82.77 | |
| d2cfua2 | 505 | Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI | 80.53 | |
| d1wfda_ | 93 | Hypothetical protein 1500032H18Rik {Mouse (Mus mus | 80.12 |
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: Tetratricopeptide repeat (TPR) domain: O-GlcNAc transferase p110 subunit, OGT species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.96 E-value=8.1e-29 Score=214.72 Aligned_cols=269 Identities=12% Similarity=0.102 Sum_probs=172.9
Q ss_pred chHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHccCHHHHHHHHHHHHhcCC----------
Q 020914 3 AEAEEMSLKDKGNEFFKAGNYLKAAALYTQAIKQDPSNPTLFSNRAAAFLHLVKLNKALADAETTISLNP---------- 72 (320)
Q Consensus 3 ~p~~a~~~~~~g~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~l~p---------- 72 (320)
.|+++.++..+|.+++..|++++|+..|+++++++|+++.++..+|.+|..+|++++|+..+.+++..+|
T Consensus 29 ~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~ 108 (388)
T d1w3ba_ 29 EPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLA 108 (388)
T ss_dssp CTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHH
T ss_pred CCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhcccccccccccccccccccccccccccc
Confidence 3555566666666666666666666666666666666666666666666666666666665555544332
Q ss_pred ----------------------------------------------------------CCHHHHHHHHHHHHHccCHHHH
Q 020914 73 ----------------------------------------------------------QWEKGYFRKGCILEAMEQYDDA 94 (320)
Q Consensus 73 ----------------------------------------------------------~~~~~~~~lg~~~~~~~~~~~A 94 (320)
+++.++..+|.++...|++++|
T Consensus 109 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A 188 (388)
T d1w3ba_ 109 AALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLA 188 (388)
T ss_dssp HHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHH
T ss_pred ccccccccccccccccccccccccccccccccccccccccchhhhhHHHHHHhhccCcchhHHHHhhcccccccCcHHHH
Confidence 3344455556666666666666
Q ss_pred HHHHHHHHhhCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHhHHHHHHHHhhhhcchhhhhhHHHHHHHHHHH
Q 020914 95 LSAFQTALQYNPQSAEVSRKIKRVSQLAKDKKRAQEVENIRSNVDMVQHLDEFKSEMSEKYGAEECWKHVFSFVVETMET 174 (320)
Q Consensus 95 ~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~ 174 (320)
+..++++++++|++..++..+|.++...|++++|+..... . ....+........+|.++...|.+..|+..+++
T Consensus 189 ~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~--~----~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~ 262 (388)
T d1w3ba_ 189 IHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLR--A----LSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRR 262 (388)
T ss_dssp HHHHHHHHHHCTTCHHHHHHHHHHHHTTTCTTHHHHHHHH--H----HHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHH
T ss_pred HHHHHHHHHhCcccHHHHHHHhhhhhccccHHHHHHHHHH--h----HHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHH
Confidence 6666666666666666666666666666666666554321 1 111112223333445555555555555555555
Q ss_pred HHHhHhhccccCh---hHHhhhcChhHHHHhhhhhhccccCcCCccc-hhhHHHHhhHH--HHHHHHHHhchhCCCCCCC
Q 020914 175 AVKSWHETSKVDA---KVYFLLDKEKTDTEKYAPIVNVDKAFESPHT-HGSCFQFLRQY--ADDSFSSAACLVAPKSIIS 248 (320)
Q Consensus 175 a~~~~~~~~~~~~---~~~~~lg~~~~A~~~~~~a~~~~~~~~~~~~-~g~~~~~~~~~--A~~~~~~al~~~~~~~~~~ 248 (320)
+++..+......- .++...|++.+|+..++.++...|.....+. +|.++...+++ |++.|++++++ +|.
T Consensus 263 al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~-----~p~ 337 (388)
T d1w3ba_ 263 AIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEV-----FPE 337 (388)
T ss_dssp HHHTCSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTS-----CTT
T ss_pred HHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccCCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHh-----CCC
Confidence 4443222111100 1788889999999999999998887654444 88888889999 99999999988 777
Q ss_pred hhHhhhcccccccccCcccchhhhcccccccccc
Q 020914 249 YPQVWRGQGLRKWRHSQQDGFFVQFESPLLRKLW 282 (320)
Q Consensus 249 ~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~ 282 (320)
++.+|+++|.++..+|+++++...+++.+...|.
T Consensus 338 ~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~ 371 (388)
T d1w3ba_ 338 FAAAHSNLASVLQQQGKLQEALMHYKEAIRISPT 371 (388)
T ss_dssp CHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTT
T ss_pred CHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCC
Confidence 8999999999999999999998888776654443
|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|