Citrus Sinensis ID: 020914


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320
MAAEAEEMSLKDKGNEFFKAGNYLKAAALYTQAIKQDPSNPTLFSNRAAAFLHLVKLNKALADAETTISLNPQWEKGYFRKGCILEAMEQYDDALSAFQTALQYNPQSAEVSRKIKRVSQLAKDKKRAQEVENIRSNVDMVQHLDEFKSEMSEKYGAEECWKHVFSFVVETMETAVKSWHETSKVDAKVYFLLDKEKTDTEKYAPIVNVDKAFESPHTHGSCFQFLRQYADDSFSSAACLVAPKSIISYPQVWRGQGLRKWRHSQQDGFFVQFESPLLRKLWFIPSSNEKGKTLCRDPEVLDISAHEVFPRLFKEKLSNS
cccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccHHHHHHHccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHccccccccHHHccccHHHHHccHHHHHHcccccccccccccccccccccccccccHHHHHHHHcccc
cccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEccccccccccccEEEEEEccccccHHHHHHHHHHHHHHccHHHHEEEEccccEEEccccEccccccccEccccccEEEEEccHHHHEEEEEccccccccEEccccHHHcccHHHHHHHHHHHccccc
MAAEAEEmslkdkgneffkAGNYLKAAALYTQAikqdpsnptlfsNRAAAFLHLVKLNKALAdaettislnpqwekgyfrkgCILEAMEQYDDALSAFQTALqynpqsaeVSRKIKRVSQLAKDKKRAQEVENIRSNVDMVQHLDEFKsemsekygaeECWKHVFSFVVETMETAVKSWHETSKVDAKVYFLLdkektdtekyapivnvdkafesphthgscfQFLRQYAddsfssaaclvapksiisypqvwrgqglrkwrhsqqdgffvqfespllrklwfipssnekgktlcrdpevldisaheVFPRLFKEKLSNS
maaeaeemslkdkgNEFFKAGNYLKAAALYTQAIKQDPSNPTLFSNRAAAFLHLVKLNKALADAettislnpqwekgYFRKGCILEAMEQYDDALSAFQTALQynpqsaevsrkIKRVSqlakdkkraqevenirsnvdmvQHLDEFKSEMSEKYGAEECWKHVFSFVVETMETAVKswhetskvdaKVYFLLDKEKTDTEKYAPIVNVDKAFESPHTHGSCFQFLRQYADDSFSSAACLVAPKSIISYPQVWRGQGLRKWRHSQQDGFFVQFESPLLRKLWFIPSSNEKGKTLCRDPEVLDisahevfprlfkeklsns
MAAEAEEMSLKDKGNEFFKAGNYLKAAALYTQAIKQDPSNPTLFSNRAAAFLHLVKLNKALADAETTISLNPQWEKGYFRKGCILEAMEQYDDALSAFQTALQYNPQSAEVSRKIKRVSQLAKDKKRAQEVENIRSNVDMVQHLDEFKSEMSEKYGAEECWKHVFSFVVETMETAVKSWHETSKVDAKVYFLLDKEKTDTEKYAPIVNVDKAFESPHTHGSCFQFLRQYADDSFSSAACLVAPKSIISYPQVWRGQGLRKWRHSQQDGFFVQFESPLLRKLWFIPSSNEKGKTLCRDPEVLDISAHEVFPRLFKEKLSNS
****************FFKAGNYLKAAALYTQAIKQDPSNPTLFSNRAAAFLHLVKLNKALADAETTISLNPQWEKGYFRKGCILEAMEQYDDALSAFQTALQY*************************************************KYGAEECWKHVFSFVVETMETAVKSWHETSKVDAKVYFLLDKEKTDTEKYAPIVNVDKAFESPHTHGSCFQFLRQYADDSFSSAACLVAPKSIISYPQVWRGQGLRKWRHSQQDGFFVQFESPLLRKLWFIPSSNEKGKTLCRDPEVLDISAHEVFPRL********
****A*E**LKDKGNEFFKAGNYLKAAALYTQAIKQDPSNPTLFSNRAAAFLHLVKLNKALADAETTISLNPQWEKGYFRKGCILEAMEQYDDALSAFQTALQYNPQSAEVSRKIKR*********************************************HVFSFVVETMETAVKSWHETSKVDAKVYFLLDKEKTDTEKYAPIVNVDKAFESPHTHGSCFQFLRQYADDSFSSAACLVAPKSIISY************************ESPL**********************VLDISAHEVFPR**K******
**********KDKGNEFFKAGNYLKAAALYTQAIKQDPSNPTLFSNRAAAFLHLVKLNKALADAETTISLNPQWEKGYFRKGCILEAMEQYDDALSAFQTALQY*************************EVENIRSNVDMVQHLDEFKSEMSEKYGAEECWKHVFSFVVETMETAVKSWHETSKVDAKVYFLLDKEKTDTEKYAPIVNVDKAFESPHTHGSCFQFLRQYADDSFSSAACLVAPKSIISYPQVWRGQGLRKWRHSQQDGFFVQFESPLLRKLWFIPSSNEKGKTLCRDPEVLDISAHEVFPRLFKEKLSNS
****AEEMSLKDKGNEFFKAGNYLKAAALYTQAIKQDPSNPTLFSNRAAAFLHLVKLNKALADAETTISLNPQWEKGYFRKGCILEAMEQYDDALSAFQTALQYNPQSAEVSRKIKRVSQLAKDKKRAQEVENIRSNVDMVQHLDEFKSEMSEKYGAEECWKHVFSFVVETMETAVKSWHETSKVDAKVYFLLDKEKTDTEKYAPIVNVDKAFESPHTHGSCFQFLRQYADDSFSSAACLVAPKSIISYPQVWRGQGLRKWRHSQQDGFFVQFESPLLRKLWFIPSSNEKGKTLCRDPEVLDISAHEVFPRLFKEK****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAEAEEMSLKDKGNEFFKAGNYLKAAALYTQAIKQDPSNPTLFSNRAAAFLHLVKLNKALADAETTISLNPQWEKGYFRKGCILEAMEQYDDALSAFQTALQYNPQSAEVSRKIKRVSQLAKDKKRAQEVENIRSNVDMVQHLDEFKSEMSEKYGAEECWKHVFSFVVETMETAVKSWHETSKVDAKVYFLLDKEKTDTEKYAPIVNVDKAFESPHTHGSCFQFLRQYADDSFSSAACLVAPKSIISYPQVWRGQGLRKWRHSQQDGFFVQFESPLLRKLWFIPSSNEKGKTLCRDPEVLDISAHEVFPRLFKEKLSNS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query320 2.2.26 [Sep-21-2011]
Q43468569 Heat shock protein STI OS no no 0.353 0.198 0.403 3e-18
O54981543 Stress-induced-phosphopro yes no 0.334 0.197 0.416 3e-17
P31948543 Stress-induced-phosphopro yes no 0.328 0.193 0.416 5e-17
Q3ZBZ8543 Stress-induced-phosphopro yes no 0.328 0.193 0.416 5e-17
Q60864543 Stress-induced-phosphopro yes no 0.306 0.180 0.416 6e-17
O35814543 Stress-induced-phosphopro yes no 0.306 0.180 0.416 6e-17
Q4R8N7543 Stress-induced-phosphopro N/A no 0.328 0.193 0.416 6e-17
Q54DA8564 Protein STIP1 homolog OS= yes no 0.434 0.246 0.347 4e-15
Q54IP0539 DnaJ homolog subfamily C no no 0.337 0.200 0.348 1e-14
Q9H6T3 665 RNA polymerase II-associa no no 0.334 0.160 0.336 1e-14
>sp|Q43468|STIP_SOYBN Heat shock protein STI OS=Glycine max GN=STI PE=2 SV=1 Back     alignment and function desciption
 Score = 92.4 bits (228), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 72/114 (63%), Gaps = 1/114 (0%)

Query: 11  KDKGNEFFKAGNYLKAAALYTQAIKQDPSNPTLFSNRAAAFLHLVKLNKALADAETTISL 70
           ++KGNE FK   Y +A   YT+AIK++P +   +SNRAA +  L  + + L DAE  I L
Sbjct: 385 REKGNELFKQQKYPEATKHYTEAIKRNPKDAKAYSNRAACYTKLGAMPEGLKDAEKCIEL 444

Query: 71  NPQWEKGYFRKGCILEAMEQYDDALSAFQTALQYNPQSAEVSRKIKR-VSQLAK 123
           +P + KGY RKG +  +M++YD AL  ++  L+++P + E+   I+R V Q+ K
Sbjct: 445 DPTFSKGYTRKGAVQFSMKEYDKALETYREGLKHDPNNQELLDGIRRCVEQINK 498





Glycine max (taxid: 3847)
>sp|O54981|STIP1_CRIGR Stress-induced-phosphoprotein 1 OS=Cricetulus griseus GN=STIP1 PE=2 SV=1 Back     alignment and function description
>sp|P31948|STIP1_HUMAN Stress-induced-phosphoprotein 1 OS=Homo sapiens GN=STIP1 PE=1 SV=1 Back     alignment and function description
>sp|Q3ZBZ8|STIP1_BOVIN Stress-induced-phosphoprotein 1 OS=Bos taurus GN=STIP1 PE=2 SV=1 Back     alignment and function description
>sp|Q60864|STIP1_MOUSE Stress-induced-phosphoprotein 1 OS=Mus musculus GN=Stip1 PE=1 SV=1 Back     alignment and function description
>sp|O35814|STIP1_RAT Stress-induced-phosphoprotein 1 OS=Rattus norvegicus GN=Stip1 PE=1 SV=1 Back     alignment and function description
>sp|Q4R8N7|STIP1_MACFA Stress-induced-phosphoprotein 1 OS=Macaca fascicularis GN=STIP1 PE=2 SV=1 Back     alignment and function description
>sp|Q54DA8|STIP1_DICDI Protein STIP1 homolog OS=Dictyostelium discoideum GN=sti1 PE=3 SV=1 Back     alignment and function description
>sp|Q54IP0|DNJC7_DICDI DnaJ homolog subfamily C member 7 homolog OS=Dictyostelium discoideum GN=dnajc7 PE=1 SV=1 Back     alignment and function description
>sp|Q9H6T3|RPAP3_HUMAN RNA polymerase II-associated protein 3 OS=Homo sapiens GN=RPAP3 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query320
255552073330 heat shock protein 70 (HSP70)-interactin 0.987 0.957 0.832 1e-159
224099829334 predicted protein [Populus trichocarpa] 0.981 0.940 0.821 1e-158
449455294331 PREDICTED: RNA polymerase II-associated 0.971 0.939 0.826 1e-156
224111122334 predicted protein [Populus trichocarpa] 0.981 0.940 0.808 1e-155
225432762330 PREDICTED: serine/threonine-protein phos 0.993 0.963 0.792 1e-154
297737096329 unnamed protein product [Vitis vinifera] 0.993 0.966 0.792 1e-154
356537369325 PREDICTED: RNA polymerase II-associated 1.0 0.984 0.790 1e-153
449516834338 PREDICTED: LOW QUALITY PROTEIN: RNA poly 0.971 0.920 0.805 1e-152
359806614324 uncharacterized protein LOC100790717 [Gl 0.981 0.969 0.802 1e-152
15219673328 tetratricopeptide repeat-containing prot 0.981 0.957 0.767 1e-146
>gi|255552073|ref|XP_002517081.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] gi|223543716|gb|EEF45244.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  566 bits (1459), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 263/316 (83%), Positives = 292/316 (92%)

Query: 5   AEEMSLKDKGNEFFKAGNYLKAAALYTQAIKQDPSNPTLFSNRAAAFLHLVKLNKALADA 64
            EE+SLKDKGNEFFKAGNYLKAAALYTQAIK DPSNPTL+SNRAAAFL LVKLNKALADA
Sbjct: 15  GEEVSLKDKGNEFFKAGNYLKAAALYTQAIKLDPSNPTLYSNRAAAFLQLVKLNKALADA 74

Query: 65  ETTISLNPQWEKGYFRKGCILEAMEQYDDALSAFQTALQYNPQSAEVSRKIKRVSQLAKD 124
           E TI+LNPQWEKGYFRKGC+LEAME+YDDA +AFQTAL+YNPQS+EVSRKIKR+SQLAK+
Sbjct: 75  EMTITLNPQWEKGYFRKGCVLEAMERYDDASAAFQTALKYNPQSSEVSRKIKRISQLAKE 134

Query: 125 KKRAQEVENIRSNVDMVQHLDEFKSEMSEKYGAEECWKHVFSFVVETMETAVKSWHETSK 184
           KKRAQEVE++RSNVD+ +H D+ KSEMSEK G+EEC K +FSF+VETME AVKSWHETSK
Sbjct: 135 KKRAQEVESMRSNVDLAKHFDKLKSEMSEKIGSEECLKEIFSFLVETMEMAVKSWHETSK 194

Query: 185 VDAKVYFLLDKEKTDTEKYAPIVNVDKAFESPHTHGSCFQFLRQYADDSFSSAACLVAPK 244
           VD +VYFLLDKEKT ++KYAP VN+DKAFESPHTH SCF FLRQYA++SFS AACLVAPK
Sbjct: 195 VDPRVYFLLDKEKTQSDKYAPAVNIDKAFESPHTHSSCFTFLRQYAEESFSKAACLVAPK 254

Query: 245 SIISYPQVWRGQGLRKWRHSQQDGFFVQFESPLLRKLWFIPSSNEKGKTLCRDPEVLDIS 304
           SIISYPQVW+GQG RKW+H Q DGFFVQFESP LRKLWFI S+NEKG+TLCRDPE+LDIS
Sbjct: 255 SIISYPQVWKGQGSRKWKHGQHDGFFVQFESPCLRKLWFISSTNEKGQTLCRDPEMLDIS 314

Query: 305 AHEVFPRLFKEKLSNS 320
           AHEVFPRLFKEKL NS
Sbjct: 315 AHEVFPRLFKEKLPNS 330




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224099829|ref|XP_002311636.1| predicted protein [Populus trichocarpa] gi|222851456|gb|EEE89003.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449455294|ref|XP_004145388.1| PREDICTED: RNA polymerase II-associated protein 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224111122|ref|XP_002315755.1| predicted protein [Populus trichocarpa] gi|222864795|gb|EEF01926.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225432762|ref|XP_002283155.1| PREDICTED: serine/threonine-protein phosphatase 5-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297737096|emb|CBI26297.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356537369|ref|XP_003537200.1| PREDICTED: RNA polymerase II-associated protein 3-like [Glycine max] Back     alignment and taxonomy information
>gi|449516834|ref|XP_004165451.1| PREDICTED: LOW QUALITY PROTEIN: RNA polymerase II-associated protein 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|359806614|ref|NP_001241273.1| uncharacterized protein LOC100790717 [Glycine max] gi|255644906|gb|ACU22953.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|15219673|ref|NP_171915.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana] gi|19423984|gb|AAL87273.1| unknown protein [Arabidopsis thaliana] gi|21281239|gb|AAM45091.1| unknown protein [Arabidopsis thaliana] gi|332189547|gb|AEE27668.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query320
TAIR|locus:2020240328 TPR3 "tetratricopeptide repeat 0.987 0.963 0.766 3.3e-134
FB|FBgn0024352490 Hop "Hsp70/Hsp90 organizing pr 0.434 0.283 0.395 3e-20
WB|WBGene00019983320 sti-1 [Caenorhabditis elegans 0.375 0.375 0.388 2.6e-19
TAIR|locus:2026197571 Hop2 "Hop2" [Arabidopsis thali 0.353 0.197 0.412 5.4e-19
ZFIN|ZDB-GENE-041121-17542 stip1 "stress-induced-phosphop 0.437 0.258 0.370 5.5e-17
UNIPROTKB|Q43468569 STI "Heat shock protein STI" [ 0.353 0.198 0.403 8.5e-17
TAIR|locus:2034620572 Hop1 "Hop1" [Arabidopsis thali 0.353 0.197 0.385 1.3e-16
TAIR|locus:2139109558 Hop3 "AT4G12400" [Arabidopsis 0.459 0.263 0.346 2.2e-16
UNIPROTKB|Q3ZBZ8543 STIP1 "Stress-induced-phosphop 0.437 0.257 0.364 1.9e-15
UNIPROTKB|P31948543 STIP1 "Stress-induced-phosphop 0.403 0.237 0.372 1.9e-15
TAIR|locus:2020240 TPR3 "tetratricopeptide repeat 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1315 (468.0 bits), Expect = 3.3e-134, P = 3.3e-134
 Identities = 243/317 (76%), Positives = 279/317 (88%)

Query:     4 EAEEMSLKDKGNEFFKAGNYLKAAALYTQAIKQDPSNPTLFSNRAAAFLHLVKLNKALAD 63
             EAE+ SLK+KGNEFFKAGN+LKAAALYTQAIK DPSN TL+SNRAAAFL LVKL+KALAD
Sbjct:    13 EAEK-SLKEKGNEFFKAGNFLKAAALYTQAIKLDPSNATLYSNRAAAFLSLVKLSKALAD 71

Query:    64 AETTISLNPQWEKGYFRKGCILEAMEQYDDALSAFQTALQYNPQSAEVSRKIKRVSQLAK 123
             AETTI LNPQWEKGYFRKGC+LEAME+Y+DAL+AF+ ALQYNPQS EVSRKIKR+ QL K
Sbjct:    72 AETTIKLNPQWEKGYFRKGCVLEAMEKYEDALAAFEMALQYNPQSTEVSRKIKRLGQLQK 131

Query:   124 DKKRAQEVENIRSNVDMVQHLDEFKSEMSEKYGAEECWKHVFSFVVETMETAVKSWHETS 183
             +K+RAQE+EN+RSNVDM +HL+ FKSEMSE YG EECWK +FSF+VETMETAVKSWHETS
Sbjct:   132 EKQRAQELENLRSNVDMAKHLESFKSEMSENYGTEECWKEMFSFIVETMETAVKSWHETS 191

Query:   184 KVDAKVYFLLDKEKTDTEKYAPIVNVDKAFESPHTHGSCFQFLRQYADDSFSSAACLVAP 243
             KVD +VYFLLDKEKT T+KYAP VN+DKAF+SP TH +CF +LRQYA++SFS AACLV P
Sbjct:   192 KVDTRVYFLLDKEKTQTDKYAPAVNIDKAFQSPDTHSNCFTYLRQYAEESFSKAACLVTP 251

Query:   244 KSIISYPQVWRGQGLRKWRHSQQDGFFVQFESPLLRKLWFIPSSNEKGKTLCRDPEVLDI 303
             KS ISYPQVW+G G RKW+    DG FVQFESP LRK+WFI SS EKG+TLCR+P+ LDI
Sbjct:   252 KSSISYPQVWKGVGSRKWKLGPNDGIFVQFESPSLRKVWFISSSKEKGQTLCREPQALDI 311

Query:   304 SAHEVFPRLFKEKLSNS 320
              AHE+ PR+FKEK  +S
Sbjct:   312 GAHEILPRIFKEKSKSS 328




GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0005829 "cytosol" evidence=IDA
GO:0006606 "protein import into nucleus" evidence=RCA
GO:0009640 "photomorphogenesis" evidence=RCA
GO:0009909 "regulation of flower development" evidence=RCA
GO:0010388 "cullin deneddylation" evidence=RCA
GO:0034968 "histone lysine methylation" evidence=RCA
FB|FBgn0024352 Hop "Hsp70/Hsp90 organizing protein homolog" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00019983 sti-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
TAIR|locus:2026197 Hop2 "Hop2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041121-17 stip1 "stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q43468 STI "Heat shock protein STI" [Glycine max (taxid:3847)] Back     alignment and assigned GO terms
TAIR|locus:2034620 Hop1 "Hop1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139109 Hop3 "AT4G12400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZBZ8 STIP1 "Stress-induced-phosphoprotein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P31948 STIP1 "Stress-induced-phosphoprotein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_fgenesh4_pm.C_LG_VIII0670
hypothetical protein (334 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query320
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-22
PLN03088356 PLN03088, PLN03088, SGT1, suppressor of G2 allele 8e-16
pfam1341469 pfam13414, TPR_11, TPR repeat 6e-13
TIGR00990 615 TIGR00990, 3a0801s09, mitochondrial precursor prot 2e-09
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 3e-06
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 3e-05
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 4e-05
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 7e-05
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 2e-04
TIGR03939 800 TIGR03939, PGA_TPR_OMP, poly-beta-1,6 N-acetyl-D-g 2e-04
smart0002834 smart00028, TPR, Tetratricopeptide repeats 3e-04
pfam0771934 pfam07719, TPR_2, Tetratricopeptide repeat 7e-04
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 0.002
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 0.002
pfam1341469 pfam13414, TPR_11, TPR repeat 0.003
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 0.003
TIGR03302235 TIGR03302, OM_YfiO, outer membrane assembly lipopr 0.003
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
 Score = 89.7 bits (223), Expect = 1e-22
 Identities = 34/98 (34%), Positives = 56/98 (57%)

Query: 10  LKDKGNEFFKAGNYLKAAALYTQAIKQDPSNPTLFSNRAAAFLHLVKLNKALADAETTIS 69
           L + GN ++K G+Y +A   Y +A++ DP N   + N AAA+  L K  +AL D E  + 
Sbjct: 3   LLNLGNLYYKLGDYDEALEYYEKALELDPDNADAYYNLAAAYYKLGKYEEALEDYEKALE 62

Query: 70  LNPQWEKGYFRKGCILEAMEQYDDALSAFQTALQYNPQ 107
           L+P   K Y+  G     + +Y++AL A++ AL+ +P 
Sbjct: 63  LDPDNAKAYYNLGLAYYKLGKYEEALEAYEKALELDPN 100


Length = 100

>gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|234406 TIGR03939, PGA_TPR_OMP, poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|234164 TIGR03302, OM_YfiO, outer membrane assembly lipoprotein YfiO Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 320
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.97
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.93
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.93
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.91
KOG0547606 consensus Translocase of outer mitochondrial membr 99.9
KOG0547606 consensus Translocase of outer mitochondrial membr 99.9
KOG1126638 consensus DNA-binding cell division cycle control 99.9
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.89
KOG1126638 consensus DNA-binding cell division cycle control 99.88
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.88
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.87
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.87
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.87
PRK11189296 lipoprotein NlpI; Provisional 99.87
PRK11788389 tetratricopeptide repeat protein; Provisional 99.85
PRK11788389 tetratricopeptide repeat protein; Provisional 99.83
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.83
KOG0553304 consensus TPR repeat-containing protein [General f 99.82
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.82
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.82
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.82
KOG2076 895 consensus RNA polymerase III transcription factor 99.82
PRK15359144 type III secretion system chaperone protein SscB; 99.82
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.82
KOG1125579 consensus TPR repeat-containing protein [General f 99.81
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.81
PRK11189296 lipoprotein NlpI; Provisional 99.81
PRK12370553 invasion protein regulator; Provisional 99.81
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.81
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.79
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.78
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.78
PRK12370553 invasion protein regulator; Provisional 99.78
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.76
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.75
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.74
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.74
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.73
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.73
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.73
PLN02789320 farnesyltranstransferase 99.72
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.71
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.71
KOG1125579 consensus TPR repeat-containing protein [General f 99.7
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.7
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.69
PRK10370198 formate-dependent nitrite reductase complex subuni 99.69
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.69
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.68
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.67
PRK15359144 type III secretion system chaperone protein SscB; 99.66
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.66
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.66
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.65
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.64
KOG1129478 consensus TPR repeat-containing protein [General f 99.64
PLN02789320 farnesyltranstransferase 99.63
PRK10370198 formate-dependent nitrite reductase complex subuni 99.63
KOG2003840 consensus TPR repeat-containing protein [General f 99.62
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.62
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.61
KOG2003840 consensus TPR repeat-containing protein [General f 99.61
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.6
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.58
PRK14574 822 hmsH outer membrane protein; Provisional 99.58
KOG2076 895 consensus RNA polymerase III transcription factor 99.57
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.57
KOG1129478 consensus TPR repeat-containing protein [General f 99.56
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.56
PRK14574 822 hmsH outer membrane protein; Provisional 99.56
KOG4234271 consensus TPR repeat-containing protein [General f 99.55
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.55
KOG4648 536 consensus Uncharacterized conserved protein, conta 99.54
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.54
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.54
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.53
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.52
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.52
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.52
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.51
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.51
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.51
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.5
PRK15331165 chaperone protein SicA; Provisional 99.49
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.49
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.49
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.48
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.47
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.47
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.47
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.46
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.45
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.45
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.44
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.44
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.43
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.43
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.41
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.4
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.39
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.38
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.37
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.37
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.36
PRK10803263 tol-pal system protein YbgF; Provisional 99.36
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.36
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.36
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.36
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.35
KOG0553304 consensus TPR repeat-containing protein [General f 99.34
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.34
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.33
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.32
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.31
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.28
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 99.27
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.24
KOG1128777 consensus Uncharacterized conserved protein, conta 99.22
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.21
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.2
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.2
KOG4555175 consensus TPR repeat-containing protein [Function 99.2
PF12688120 TPR_5: Tetratrico peptide repeat 99.2
PF13512142 TPR_18: Tetratricopeptide repeat 99.19
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.19
PLN03218 1060 maturation of RBCL 1; Provisional 99.18
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 99.17
PF1337173 TPR_9: Tetratricopeptide repeat 99.16
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 99.16
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 99.15
PRK10153517 DNA-binding transcriptional activator CadC; Provis 99.15
PLN03218 1060 maturation of RBCL 1; Provisional 99.15
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 99.14
KOG1128777 consensus Uncharacterized conserved protein, conta 99.14
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.14
PF1337173 TPR_9: Tetratricopeptide repeat 99.14
PRK11906458 transcriptional regulator; Provisional 99.13
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 99.13
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.12
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.11
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.1
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 99.09
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 99.09
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 99.08
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.07
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.07
COG1729262 Uncharacterized protein conserved in bacteria [Fun 99.06
PF12688120 TPR_5: Tetratrico peptide repeat 99.05
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.05
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 99.05
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.04
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 99.04
COG4105254 ComL DNA uptake lipoprotein [General function pred 99.04
PF06552186 TOM20_plant: Plant specific mitochondrial import r 99.03
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.03
PRK11906458 transcriptional regulator; Provisional 99.01
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.97
PRK15331165 chaperone protein SicA; Provisional 98.96
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.95
KOG3785 557 consensus Uncharacterized conserved protein [Funct 98.93
PRK04841 903 transcriptional regulator MalT; Provisional 98.92
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.91
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.9
PLN03077 857 Protein ECB2; Provisional 98.89
PRK10803263 tol-pal system protein YbgF; Provisional 98.89
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.89
PLN03077857 Protein ECB2; Provisional 98.87
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.86
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 98.84
KOG1915 677 consensus Cell cycle control protein (crooked neck 98.82
KOG3785 557 consensus Uncharacterized conserved protein [Funct 98.8
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.77
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.76
KOG4340 459 consensus Uncharacterized conserved protein [Funct 98.73
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.72
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.71
COG4700251 Uncharacterized protein conserved in bacteria cont 98.69
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.69
PF1342844 TPR_14: Tetratricopeptide repeat 98.61
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 98.61
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.61
PRK04841903 transcriptional regulator MalT; Provisional 98.6
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.6
PF1342844 TPR_14: Tetratricopeptide repeat 98.59
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.57
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.56
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.55
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.55
KOG4555175 consensus TPR repeat-containing protein [Function 98.55
PF1343134 TPR_17: Tetratricopeptide repeat 98.54
PF1343134 TPR_17: Tetratricopeptide repeat 98.51
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.46
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.46
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.45
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.45
KOG4234271 consensus TPR repeat-containing protein [General f 98.44
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.43
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 98.38
COG4700251 Uncharacterized protein conserved in bacteria cont 98.37
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 98.36
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 98.31
KOG1941 518 consensus Acetylcholine receptor-associated protei 98.31
KOG1941518 consensus Acetylcholine receptor-associated protei 98.3
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 98.3
PF13512142 TPR_18: Tetratricopeptide repeat 98.28
KOG2610491 consensus Uncharacterized conserved protein [Funct 98.25
PF03704146 BTAD: Bacterial transcriptional activator domain; 98.24
KOG1586288 consensus Protein required for fusion of vesicles 98.24
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.22
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.19
KOG1915677 consensus Cell cycle control protein (crooked neck 98.17
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.17
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.17
KOG1585308 consensus Protein required for fusion of vesicles 98.14
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 98.09
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.02
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 98.02
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.98
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.97
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.96
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.91
KOG2471 696 consensus TPR repeat-containing protein [General f 97.91
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.86
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.86
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 97.79
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.79
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.78
KOG1310758 consensus WD40 repeat protein [General function pr 97.78
KOG4507886 consensus Uncharacterized conserved protein, conta 97.77
PRK10941269 hypothetical protein; Provisional 97.74
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.72
KOG1586288 consensus Protein required for fusion of vesicles 97.69
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 97.69
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.69
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 97.67
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 97.64
KOG1585308 consensus Protein required for fusion of vesicles 97.63
PRK10941269 hypothetical protein; Provisional 97.62
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 97.61
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.61
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.6
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.6
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.6
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.58
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.57
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.55
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 97.54
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 97.51
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.49
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 97.46
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.42
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.41
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.39
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.38
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 97.36
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 97.35
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 97.31
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 97.31
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 97.22
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 97.21
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.19
KOG2471696 consensus TPR repeat-containing protein [General f 97.08
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 97.07
PF09986214 DUF2225: Uncharacterized protein conserved in bact 97.05
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 97.01
KOG2610491 consensus Uncharacterized conserved protein [Funct 96.97
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.97
COG4976287 Predicted methyltransferase (contains TPR repeat) 96.9
COG3898 531 Uncharacterized membrane-bound protein [Function u 96.87
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 96.86
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 96.83
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 96.82
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 96.78
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.77
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.75
KOG0530318 consensus Protein farnesyltransferase, alpha subun 96.7
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.64
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.63
KOG2300629 consensus Uncharacterized conserved protein [Funct 96.63
KOG2449157 consensus Methylmalonate semialdehyde dehydrogenas 96.61
KOG4507 886 consensus Uncharacterized conserved protein, conta 96.58
KOG1550552 consensus Extracellular protein SEL-1 and related 96.57
KOG4814 872 consensus Uncharacterized conserved protein [Funct 96.51
COG4976287 Predicted methyltransferase (contains TPR repeat) 96.5
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 96.5
COG5191435 Uncharacterized conserved protein, contains HAT (H 96.5
KOG2300629 consensus Uncharacterized conserved protein [Funct 96.48
KOG3364149 consensus Membrane protein involved in organellar 96.45
COG2912269 Uncharacterized conserved protein [Function unknow 96.45
COG2976207 Uncharacterized protein conserved in bacteria [Fun 96.45
KOG1258577 consensus mRNA processing protein [RNA processing 96.42
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 96.42
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 96.34
COG2912269 Uncharacterized conserved protein [Function unknow 96.32
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 96.25
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 96.2
KOG1550552 consensus Extracellular protein SEL-1 and related 96.15
KOG3364149 consensus Membrane protein involved in organellar 96.13
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 96.11
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 96.01
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.01
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 96.01
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 95.86
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 95.75
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 95.62
KOG0529421 consensus Protein geranylgeranyltransferase type I 95.6
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 95.47
PF1286294 Apc5: Anaphase-promoting complex subunit 5 95.41
PF10373278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 95.38
KOG3616 1636 consensus Selective LIM binding factor [Transcript 95.32
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 95.29
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 95.25
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 95.1
KOG4151 748 consensus Myosin assembly protein/sexual cycle pro 95.09
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 95.08
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 95.04
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 95.03
PF09986214 DUF2225: Uncharacterized protein conserved in bact 95.02
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 94.97
KOG4814 872 consensus Uncharacterized conserved protein [Funct 94.96
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 94.96
PF1286294 Apc5: Anaphase-promoting complex subunit 5 94.95
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 94.88
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 94.73
KOG0530318 consensus Protein farnesyltransferase, alpha subun 94.68
KOG1258577 consensus mRNA processing protein [RNA processing 94.68
KOG1310 758 consensus WD40 repeat protein [General function pr 94.65
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 94.62
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 94.59
COG3898531 Uncharacterized membrane-bound protein [Function u 94.51
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 94.31
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 94.31
COG3629280 DnrI DNA-binding transcriptional activator of the 94.26
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 94.25
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 94.24
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 94.22
COG3629280 DnrI DNA-binding transcriptional activator of the 94.03
COG5191435 Uncharacterized conserved protein, contains HAT (H 94.0
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 93.9
COG3947361 Response regulator containing CheY-like receiver a 93.49
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 93.39
PF10373278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 93.36
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 93.35
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 93.29
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 93.04
KOG0529421 consensus Protein geranylgeranyltransferase type I 92.97
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 92.97
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 92.91
KOG2041 1189 consensus WD40 repeat protein [General function pr 92.57
COG3947361 Response regulator containing CheY-like receiver a 92.21
COG5159421 RPN6 26S proteasome regulatory complex component [ 92.11
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 91.96
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 91.86
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 91.78
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 91.74
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 91.48
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 91.37
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 91.12
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 90.75
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 90.61
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 90.55
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 90.31
KOG3807556 consensus Predicted membrane protein ST7 (tumor su 90.2
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 90.03
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 89.85
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 89.67
KOG2422665 consensus Uncharacterized conserved protein [Funct 89.52
KOG0686466 consensus COP9 signalosome, subunit CSN1 [Posttran 89.14
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 89.13
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 89.1
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 89.01
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 89.01
KOG20411189 consensus WD40 repeat protein [General function pr 88.95
COG4941415 Predicted RNA polymerase sigma factor containing a 88.87
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 88.85
KOG2581493 consensus 26S proteasome regulatory complex, subun 88.68
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 88.57
KOG2422665 consensus Uncharacterized conserved protein [Funct 88.15
COG4455273 ImpE Protein of avirulence locus involved in tempe 87.93
PRK15490 578 Vi polysaccharide biosynthesis protein TviE; Provi 87.84
KOG3616 1636 consensus Selective LIM binding factor [Transcript 87.57
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 87.02
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 86.75
COG4455273 ImpE Protein of avirulence locus involved in tempe 86.49
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 85.66
PF0421269 MIT: MIT (microtubule interacting and transport) d 85.54
cd0268176 MIT_calpain7_1 MIT: domain contained within Microt 85.5
cd0268377 MIT_1 MIT: domain contained within Microtubule Int 85.32
PF0421269 MIT: MIT (microtubule interacting and transport) d 85.27
cd0268176 MIT_calpain7_1 MIT: domain contained within Microt 85.06
cd0267979 MIT_spastin MIT: domain contained within Microtubu 84.86
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 84.59
PF09797365 NatB_MDM20: N-acetyltransferase B complex (NatB) n 83.29
PHA02537230 M terminase endonuclease subunit; Provisional 83.02
cd0268075 MIT_calpain7_2 MIT: domain contained within Microt 82.47
KOG3783546 consensus Uncharacterized conserved protein [Funct 81.77
PF1285434 PPR_1: PPR repeat 81.15
KOG2561568 consensus Adaptor protein NUB1, contains UBA domai 81.12
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 80.11
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=9.9e-34  Score=245.78  Aligned_cols=280  Identities=13%  Similarity=0.122  Sum_probs=246.3

Q ss_pred             cchHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHccCHHHHHHHHHHHHhcCCCCHHHHHHH
Q 020914            2 AAEAEEMSLKDKGNEFFKAGNYLKAAALYTQAIKQDPSNPTLFSNRAAAFLHLVKLNKALADAETTISLNPQWEKGYFRK   81 (320)
Q Consensus         2 ~~p~~a~~~~~~g~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~l~p~~~~~~~~l   81 (320)
                      +.|.-+.+|.++|.++..+|+...||..|++|+.++|+...+|+++|.+|...+.++.|+.+|.+|+.+.|+++.++-++
T Consensus       213 ~qp~fAiawsnLg~~f~~~Gei~~aiq~y~eAvkldP~f~dAYiNLGnV~ke~~~~d~Avs~Y~rAl~lrpn~A~a~gNl  292 (966)
T KOG4626|consen  213 TQPCFAIAWSNLGCVFNAQGEIWLAIQHYEEAVKLDPNFLDAYINLGNVYKEARIFDRAVSCYLRALNLRPNHAVAHGNL  292 (966)
T ss_pred             hCCceeeeehhcchHHhhcchHHHHHHHHHHhhcCCCcchHHHhhHHHHHHHHhcchHHHHHHHHHHhcCCcchhhccce
Confidence            46777889999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHccCHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHhHHHHHHHHhhhhcchhhh
Q 020914           82 GCILEAMEQYDDALSAFQTALQYNPQSAEVSRKIKRVSQLAKDKKRAQEVENIRSNVDMVQHLDEFKSEMSEKYGAEECW  161 (320)
Q Consensus        82 g~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  161 (320)
                      |.+|..+|..+-||.+|++||++.|+.++++.+++..+...|+..+|...+.      .+..+.+..+....++|+++..
T Consensus       293 a~iYyeqG~ldlAI~~Ykral~~~P~F~~Ay~NlanALkd~G~V~ea~~cYn------kaL~l~p~hadam~NLgni~~E  366 (966)
T KOG4626|consen  293 ACIYYEQGLLDLAIDTYKRALELQPNFPDAYNNLANALKDKGSVTEAVDCYN------KALRLCPNHADAMNNLGNIYRE  366 (966)
T ss_pred             EEEEeccccHHHHHHHHHHHHhcCCCchHHHhHHHHHHHhccchHHHHHHHH------HHHHhCCccHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999977752      2233334455566677888887


Q ss_pred             hhHHHHHHHHHHHHHHhHhhccccChh---HHhhhcChhHHHHhhhhhhccccCcCCccc-hhhHHHHhhHH--HHHHHH
Q 020914          162 KHVFSFVVETMETAVKSWHETSKVDAK---VYFLLDKEKTDTEKYAPIVNVDKAFESPHT-HGSCFQFLRQY--ADDSFS  235 (320)
Q Consensus       162 ~~~~~~a~~~~~~a~~~~~~~~~~~~~---~~~~lg~~~~A~~~~~~a~~~~~~~~~~~~-~g~~~~~~~~~--A~~~~~  235 (320)
                      .|.++.|...|.+|++.++.-..-..+   +|..+|++++|+..|+.++.|+|.+..... +|..|..+|+.  |+.+|+
T Consensus       367 ~~~~e~A~~ly~~al~v~p~~aaa~nNLa~i~kqqgnl~~Ai~~YkealrI~P~fAda~~NmGnt~ke~g~v~~A~q~y~  446 (966)
T KOG4626|consen  367 QGKIEEATRLYLKALEVFPEFAAAHNNLASIYKQQGNLDDAIMCYKEALRIKPTFADALSNMGNTYKEMGDVSAAIQCYT  446 (966)
T ss_pred             hccchHHHHHHHHHHhhChhhhhhhhhHHHHHHhcccHHHHHHHHHHHHhcCchHHHHHHhcchHHHHhhhHHHHHHHHH
Confidence            787888888887777777665444443   999999999999999999999999866655 99999999998  999999


Q ss_pred             HHhchhCCCCCCChhHhhhcccccccccCcccchhhhcccccccccccccccccccc
Q 020914          236 SAACLVAPKSIISYPQVWRGQGLRKWRHSQQDGFFVQFESPLLRKLWFIPSSNEKGK  292 (320)
Q Consensus       236 ~al~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  292 (320)
                      +||..     +|.++++..|+|+.+...|...+++..+++++..++.|..+..+...
T Consensus       447 rAI~~-----nPt~AeAhsNLasi~kDsGni~~AI~sY~~aLklkPDfpdA~cNllh  498 (966)
T KOG4626|consen  447 RAIQI-----NPTFAEAHSNLASIYKDSGNIPEAIQSYRTALKLKPDFPDAYCNLLH  498 (966)
T ss_pred             HHHhc-----CcHHHHHHhhHHHHhhccCCcHHHHHHHHHHHccCCCCchhhhHHHH
Confidence            99999     99999999999999999999999999999999888887766666543



>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2449 consensus Methylmalonate semialdehyde dehydrogenase [Amino acid transport and metabolism; Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PRK15490 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking Back     alignment and domain information
>cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking Back     alignment and domain information
>cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>cd02679 MIT_spastin MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PF09797 NatB_MDM20: N-acetyltransferase B complex (NatB) non catalytic subunit; InterPro: IPR019183 This is the non-catalytic subunit of the N-terminal acetyltransferase B complex (NatB) Back     alignment and domain information
>PHA02537 M terminase endonuclease subunit; Provisional Back     alignment and domain information
>cd02680 MIT_calpain7_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query320
4gco_A126 Central Domain Of Stress-Induced Protein-1 (Sti-1) 1e-19
2lni_A133 Solution Nmr Structure Of Stress-Induced-Phosphopro 2e-18
1wao_1 477 Pp5 Structure Length = 477 1e-14
1elw_A118 Crystal Structure Of The Tpr1 Domain Of Hop In Comp 2e-14
1a17_A166 Tetratricopeptide Repeats Of Protein Phosphatase 5 1e-13
2bug_A140 Solution Structure Of The Tpr Domain From Protein P 8e-13
2vyi_A131 Crystal Structure Of The Tpr Domain Of Human Sgt Le 3e-12
2c2l_A281 Crystal Structure Of The Chip U-Box E3 Ubiquitin Li 1e-10
3q47_B137 Crystal Structure Of Tpr Domain Of Chip Complexed W 2e-10
3sz7_A164 Crystal Structure Of The Sgt2 Tpr Domain From Asper 2e-09
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 1e-08
3upv_A126 Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = 2e-08
3uq3_A258 Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = 2e-08
3lca_A 533 Structure Of Tom71 Complexed With Hsp70 Ssa1 C Term 3e-08
3fp2_A 537 Crystal Structure Of Tom71 Complexed With Hsp82 C-T 3e-08
2dba_A148 The Solution Structure Of The Tetratrico Peptide Re 3e-07
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 3e-07
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 2e-06
1kt0_A457 Structure Of The Large Fkbp-like Protein, Fkbp51, I 2e-06
1kt1_A457 Structure Of The Large Fkbp-Like Protein, Fkbp51, I 6e-06
2gw1_A 514 Crystal Structure Of The Yeast Tom70 Length = 514 2e-05
3ieg_A359 Crystal Structure Of P58(Ipk) Tpr Domain At 2.5 A L 4e-05
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 4e-05
2y4t_A 450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 6e-05
2l6j_A111 Tah1 Complexed By Meevd Length = 111 6e-05
3pe3_A 723 Structure Of Human O-Glcnac Transferase And Its Com 1e-04
2y4u_A 450 Crystal Structure Of Human P58(Ipk) In Space Group 1e-04
1w3b_A388 The Superhelical Tpr Domain Of O-Linked Glcnac Tran 3e-04
>pdb|4GCO|A Chain A, Central Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 126 Back     alignment and structure

Iteration: 1

Score = 93.6 bits (231), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 44/106 (41%), Positives = 66/106 (62%) Query: 11 KDKGNEFFKAGNYLKAAALYTQAIKQDPSNPTLFSNRAAAFLHLVKLNKALADAETTISL 70 K+KGNE+FK G+Y A Y +A+K+DP N L+SNRAA L++ +AL D +T I L Sbjct: 17 KNKGNEYFKKGDYPTAMRHYNEAVKRDPENAILYSNRAACLTKLMEFQRALDDCDTCIRL 76 Query: 71 NPQWEKGYFRKGCILEAMEQYDDALSAFQTALQYNPQSAEVSRKIK 116 + ++ KGY RK L AM ++ A A++ ALQ +P + E ++ Sbjct: 77 DSKFIKGYIRKAACLVAMREWSKAQRAYEDALQVDPSNEEAREGVR 122
>pdb|2LNI|A Chain A, Solution Nmr Structure Of Stress-Induced-Phosphoprotein 1 Sti1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4403e Length = 133 Back     alignment and structure
>pdb|1WAO|1 Chain 1, Pp5 Structure Length = 477 Back     alignment and structure
>pdb|1ELW|A Chain A, Crystal Structure Of The Tpr1 Domain Of Hop In Complex With A Hsc70 Peptide Length = 118 Back     alignment and structure
>pdb|1A17|A Chain A, Tetratricopeptide Repeats Of Protein Phosphatase 5 Length = 166 Back     alignment and structure
>pdb|2VYI|A Chain A, Crystal Structure Of The Tpr Domain Of Human Sgt Length = 131 Back     alignment and structure
>pdb|2C2L|A Chain A, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase Length = 281 Back     alignment and structure
>pdb|3Q47|B Chain B, Crystal Structure Of Tpr Domain Of Chip Complexed With Pseudophosphorylated Smad1 Peptide Length = 137 Back     alignment and structure
>pdb|3SZ7|A Chain A, Crystal Structure Of The Sgt2 Tpr Domain From Aspergillus Fumigatus Length = 164 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|3UPV|A Chain A, Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = 126 Back     alignment and structure
>pdb|3UQ3|A Chain A, Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = 258 Back     alignment and structure
>pdb|3LCA|A Chain A, Structure Of Tom71 Complexed With Hsp70 Ssa1 C Terminal Tail Indicating Conformational Plasticity Length = 533 Back     alignment and structure
>pdb|3FP2|A Chain A, Crystal Structure Of Tom71 Complexed With Hsp82 C-Terminal Fragment Length = 537 Back     alignment and structure
>pdb|2DBA|A Chain A, The Solution Structure Of The Tetratrico Peptide Repeat Of Human Smooth Muscle Cell Associated Protein-1, Isoform 2 Length = 148 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|2GW1|A Chain A, Crystal Structure Of The Yeast Tom70 Length = 514 Back     alignment and structure
>pdb|3IEG|A Chain A, Crystal Structure Of P58(Ipk) Tpr Domain At 2.5 A Length = 359 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure
>pdb|2L6J|A Chain A, Tah1 Complexed By Meevd Length = 111 Back     alignment and structure
>pdb|3PE3|A Chain A, Structure Of Human O-Glcnac Transferase And Its Complex With A Peptide Substrate Length = 723 Back     alignment and structure
>pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 Back     alignment and structure
>pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha. Length = 388 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query320
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 8e-45
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 3e-44
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 6e-44
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 7e-44
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 4e-43
3q49_B137 STIP1 homology and U box-containing protein 1; E3 4e-43
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 5e-43
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 5e-42
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 8e-42
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 4e-39
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 8e-35
2l6j_A111 TPR repeat-containing protein associated with HSP; 5e-34
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 2e-32
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 5e-32
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 1e-28
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-21
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 4e-15
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 4e-15
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 5e-10
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-06
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 5e-28
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 9e-25
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-21
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-13
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-13
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 5e-12
2gw1_A 514 Mitochondrial precursor proteins import receptor; 2e-27
2gw1_A514 Mitochondrial precursor proteins import receptor; 7e-19
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-18
2gw1_A514 Mitochondrial precursor proteins import receptor; 4e-18
2gw1_A514 Mitochondrial precursor proteins import receptor; 6e-17
2gw1_A514 Mitochondrial precursor proteins import receptor; 4e-15
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-11
2gw1_A514 Mitochondrial precursor proteins import receptor; 7e-08
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-27
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-24
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-21
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 8e-13
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-12
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-11
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-10
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-05
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 6e-25
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 8e-19
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-17
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 6e-17
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-15
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-14
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-12
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-12
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 7e-10
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 6e-09
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 2e-24
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 2e-24
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 2e-22
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-20
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-19
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-19
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 8e-19
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 6e-18
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 9e-18
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-17
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-17
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 6e-17
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-09
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 3e-19
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 5e-19
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 8e-12
3u4t_A272 TPR repeat-containing protein; structural genomics 6e-19
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-17
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-15
3u4t_A272 TPR repeat-containing protein; structural genomics 5e-15
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-11
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-07
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-05
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-18
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 7e-17
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-16
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-16
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 4e-10
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 4e-18
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 6e-18
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 6e-15
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-14
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-13
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 6e-13
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-11
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-08
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 7e-07
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 8e-06
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 6e-17
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 4e-11
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 4e-05
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 7e-17
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-15
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 4e-15
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-12
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-12
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-10
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 9e-07
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 8e-17
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 4e-12
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 9e-17
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 4e-16
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 4e-16
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-11
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-05
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-16
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 9e-14
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-10
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-09
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-08
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 4e-06
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-04
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 7e-16
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 6e-09
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 9e-16
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 9e-16
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-15
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-15
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 2e-15
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 6e-15
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-14
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-14
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-14
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-13
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 8e-13
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 1e-09
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 1e-15
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 5e-14
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-13
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 6e-13
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 6e-10
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 2e-15
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 6e-12
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 4e-07
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 2e-15
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-15
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 5e-13
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 5e-12
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-11
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-10
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 3e-09
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-15
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-14
4eqf_A365 PEX5-related protein; accessory protein, tetratric 5e-13
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-12
4eqf_A365 PEX5-related protein; accessory protein, tetratric 3e-10
4eqf_A365 PEX5-related protein; accessory protein, tetratric 6e-05
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 3e-15
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-14
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 3e-14
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 6e-05
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 3e-15
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 4e-09
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 5e-07
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 4e-15
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 8e-15
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 8e-09
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 6e-15
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 3e-14
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 3e-09
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 8e-07
2kat_A115 Uncharacterized protein; NESG, structure, structur 6e-14
2kat_A115 Uncharacterized protein; NESG, structure, structur 1e-04
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-14
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-13
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-12
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-12
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-12
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-11
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-11
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-11
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-11
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-09
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-07
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-06
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-04
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-04
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-04
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-13
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-13
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-12
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-11
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-08
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-13
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 8e-13
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 4e-12
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-09
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-11
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 7e-11
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-10
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-10
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 4e-11
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 1e-06
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 5e-11
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 1e-10
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-10
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 6e-10
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-09
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-06
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 5e-05
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 3e-10
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-08
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 7e-07
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 1e-06
4g1t_A472 Interferon-induced protein with tetratricopeptide 9e-10
4g1t_A472 Interferon-induced protein with tetratricopeptide 8e-09
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-08
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-07
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-06
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-04
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 5e-09
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 3e-07
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 2e-08
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 1e-06
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 5e-08
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 2e-07
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 3e-04
3k9i_A117 BH0479 protein; putative protein binding protein, 7e-08
3k9i_A117 BH0479 protein; putative protein binding protein, 2e-07
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 1e-06
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 4e-05
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 4e-06
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 2e-04
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 3e-04
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 4e-04
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
 Score =  149 bits (378), Expect = 8e-45
 Identities = 44/153 (28%), Positives = 77/153 (50%), Gaps = 2/153 (1%)

Query: 3   AEAEEMSLKDKGNEFFKAGNYLKAAALYTQAIKQDPSNPTLFSNRAAAFLHLVKLNKALA 62
             AEE  LK + N++FKA +Y  A   Y+QAI+ +PSN   + NR+ A+L       AL 
Sbjct: 11  KRAEE--LKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALG 68

Query: 63  DAETTISLNPQWEKGYFRKGCILEAMEQYDDALSAFQTALQYNPQSAEVSRKIKRVSQLA 122
           DA   I L+ ++ KGY+R+     A+ ++  AL  ++T ++  P   +   K +  +++ 
Sbjct: 69  DATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIV 128

Query: 123 KDKKRAQEVENIRSNVDMVQHLDEFKSEMSEKY 155
           K K   + +        +V  LD     + ++Y
Sbjct: 129 KQKAFERAIAGDEHKRSVVDSLDIESMTIEDEY 161


>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query320
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.95
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.95
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.95
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.95
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.95
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.95
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.95
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.95
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.94
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.94
2gw1_A 514 Mitochondrial precursor proteins import receptor; 99.93
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.93
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.93
3u4t_A272 TPR repeat-containing protein; structural genomics 99.93
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.93
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.92
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.92
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.92
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.91
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.91
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.91
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.91
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.91
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.91
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.91
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.91
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.91
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.9
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.9
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.9
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.9
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.9
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.9
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.9
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.9
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.89
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.89
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.89
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.88
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.88
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.88
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.87
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.87
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.86
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.86
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.86
3u4t_A272 TPR repeat-containing protein; structural genomics 99.86
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.86
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.86
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.85
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.85
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.85
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.85
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.85
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.85
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.85
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.85
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.84
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.84
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.84
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.83
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.83
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.83
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.83
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.83
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.83
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.82
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.82
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.82
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.82
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.82
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.81
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.81
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.8
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.8
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.8
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.8
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.8
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.8
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.8
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.8
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.8
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.79
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.79
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.79
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.79
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.79
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.78
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.78
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.78
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.78
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.77
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.77
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.76
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.76
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.76
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.76
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.75
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.75
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.75
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.75
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.75
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.75
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.74
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.74
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.74
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.74
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.73
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.73
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.72
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.72
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.72
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.72
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.71
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.71
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.71
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.71
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.7
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.7
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 99.7
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.7
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.7
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.69
3k9i_A117 BH0479 protein; putative protein binding protein, 99.68
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.68
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.68
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.68
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.67
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.66
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.66
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.65
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.64
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.64
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.64
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.64
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.63
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.63
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.63
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.63
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.62
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.62
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.61
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.6
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.6
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.6
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.59
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.59
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.59
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.58
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.58
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.57
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.57
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.56
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.56
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.54
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.54
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.54
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.53
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.53
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 99.53
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.52
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.52
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.52
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.52
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.51
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.51
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.5
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.5
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.48
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.48
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.48
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.47
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.47
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.47
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.47
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.46
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.44
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.43
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.43
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.42
3k9i_A117 BH0479 protein; putative protein binding protein, 99.42
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.41
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.41
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.4
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.4
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.4
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.39
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.36
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.36
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.34
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.3
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.3
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.26
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.25
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.2
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 99.19
1pc2_A152 Mitochondria fission protein; unknown function; NM 99.16
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.13
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.13
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 99.09
3qww_A433 SET and MYND domain-containing protein 2; methyltr 99.08
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 99.07
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.06
1klx_A138 Cysteine rich protein B; structural genomics, heli 99.06
1klx_A138 Cysteine rich protein B; structural genomics, heli 99.02
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 99.01
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.99
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.98
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.98
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.94
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.88
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.74
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.68
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.62
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.6
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.35
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.35
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.31
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.13
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 98.11
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 98.09
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.08
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.99
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.98
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.79
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 97.7
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.7
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.68
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.58
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 97.34
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 97.15
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 97.07
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 97.0
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 96.69
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 96.68
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 96.6
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 96.51
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 96.5
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 95.68
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.38
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 95.31
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.1
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 94.95
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 94.48
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.27
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 94.27
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 94.08
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 93.11
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 92.66
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 92.51
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 92.39
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 92.16
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 91.54
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 89.62
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 87.5
2vkj_A106 TM1634; membrane protein, TPR motif joint center f 86.76
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 85.06
4gq2_M950 Nucleoporin NUP120; beta propeller alpha helical, 84.88
4a5x_A86 MITD1, MIT domain-containing protein 1; protein tr 84.79
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 84.52
2w2u_A83 Hypothetical P60 katanin; hydrolase transport comp 83.59
3ax2_A73 Mitochondrial import receptor subunit TOM20 homol; 82.47
2w2u_A83 Hypothetical P60 katanin; hydrolase transport comp 82.27
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 82.12
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 82.0
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 81.55
2v6y_A83 AAA family ATPase, P60 katanin; MIT, VPS4, archaea 81.48
2crb_A97 Nuclear receptor binding factor 2; NRBF-2, MIT dom 80.24
3t5x_A203 PCI domain-containing protein 2; PCI, mRNA nuclear 80.08
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
Probab=99.96  E-value=5e-30  Score=226.35  Aligned_cols=256  Identities=15%  Similarity=0.160  Sum_probs=127.1

Q ss_pred             hHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHccCHHHHHHHHHHHHhcCCCCHHHHHHHHH
Q 020914            4 EAEEMSLKDKGNEFFKAGNYLKAAALYTQAIKQDPSNPTLFSNRAAAFLHLVKLNKALADAETTISLNPQWEKGYFRKGC   83 (320)
Q Consensus         4 p~~a~~~~~~g~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~l~p~~~~~~~~lg~   83 (320)
                      |.++.++..+|.++...|++++|+..|+++++++|+++.++.++|.++...|++++|+..|+++++++|++..++..+|.
T Consensus        64 p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~  143 (388)
T 1w3b_A           64 PLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGN  143 (388)
T ss_dssp             TTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHH
T ss_pred             CCchHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCcchHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCcHHHHHHHHH
Confidence            33444444444444444444444444444444444444444444444444444444444444444444444444444444


Q ss_pred             HHHHccCHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHhHHHHHHHHhhhhcchhhhhh
Q 020914           84 ILEAMEQYDDALSAFQTALQYNPQSAEVSRKIKRVSQLAKDKKRAQEVENIRSNVDMVQHLDEFKSEMSEKYGAEECWKH  163 (320)
Q Consensus        84 ~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  163 (320)
                      ++..+|++++|++.|+++++.+|++..+|..+|.++...|++++|+..+.  ..+..    .+.....+..+|.++...|
T Consensus       144 ~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~--~al~~----~p~~~~~~~~lg~~~~~~~  217 (388)
T 1w3b_A          144 LLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFE--KAVTL----DPNFLDAYINLGNVLKEAR  217 (388)
T ss_dssp             HHHTTSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHH--HHHHH----CTTCHHHHHHHHHHHHTTT
T ss_pred             HHHHccCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHH--HHHhc----CCCcHHHHHHHHHHHHHcC
Confidence            44444444444444444444444444444444444444444444433321  11111    1111122222333333333


Q ss_pred             HHHHHHHHHHHHHHhHhhccccChh----------HHhhhcChhHHHHhhhhhhccccCcCCccc-hhhHHHHhhHH--H
Q 020914          164 VFSFVVETMETAVKSWHETSKVDAK----------VYFLLDKEKTDTEKYAPIVNVDKAFESPHT-HGSCFQFLRQY--A  230 (320)
Q Consensus       164 ~~~~a~~~~~~a~~~~~~~~~~~~~----------~~~~lg~~~~A~~~~~~a~~~~~~~~~~~~-~g~~~~~~~~~--A  230 (320)
                      .+.       +|+..+.+++.+.|.          ++...|++++|+..|+++++++|.....+. +|.++...|++  |
T Consensus       218 ~~~-------~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A  290 (388)
T 1w3b_A          218 IFD-------RAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEA  290 (388)
T ss_dssp             CTT-------HHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCHHHHHHHHHHHHHHSCHHHH
T ss_pred             CHH-------HHHHHHHHHHhhCcCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHcCCHHHH
Confidence            333       333333333333332          566667777777777777777666543333 66666666666  7


Q ss_pred             HHHHHHHhchhCCCCCCChhHhhhcccccccccCcccchhhhccccc
Q 020914          231 DDSFSSAACLVAPKSIISYPQVWRGQGLRKWRHSQQDGFFVQFESPL  277 (320)
Q Consensus       231 ~~~~~~al~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~  277 (320)
                      ++.|++++++     .|..+.+|.++|.++...|+++++...+++..
T Consensus       291 ~~~~~~al~~-----~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al  332 (388)
T 1w3b_A          291 EDCYNTALRL-----CPTHADSLNNLANIKREQGNIEEAVRLYRKAL  332 (388)
T ss_dssp             HHHHHHHHHH-----CTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHT
T ss_pred             HHHHHHHHhh-----CcccHHHHHHHHHHHHHcCCHHHHHHHHHHHH
Confidence            7777777766     55556667777777777777766665555433



>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2vkj_A TM1634; membrane protein, TPR motif joint center for structural GENO JCSG, structural genomics; 1.65A {Thermotoga maritima} PDB: 2vko_A* Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>4a5x_A MITD1, MIT domain-containing protein 1; protein transport, ESCRT, cytokinesis, midbody; HET: P15; 1.91A {Homo sapiens} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} Back     alignment and structure
>3ax2_A Mitochondrial import receptor subunit TOM20 homol; protein-protein complex, membrane protein-transport protein; 1.90A {Rattus norvegicus} PDB: 2v1s_A 3awr_A 2v1t_A 3ax5_A 3ax3_A Back     alignment and structure
>2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>2v6y_A AAA family ATPase, P60 katanin; MIT, VPS4, archaea, AAA-ATPase, ATP-binding, microtubule INT and trafficking domain, nucleotide-binding; HET: SRT; 2.40A {Sulfolobus solfataricus} PDB: 2v6y_B* Back     alignment and structure
>2crb_A Nuclear receptor binding factor 2; NRBF-2, MIT domain, helix bundle, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.7.16.1 Back     alignment and structure
>3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 320
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 7e-17
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 4e-13
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 9e-13
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-11
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-11
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-11
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 7e-09
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 8e-09
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-05
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 5e-12
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 1e-11
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 1e-11
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 2e-11
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 4e-11
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 3e-10
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 5e-10
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 8e-09
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 3e-08
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 2e-07
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 3e-04
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 2e-06
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 3e-06
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 5e-06
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 1e-05
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 3e-05
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 0.001
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 5e-04
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 9e-04
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: STIP1 homology and U box-containing protein 1, STUB1
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 75.4 bits (184), Expect = 7e-17
 Identities = 43/159 (27%), Positives = 71/159 (44%), Gaps = 2/159 (1%)

Query: 4   EAEEMSLKDKGNEFFKAGNYLKAAALYTQAIKQDPSNPTLFSNRAAAFLHLVKLNKALAD 63
            A+E  LK++GN  F    Y +AAA Y +AI ++P     ++NRA  +L + +  +ALAD
Sbjct: 3   SAQE--LKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALAD 60

Query: 64  AETTISLNPQWEKGYFRKGCILEAMEQYDDALSAFQTALQYNPQSAEVSRKIKRVSQLAK 123
               + L+ Q  K +F  G     ME YD+A++  Q A     +           +    
Sbjct: 61  CRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIA 120

Query: 124 DKKRAQEVENIRSNVDMVQHLDEFKSEMSEKYGAEECWK 162
            KKR   +E  R + +   H    +   +E+    E  +
Sbjct: 121 KKKRWNSIEERRIHQESELHSYLTRLIAAERERELEECQ 159


>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query320
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.96
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.94
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.94
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.93
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.9
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.88
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.88
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.84
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.84
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.84
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.84
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.83
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.83
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.82
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.81
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.81
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.81
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.78
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.77
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.77
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.77
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.75
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.7
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.67
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.65
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.64
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.64
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.63
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.62
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.6
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.57
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.56
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.56
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.52
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.52
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.45
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.44
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.42
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.41
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.4
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.39
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.34
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 99.34
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.19
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.18
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 99.17
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.94
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.93
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.87
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.74
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.71
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.24
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.0
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 88.67
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 88.43
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 87.95
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 87.63
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 84.12
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 82.77
d2cfua2505 Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI 80.53
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 80.12
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.96  E-value=8.1e-29  Score=214.72  Aligned_cols=269  Identities=12%  Similarity=0.102  Sum_probs=172.9

Q ss_pred             chHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHccCHHHHHHHHHHHHhcCC----------
Q 020914            3 AEAEEMSLKDKGNEFFKAGNYLKAAALYTQAIKQDPSNPTLFSNRAAAFLHLVKLNKALADAETTISLNP----------   72 (320)
Q Consensus         3 ~p~~a~~~~~~g~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~l~p----------   72 (320)
                      .|+++.++..+|.+++..|++++|+..|+++++++|+++.++..+|.+|..+|++++|+..+.+++..+|          
T Consensus        29 ~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~  108 (388)
T d1w3ba_          29 EPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLA  108 (388)
T ss_dssp             CTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhcccccccccccccccccccccccccccc
Confidence            3555566666666666666666666666666666666666666666666666666666665555544332          


Q ss_pred             ----------------------------------------------------------CCHHHHHHHHHHHHHccCHHHH
Q 020914           73 ----------------------------------------------------------QWEKGYFRKGCILEAMEQYDDA   94 (320)
Q Consensus        73 ----------------------------------------------------------~~~~~~~~lg~~~~~~~~~~~A   94 (320)
                                                                                +++.++..+|.++...|++++|
T Consensus       109 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A  188 (388)
T d1w3ba_         109 AALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLA  188 (388)
T ss_dssp             HHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHH
T ss_pred             ccccccccccccccccccccccccccccccccccccccccchhhhhHHHHHHhhccCcchhHHHHhhcccccccCcHHHH
Confidence                                                                      3344455556666666666666


Q ss_pred             HHHHHHHHhhCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHhHHHHHHHHhhhhcchhhhhhHHHHHHHHHHH
Q 020914           95 LSAFQTALQYNPQSAEVSRKIKRVSQLAKDKKRAQEVENIRSNVDMVQHLDEFKSEMSEKYGAEECWKHVFSFVVETMET  174 (320)
Q Consensus        95 ~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~  174 (320)
                      +..++++++++|++..++..+|.++...|++++|+.....  .    ....+........+|.++...|.+..|+..+++
T Consensus       189 ~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~--~----~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~  262 (388)
T d1w3ba_         189 IHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLR--A----LSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRR  262 (388)
T ss_dssp             HHHHHHHHHHCTTCHHHHHHHHHHHHTTTCTTHHHHHHHH--H----HHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHH
T ss_pred             HHHHHHHHHhCcccHHHHHHHhhhhhccccHHHHHHHHHH--h----HHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHH
Confidence            6666666666666666666666666666666666554321  1    111112223333445555555555555555555


Q ss_pred             HHHhHhhccccCh---hHHhhhcChhHHHHhhhhhhccccCcCCccc-hhhHHHHhhHH--HHHHHHHHhchhCCCCCCC
Q 020914          175 AVKSWHETSKVDA---KVYFLLDKEKTDTEKYAPIVNVDKAFESPHT-HGSCFQFLRQY--ADDSFSSAACLVAPKSIIS  248 (320)
Q Consensus       175 a~~~~~~~~~~~~---~~~~~lg~~~~A~~~~~~a~~~~~~~~~~~~-~g~~~~~~~~~--A~~~~~~al~~~~~~~~~~  248 (320)
                      +++..+......-   .++...|++.+|+..++.++...|.....+. +|.++...+++  |++.|++++++     +|.
T Consensus       263 al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~-----~p~  337 (388)
T d1w3ba_         263 AIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEV-----FPE  337 (388)
T ss_dssp             HHHTCSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTS-----CTT
T ss_pred             HHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccCCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHh-----CCC
Confidence            4443222111100   1788889999999999999998887654444 88888889999  99999999988     777


Q ss_pred             hhHhhhcccccccccCcccchhhhcccccccccc
Q 020914          249 YPQVWRGQGLRKWRHSQQDGFFVQFESPLLRKLW  282 (320)
Q Consensus       249 ~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~  282 (320)
                      ++.+|+++|.++..+|+++++...+++.+...|.
T Consensus       338 ~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~  371 (388)
T d1w3ba_         338 FAAAHSNLASVLQQQGKLQEALMHYKEAIRISPT  371 (388)
T ss_dssp             CHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTT
T ss_pred             CHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCC
Confidence            8999999999999999999998888776654443



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure