Citrus Sinensis ID: 021106

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------
MEPNSNRAEAERLLGVAEKLLNQRDLNGSKEFAILAQETEPLLEGSDQILAVVDVLLAAEKRVNNHHDWYSILQIDRRTDDQDLIKKQYRKLALLLHPDKNKYPFADQAFTLVVDAWGVLSDTRKKTPYDHELSLFTKIDLTTHSDSMHQSNKLPVRRSQRPSSNTKRPSNARGVDGEDQRARLSSFWTACPYCYILYEYPRVYENCCLRCENCKRGFHAALVPNLPPLVSGKDAYYCCWGFFPLGFVAGNSENGGLPTSGFPNWMPPLFTGGGGGGGDAGAGAGGADVEGRAKVDGNVERVATGAKKRGRPRKNPL
ccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccEEEcccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccEEEEEcEEEcccccccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccHHHHEccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccEEEEEcHEEcccEEEcccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MEPNSNRAEAERLLGVAEKLLnqrdlngsKEFAILAQetepllegsDQILAVVDVLLAAEKRVNNHHDWYSILQIDRRTDDQDLIKKQYRKLALLlhpdknkypfadqAFTLVVDAWgvlsdtrkktpydhelslftkidltthsdsmhqsnklpvrrsqrpssntkrpsnargvdgedqRARLSSfwtacpycyilyeyprvyencclrcenckrgfhaalvpnlpplvsgkdayyccwgffplgfvagnsengglptsgfpnwmpplftgggggggdagagaggadvegrakvdgNVERVATgakkrgrprknpl
MEPNSNRAEAERLLGVAEKLLNQRDLNGSKEFAILAQETEPLLEGSDQILAVVDVLLAAEKRVnnhhdwysilqidrrtddQDLIKKQYRKLALLLHPDKNKYPFADQAFTLVVDAWGVLSdtrkktpydheLSLFtkidltthsdsmhqsnklpvrrsqrpssntkrpsnargvdgedqRARLSSFWTACPYCYILYEYPRVYENCCLRCENCKRGFHAALVPNLPPLVSGKDAYYCCWGFFPLGFVAGNSENGGLPTSGFPNWMPPLFTGGGGGGGDAGAGAGGADvegrakvdgnvervatgakkrgrprknpl
MEPNSNRAEAERLLGVAEKLLNQRDLNGSKEFAILAQETEPLLEGSDQILAVVDVLLAAEKRVNNHHDWYSILQIDRRTDDQDLIKKQYRKLALLLHPDKNKYPFADQAFTLVVDAWGVLSDTRKKTPYDHELSLFTKIDLTTHSDSMHQSNKLPVRRSQRPSSNTKRPSNARGVDGEDQRARLSSFWTACPYCYILYEYPRVYENCCLRCENCKRGFHAALVPNLPPLVSGKDAYYCCWGFFPLGFVAGNSENGGLPTSGFPNWMPPLFTgggggggdagagaggadVEGRAKVDGNVERVATGAKKRGRPRKNPL
*****************************KEFAILAQETEPLLEGSDQILAVVDVLLAAEKRVNNHHDWYSILQIDRRTDDQDLIKKQYRKLALLLHPDKNKYPFADQAFTLVVDAWGVLSDTRKKTPYDHELSLFTKIDL******************************************LSSFWTACPYCYILYEYPRVYENCCLRCENCKRGFHAALVPNLPPLVSGKDAYYCCWGFFPLGFVAGN******************************************************************
******R*EAERLLGVAEKLLNQRDLNGSKEFAILAQETEPLLEGSDQILAVVDVLLAAEKRVNNHHDWYSILQIDRRTDDQDLIKKQYRKLALLLHPDKNKYPFADQAFTLVVDAWGVLSDTRKKTPYDH******************************************************SFWTACPYCYILYEYPRVYENCCLRCENCKRGFHAALV**********************************************************************************************
*********AERLLGVAEKLLNQRDLNGSKEFAILAQETEPLLEGSDQILAVVDVLLAAEKRVNNHHDWYSILQIDRRTDDQDLIKKQYRKLALLLHPDKNKYPFADQAFTLVVDAWGVLSDTRKKTPYDHELSLFTKIDLTTHSD***********************************ARLSSFWTACPYCYILYEYPRVYENCCLRCENCKRGFHAALVPNLPPLVSGKDAYYCCWGFFPLGFVAGNSENGGLPTSGFPNWMPPLFTGGGGGGGDAGAGAGGADVEGRAKVDGNVERVA**************
*******AEAERLLGVAEKLLNQRDLNGSKEFAILAQETEPLLEGSDQILAVVDVLLAAEKRVNNHHDWYSILQIDRRTDDQDLIKKQYRKLALLLHPDKNKYPFADQAFTLVVDAWGVLSDTRKKTPYDHELSL***********************************************RLSSFWTACPYCYILYEYPRVYENCCLRCENCKRGFHAALVPNLPPLVSGKDAYYCCWGFFPLGFV*********************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEPNSNRAEAERLLGVAEKLLNQRDLNGSKEFAILAQETEPLLEGSDQILAVVDVLLAAEKRVNNHHDWYSILQIDRRTDDQDLIKKQYRKLALLLHPDKNKYPFADQAFTLVVDAWGVLSDTRKKTPYDHELSLFTKIDLTTHSDSMHQSNKLPVRRSQRPSSNTKRPSNARGVDGEDQRARLSSFWTACPYCYILYEYPRVYENCCLRCENCKRGFHAALVPNLPPLVSGKDAYYCCWGFFPLGFVAGNSENGGLPTSGFPNWMPPLFTGGGGGGGDAGAGAGGADVEGRAKVDGNVERVATGAKKRGRPRKNPL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query317 2.2.26 [Sep-21-2011]
P48353224 Protein HLJ1 OS=Saccharom yes no 0.230 0.325 0.459 4e-12
Q9QYI4376 DnaJ homolog subfamily B yes no 0.233 0.196 0.493 2e-11
Q58DR2370 DnaJ homolog subfamily B yes no 0.230 0.197 0.5 4e-11
Q9NXW2375 DnaJ homolog subfamily B yes no 0.230 0.194 0.486 6e-11
Q9D832337 DnaJ homolog subfamily B no no 0.198 0.186 0.515 4e-10
Q5R8J8337 DnaJ homolog subfamily B no no 0.198 0.186 0.515 6e-10
Q9UDY4337 DnaJ homolog subfamily B no no 0.198 0.186 0.515 7e-10
Q24133334 DnaJ protein homolog 1 OS no no 0.198 0.188 0.5 8e-10
Q2KIT4337 DnaJ homolog subfamily B no no 0.198 0.186 0.515 1e-09
Q9UXR9 387 Chaperone protein DnaJ OS N/A no 0.195 0.160 0.492 2e-09
>sp|P48353|HLJ1_YEAST Protein HLJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HLJ1 PE=1 SV=1 Back     alignment and function desciption
 Score = 72.4 bits (176), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 51/74 (68%), Gaps = 1/74 (1%)

Query: 57  LAAEKRVNNHHDWYSILQIDRRTDDQDLIKKQYRKLALLLHPDKNKYPFADQAFTLVVDA 116
           +A E    + H++Y IL++DR+  D + IKK YRKLA+ LHPDKN +P A +AF ++  A
Sbjct: 10  IALEILSKDKHEFYEILKVDRKATDSE-IKKAYRKLAIKLHPDKNSHPKAGEAFKVINRA 68

Query: 117 WGVLSDTRKKTPYD 130
           + VLS+  K++ YD
Sbjct: 69  FEVLSNEEKRSIYD 82

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (taxid: 559292)
>sp|Q9QYI4|DJB12_MOUSE DnaJ homolog subfamily B member 12 OS=Mus musculus GN=Dnajb12 PE=2 SV=2 Back     alignment and function description
>sp|Q58DR2|DJB12_BOVIN DnaJ homolog subfamily B member 12 OS=Bos taurus GN=DNAJB12 PE=2 SV=1 Back     alignment and function description
>sp|Q9NXW2|DJB12_HUMAN DnaJ homolog subfamily B member 12 OS=Homo sapiens GN=DNAJB12 PE=1 SV=4 Back     alignment and function description
>sp|Q9D832|DNJB4_MOUSE DnaJ homolog subfamily B member 4 OS=Mus musculus GN=Dnajb4 PE=2 SV=1 Back     alignment and function description
>sp|Q5R8J8|DNJB4_PONAB DnaJ homolog subfamily B member 4 OS=Pongo abelii GN=DNAJB4 PE=2 SV=1 Back     alignment and function description
>sp|Q9UDY4|DNJB4_HUMAN DnaJ homolog subfamily B member 4 OS=Homo sapiens GN=DNAJB4 PE=1 SV=1 Back     alignment and function description
>sp|Q24133|DNAJ1_DROME DnaJ protein homolog 1 OS=Drosophila melanogaster GN=DnaJ-1 PE=1 SV=3 Back     alignment and function description
>sp|Q2KIT4|DNJB4_BOVIN DnaJ homolog subfamily B member 4 OS=Bos taurus GN=DNAJB4 PE=2 SV=1 Back     alignment and function description
>sp|Q9UXR9|DNAJ_METTE Chaperone protein DnaJ OS=Methanosarcina thermophila GN=dnaJ PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query317
449436954335 PREDICTED: uncharacterized protein LOC10 0.968 0.916 0.603 1e-111
255545956365 dnajc14 protein, putative [Ricinus commu 0.873 0.758 0.659 1e-110
116268421317 hypothetical protein [Prunus persica] 0.958 0.958 0.6 1e-105
225459101318 PREDICTED: uncharacterized protein LOC10 0.962 0.959 0.636 1e-104
224084558244 predicted protein [Populus trichocarpa] 0.747 0.971 0.688 1e-102
224067076313 predicted protein [Populus trichocarpa] 0.921 0.932 0.598 1e-100
302142058361 unnamed protein product [Vitis vinifera] 0.886 0.778 0.617 1e-99
356498846348 PREDICTED: uncharacterized protein LOC10 0.984 0.896 0.554 6e-98
357489993350 Curved DNA-binding protein [Medicago tru 0.974 0.882 0.540 3e-92
356551765364 PREDICTED: uncharacterized protein LOC10 0.968 0.843 0.536 2e-91
>gi|449436954|ref|XP_004136257.1| PREDICTED: uncharacterized protein LOC101205646 [Cucumis sativus] gi|449528621|ref|XP_004171302.1| PREDICTED: uncharacterized protein LOC101228826 [Cucumis sativus] Back     alignment and taxonomy information
 Score =  409 bits (1050), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 204/338 (60%), Positives = 244/338 (72%), Gaps = 31/338 (9%)

Query: 4   NSNRAEAERLLGVAEKLLNQRDLNGSKEFAILAQETEPLLEGSDQILAVVDVLLAAEKRV 63
           NSNR EAERLLG+AEKLL+ RD  GSK+FAILAQETEPLL+GSDQILAV DVLLA+EK++
Sbjct: 3   NSNRVEAERLLGIAEKLLHNRDFTGSKDFAILAQETEPLLDGSDQILAVADVLLASEKQI 62

Query: 64  NNHHDWYSILQIDRRTDDQDLIKKQYRKLALLLHPDKNKYPFADQAFTLVVDAWGVLSDT 123
           NNH+DWYSILQI+RR+DD DLIKKQYRKLALLLHPDKNK+PFADQAF LV D+W VLSD 
Sbjct: 63  NNHNDWYSILQIERRSDDSDLIKKQYRKLALLLHPDKNKFPFADQAFKLVADSWAVLSDN 122

Query: 124 RKKTPYDHELSLFTKIDLTTHSDSMHQSNKLPVRRSQRPSSNTKR------PSNARGVDG 177
            KK+ YD+EL+L+ KIDL+      HQ +KLPVRRSQR     ++       +NA     
Sbjct: 123 TKKSLYDNELNLYAKIDLS------HQ-DKLPVRRSQRSGGKKQQEFESNDSANADDDQS 175

Query: 178 EDQRARLSSFWTACPYCYILYEYPRVYENCCLRCENCKRGFHAALVPNLPPLVSGKDAYY 237
            +QR +L SFWTACPYCY+L+EYPRVYE CCLRC+NCKR F A L+P+LPPLV G++AYY
Sbjct: 176 PNQRLKLLSFWTACPYCYVLFEYPRVYEGCCLRCQNCKRAFQAVLLPSLPPLVQGQEAYY 235

Query: 238 CCWGFFPLGFVAGNSENGGL------PTSGFPNWMPPLFTGG---GGGGGDAGA------ 282
           CCWGFFP+GF A ++E  G       PT+ FPNWMPP+F+         G+  A      
Sbjct: 236 CCWGFFPMGFAAQHNEKSGKGSETAPPTTSFPNWMPPIFSNKPQETSRNGETAAPVAAEP 295

Query: 283 ---GAGGADVEGRAKVDGNVERVATGAKKRGRPRKNPL 317
              G  G  V+    V   + R     KKRGRPRKNP+
Sbjct: 296 TRTGREGVVVDAPPIVRAPIVRGTGTGKKRGRPRKNPI 333

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255545956|ref|XP_002514038.1| dnajc14 protein, putative [Ricinus communis] gi|223547124|gb|EEF48621.1| dnajc14 protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|116268421|gb|ABJ96378.1| hypothetical protein [Prunus persica] Back     alignment and taxonomy information
>gi|225459101|ref|XP_002283863.1| PREDICTED: uncharacterized protein LOC100260770 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224084558|ref|XP_002307337.1| predicted protein [Populus trichocarpa] gi|222856786|gb|EEE94333.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224067076|ref|XP_002302343.1| predicted protein [Populus trichocarpa] gi|222844069|gb|EEE81616.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|302142058|emb|CBI19261.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356498846|ref|XP_003518259.1| PREDICTED: uncharacterized protein LOC100816918 [Glycine max] Back     alignment and taxonomy information
>gi|357489993|ref|XP_003615284.1| Curved DNA-binding protein [Medicago truncatula] gi|355516619|gb|AES98242.1| Curved DNA-binding protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356551765|ref|XP_003544244.1| PREDICTED: uncharacterized protein LOC100783370 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query317
TAIR|locus:2065393311 AT2G01710 "AT2G01710" [Arabido 0.441 0.450 0.698 5.7e-86
TAIR|locus:2015529 797 AT1G62970 [Arabidopsis thalian 0.561 0.223 0.390 2.4e-51
TAIR|locus:2173443 464 EIP9 "EMF1-Interacting Protein 0.788 0.538 0.419 2.8e-50
TAIR|locus:2144726280 AT5G09540 [Arabidopsis thalian 0.463 0.525 0.46 9.7e-46
TAIR|locus:2169170 431 AT5G37380 [Arabidopsis thalian 0.514 0.378 0.401 2.8e-40
TAIR|locus:2122950 558 AT4G19570 [Arabidopsis thalian 0.504 0.286 0.385 1.2e-32
TAIR|locus:2081046 673 AT3G06340 [Arabidopsis thalian 0.731 0.344 0.352 1.1e-27
TAIR|locus:2181261 1104 AT5G27240 [Arabidopsis thalian 0.419 0.120 0.432 1.4e-26
TAIR|locus:2040110 656 AT2G25560 [Arabidopsis thalian 0.694 0.335 0.329 2.6e-26
TAIR|locus:2051244 706 AT2G05230 [Arabidopsis thalian 0.630 0.283 0.334 1.3e-24
TAIR|locus:2065393 AT2G01710 "AT2G01710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 495 (179.3 bits), Expect = 5.7e-86, Sum P(2) = 5.7e-86
 Identities = 102/146 (69%), Positives = 119/146 (81%)

Query:     4 NSNRAEAERLLGVAEKLLNQRDLNGSKEFAILAQETEPLLEGSDQILAVVDVLL--AAEK 61
             N NR+EAERLLG+AEKLL  RDLNGSKEFAILAQETEPLLEG+DQILAVVDVLL  A E 
Sbjct:     5 NPNRSEAERLLGIAEKLLESRDLNGSKEFAILAQETEPLLEGTDQILAVVDVLLSSAPEN 64

Query:    62 RVNNHHDWYSILQIDRRTD---DQDLIKKQYRKLALLLHPDKNKYPFADQAFTLVVDAWG 118
             R+ N  +WY ILQI+  T+   D DLIKKQYR+LALLLHPDKN++PFADQAF  V+DAW 
Sbjct:    65 RIKNQPNWYKILQIEDLTESSTDNDLIKKQYRRLALLLHPDKNRFPFADQAFRFVLDAWE 124

Query:   119 VLSDTRKKTPYDHELSL-FTKIDLTT 143
             VLS   KK+ +D +L+L FTK++L T
Sbjct:   125 VLSTPTKKSQFDGDLNLIFTKVNLNT 150
GO:0005575 "cellular_component" evidence=ND
GO:0006457 "protein folding" evidence=IEA;ISS
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
GO:0007067 "mitosis" evidence=RCA
TAIR|locus:2015529 AT1G62970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2173443 EIP9 "EMF1-Interacting Protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144726 AT5G09540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169170 AT5G37380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122950 AT4G19570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081046 AT3G06340 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181261 AT5G27240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040110 AT2G25560 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2051244 AT2G05230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query317
pfam0022663 pfam00226, DnaJ, DnaJ domain 1e-18
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 1e-17
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 1e-15
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 6e-13
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 7e-13
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 8e-12
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 9e-12
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 2e-11
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 2e-11
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 2e-10
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 6e-10
PRK10266306 PRK10266, PRK10266, curved DNA-binding protein Cbp 1e-09
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 1e-09
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 2e-09
PRK14288 369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 2e-09
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 4e-09
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 1e-08
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 1e-08
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 2e-08
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 3e-08
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 3e-08
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 3e-08
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 5e-08
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 5e-08
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 6e-08
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 6e-08
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 7e-08
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 8e-08
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 1e-07
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 5e-07
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 6e-07
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 1e-06
PRK14286 372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 6e-06
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 2e-05
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 2e-05
PRK14300 372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 7e-05
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information 
 Score = 78.0 bits (193), Expect = 1e-18
 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 2/64 (3%)

Query: 68  DWYSILQIDRRTDDQDLIKKQYRKLALLLHPDKNKY-PFADQAFTLVVDAWGVLSDTRKK 126
           D+Y IL + R   D++ IKK YRKLAL  HPDKN   P A++ F  + +A+ VLSD  K+
Sbjct: 1   DYYEILGVPRDASDEE-IKKAYRKLALKYHPDKNPGDPAAEEKFKEINEAYEVLSDPEKR 59

Query: 127 TPYD 130
             YD
Sbjct: 60  AIYD 63

DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. Length = 63
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 317
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 99.97
PRK14288 369 chaperone protein DnaJ; Provisional 99.93
PRK14296 372 chaperone protein DnaJ; Provisional 99.92
PRK14286 372 chaperone protein DnaJ; Provisional 99.91
PRK14298 377 chaperone protein DnaJ; Provisional 99.91
PRK14279 392 chaperone protein DnaJ; Provisional 99.91
PRK14287 371 chaperone protein DnaJ; Provisional 99.91
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.9
PRK14285 365 chaperone protein DnaJ; Provisional 99.9
PRK14278 378 chaperone protein DnaJ; Provisional 99.9
PRK14276 380 chaperone protein DnaJ; Provisional 99.9
PRK14282 369 chaperone protein DnaJ; Provisional 99.89
PRK14284 391 chaperone protein DnaJ; Provisional 99.89
PRK14280 376 chaperone protein DnaJ; Provisional 99.89
PRK14301 373 chaperone protein DnaJ; Provisional 99.89
KOG0712 337 consensus Molecular chaperone (DnaJ superfamily) [ 99.89
PRK14295 389 chaperone protein DnaJ; Provisional 99.89
PRK14291 382 chaperone protein DnaJ; Provisional 99.88
PRK14294 366 chaperone protein DnaJ; Provisional 99.88
PRK14297 380 chaperone protein DnaJ; Provisional 99.88
PRK10767 371 chaperone protein DnaJ; Provisional 99.88
PRK14277 386 chaperone protein DnaJ; Provisional 99.88
PRK14300 372 chaperone protein DnaJ; Provisional 99.88
PRK14283 378 chaperone protein DnaJ; Provisional 99.88
PRK14281 397 chaperone protein DnaJ; Provisional 99.87
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 99.87
PRK14290 365 chaperone protein DnaJ; Provisional 99.86
PRK14292 371 chaperone protein DnaJ; Provisional 99.86
PRK14293 374 chaperone protein DnaJ; Provisional 99.85
PRK14289 386 chaperone protein DnaJ; Provisional 99.84
KOG0713336 consensus Molecular chaperone (DnaJ superfamily) [ 99.81
PRK14299291 chaperone protein DnaJ; Provisional 99.8
KOG0715288 consensus Molecular chaperone (DnaJ superfamily) [ 99.78
PRK10266306 curved DNA-binding protein CbpA; Provisional 99.76
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.71
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.68
KOG0716279 consensus Molecular chaperone (DnaJ superfamily) [ 99.65
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.6
KOG0691296 consensus Molecular chaperone (DnaJ superfamily) [ 99.6
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.58
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.57
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.56
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.56
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.54
KOG0719264 consensus Molecular chaperone (DnaJ superfamily) [ 99.53
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.49
KOG0720490 consensus Molecular chaperone (DnaJ superfamily) [ 99.48
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.47
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.46
PRK05014171 hscB co-chaperone HscB; Provisional 99.38
PRK01356166 hscB co-chaperone HscB; Provisional 99.35
PHA03102153 Small T antigen; Reviewed 99.35
PRK00294173 hscB co-chaperone HscB; Provisional 99.33
PRK03578176 hscB co-chaperone HscB; Provisional 99.31
KOG0722329 consensus Molecular chaperone (DnaJ superfamily) [ 99.26
KOG0714306 consensus Molecular chaperone (DnaJ superfamily) [ 99.21
PTZ00100116 DnaJ chaperone protein; Provisional 99.13
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.1
PRK01773173 hscB co-chaperone HscB; Provisional 99.01
PHA02624 647 large T antigen; Provisional 98.96
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 98.92
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 98.9
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 98.79
COG5269379 ZUO1 Ribosome-associated chaperone zuotin [Transla 98.52
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.31
KOG0568342 consensus Molecular chaperone (DnaJ superfamily) [ 97.98
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 97.64
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 97.4
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.35
KOG0431453 consensus Auxilin-like protein and related protein 96.14
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 94.69
PF0217813 AT_hook: AT hook motif; InterPro: IPR017956 AT hoo 94.58
smart0038426 AT_hook DNA binding domain with preference for A/T 94.48
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 93.61
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 93.46
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 92.74
PF1342844 TPR_14: Tetratricopeptide repeat 90.25
PF1371937 zinc_ribbon_5: zinc-ribbon domain 90.14
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 89.88
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 89.39
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 88.8
KOG0553304 consensus TPR repeat-containing protein [General f 87.08
PF1371736 zinc_ribbon_4: zinc-ribbon domain 86.62
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 86.21
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 84.99
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 83.39
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 80.46
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.97  E-value=3.3e-32  Score=263.42  Aligned_cols=165  Identities=27%  Similarity=0.376  Sum_probs=131.2

Q ss_pred             ccCceeeeecccCCCCHHHHHHHHHHHHHHhCCCCCC-cchHHHHHHHHHHHHHHhcCCCCcchhccccCc-cccC----
Q 021106           66 HHDWYSILQIDRRTDDQDLIKKQYRKLALLLHPDKNK-YPFADQAFTLVVDAWGVLSDTRKKTPYDHELSL-FTKI----  139 (317)
Q Consensus        66 ~~D~Y~VLgv~~~a~~~~eIkkaYr~La~~~HPDkn~-~~~A~~~f~~I~eAy~vLsDp~kR~~YD~~~~~-~~~~----  139 (317)
                      .+|||+||||+++| +.+|||+|||+||++||||+|+ +++|+++|++|+|||+|||||+||+.||+.... +...    
T Consensus         3 ~~dyYeiLGV~k~A-s~~EIKkAYRkLA~kyHPD~n~g~~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~~~gg~gg   81 (371)
T COG0484           3 KRDYYEILGVSKDA-SEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGFKAGGFGG   81 (371)
T ss_pred             ccchhhhcCCCCCC-CHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHhhccCccccccCCcCC
Confidence            46999999999998 7899999999999999999999 889999999999999999999999999987653 1111    


Q ss_pred             --------CCCcCCCcccCCCCCCCCCCCCCCCCCCCCCCCCCCCCcccccccc-cceecccCceeEEeecceecccccc
Q 021106          140 --------DLTTHSDSMHQSNKLPVRRSQRPSSNTKRPSNARGVDGEDQRARLS-SFWTACPYCYILYEYPRVYENCCLR  210 (317)
Q Consensus       140 --------~~~~~~~~~~~~~~~p~~~~~r~~~~~~~~~~~~~~~g~d~~~~~~-tFwtaC~gC~~~~ey~r~y~~~~l~  210 (317)
                              ++.++|+++|+++.+   ++++++.         ..++.|+.+.+. ||.++..+|.+.++|++     ...
T Consensus        82 ~g~~~fgg~~~DIF~~~FgGg~~---~~~~~~~---------~~rG~Dl~~~l~isleEa~~G~~~~i~~~~-----~~~  144 (371)
T COG0484          82 FGFGGFGGDFGDIFEDFFGGGGG---GRRRPNR---------PRRGADLRYNLEITLEEAVFGVKKEIRVTR-----SVT  144 (371)
T ss_pred             CCcCCCCCCHHHHHHHhhcCCCc---ccCCCCC---------cccCCceEEEEEeEhhhhccCceeeEecce-----eeE
Confidence                    133344555543222   1122222         236789999998 99999999999999998     689


Q ss_pred             cCCCCCCeeecc-cCCCCCccCCCCeeEecc--cceecccc
Q 021106          211 CENCKRGFHAAL-VPNLPPLVSGKDAYYCCW--GFFPLGFV  248 (317)
Q Consensus       211 C~~C~~~F~A~~-vp~~Pp~v~G~~~~~c~w--gffp~gf~  248 (317)
                      |.+|++++-.-. -|...+.|+|+++.....  |+|-+.-+
T Consensus       145 C~~C~GsGak~gt~~~tC~tC~G~G~v~~~~~~g~~~~~~~  185 (371)
T COG0484         145 CSTCHGSGAKPGTDPKTCPTCNGSGQVRTVQRTGFFSFQQT  185 (371)
T ss_pred             CCcCCCCCCCCCCCCCcCCCCCCcCeEEEEEeeeEEEEEEE
Confidence            999999964332 223457899999988888  99998887

>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02178 AT_hook: AT hook motif; InterPro: IPR017956 AT hooks are DNA-binding motifs with a preference for A/T rich regions Back     alignment and domain information
>smart00384 AT_hook DNA binding domain with preference for A/T rich regions Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query317
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 9e-11
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 6e-09
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 7e-08
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 7e-08
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 4e-07
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 5e-07
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 2e-06
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 4e-06
3lz8_A329 Structure Of A Putative Chaperone Dnaj From Klebsie 4e-06
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 8e-06
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 8e-06
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 1e-05
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 1e-05
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 1e-05
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 2e-05
2ys8_A90 Solution Structure Of The Dnaj-Like Domain From Hum 3e-05
1wjz_A94 Soluiotn Structure Of J-Domain Of Mouse Dnaj Like P 3e-05
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 5e-05
2l6l_A155 Solution Structure Of Human J-Protein Co-Chaperone, 2e-04
2qsa_A109 Crystal Structure Of J-Domain Of Dnaj Homolog Dnj-2 6e-04
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure 
Iteration: 1

 Score = 64.3 bits (155), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 40/64 (62%), Gaps = 1/64 (1%)
Query: 68  DWYSILQIDRRTDDQDLIKKQYRKLALLLHPDKNKYPFADQAFTLVVDAWGVLSDTRKKT 127
           D+Y IL + R   D+DL KK YR+LAL  HPDKN  P A +AF  +  A+ VLS+  K+ 
Sbjct: 8   DYYEILGVSRGASDEDL-KKAYRRLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKRK 66
Query: 128 PYDH 131
            YD 
Sbjct: 67  QYDQ 70
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|2YS8|A Chain A, Solution Structure Of The Dnaj-Like Domain From Human Ras- Associated Protein Rap1 Length = 90 Back     alignment and structure
>pdb|1WJZ|A Chain A, Soluiotn Structure Of J-Domain Of Mouse Dnaj Like Protein Length = 94 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|2L6L|A Chain A, Solution Structure Of Human J-Protein Co-Chaperone, Dph4 Length = 155 Back     alignment and structure
>pdb|2QSA|A Chain A, Crystal Structure Of J-Domain Of Dnaj Homolog Dnj-2 Precursor From C.Elegans Length = 109 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query317
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.88
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 99.82
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.78
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.77
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.77
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.77
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.76
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.76
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.75
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.75
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.74
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.74
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.74
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.74
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.73
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.71
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.71
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.71
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.69
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.63
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.62
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.61
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.61
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.61
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.6
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.59
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.56
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.56
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.56
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.55
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.51
2guz_A71 Mitochondrial import inner membrane translocase su 99.5
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.47
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.38
2guz_B65 Mitochondrial import inner membrane translocase su 98.5
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 97.04
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 95.18
1nlt_A 248 Protein YDJ1, mitochondrial protein import protein 94.73
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 92.54
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 90.76
2l6j_A111 TPR repeat-containing protein associated with HSP; 90.59
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 90.52
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 85.61
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 85.53
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 85.38
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 84.1
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 83.59
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 83.16
2js4_A70 UPF0434 protein BB2007; NESG, northeast structural 83.16
2hf1_A68 Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A 82.63
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 81.46
2jr6_A68 UPF0434 protein NMA0874; solution, structural geno 81.15
2pk7_A69 Uncharacterized protein; NESG, PLR1, putative tetr 80.86
2jny_A67 Uncharacterized BCR; structure, CGR1, NESG, struct 80.45
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 80.04
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
Probab=99.88  E-value=4.3e-24  Score=183.77  Aligned_cols=129  Identities=24%  Similarity=0.406  Sum_probs=97.3

Q ss_pred             ccCceeeeecccCCCCHHHHHHHHHHHHHHhCCCCCCcc-------hHHHHHHHHHHHHHHhcCCCCcchhccccCcccc
Q 021106           66 HHDWYSILQIDRRTDDQDLIKKQYRKLALLLHPDKNKYP-------FADQAFTLVVDAWGVLSDTRKKTPYDHELSLFTK  138 (317)
Q Consensus        66 ~~D~Y~VLgv~~~a~~~~eIkkaYr~La~~~HPDkn~~~-------~A~~~f~~I~eAy~vLsDp~kR~~YD~~~~~~~~  138 (317)
                      ..|||+||||++++ +.++||++||+|++++|||++...       .|.+.|++|++||++|+||.+|+.||..+.....
T Consensus         9 ~~~~y~iLgv~~~a-~~~eIk~aYr~l~~~~HPDk~~~~~~~~~~~~a~~~f~~i~~Ay~~L~dp~~R~~Yd~~~~~~~~   87 (155)
T 2l6l_A            9 KKDWYSILGADPSA-NISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWKILGNEETKREYDLQRCEDDL   87 (155)
T ss_dssp             CSHHHHHHTCCTTC-CHHHHHHHHHHHHHHHSCCCCCCCCTTHHHHHHHHHHHHHHHHHHHSSSHHHHCHHHHHHHHHHH
T ss_pred             CCChhHhcCCCCCC-CHHHHHHHHHHHHHHHCcCCCCCCCchhHHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHcchhhc
Confidence            46999999999998 789999999999999999999754       3678999999999999999999999987743110


Q ss_pred             CCCCcCCCcccCCCCCCCCCCCCCCCCCCCCCCCCCCCCcccccccccceecccCceeEEeecceecc--cccccCCCCC
Q 021106          139 IDLTTHSDSMHQSNKLPVRRSQRPSSNTKRPSNARGVDGEDQRARLSSFWTACPYCYILYEYPRVYEN--CCLRCENCKR  216 (317)
Q Consensus       139 ~~~~~~~~~~~~~~~~p~~~~~r~~~~~~~~~~~~~~~g~d~~~~~~tFwtaC~gC~~~~ey~r~y~~--~~l~C~~C~~  216 (317)
                      .........+.                       .  ...+......+||+.|+ |...|+|.+..++  ..+.|++|..
T Consensus        88 ~~~~~~~~~~~-----------------------~--~~m~~~e~~~~f~~~Cr-CG~~f~i~~~~l~~~~~v~C~sCSl  141 (155)
T 2l6l_A           88 RNVGPVDAQVY-----------------------L--EEMSWNEGDHSFYLSCR-CGGKYSVSKDEAEEVSLISCDTCSL  141 (155)
T ss_dssp             HTTCSSSEEEE-----------------------T--TTSEEETTTTEEEEECS-SSCEEEEETTHHHHCCEEECSSSSC
T ss_pred             cccccccceee-----------------------H--HHhccccCCcEEEEcCC-CCCeEEecHHHhCCCCEEECCCCce
Confidence            00000000000                       0  00001112348999998 9999999999887  8899999999


Q ss_pred             Ceeec
Q 021106          217 GFHAA  221 (317)
Q Consensus       217 ~F~A~  221 (317)
                      .|..+
T Consensus       142 ~~~v~  146 (155)
T 2l6l_A          142 IIELL  146 (155)
T ss_dssp             EEEEE
T ss_pred             EEEEE
Confidence            99664
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2js4_A UPF0434 protein BB2007; NESG, northeast structural genomics consortium, beta, PSI-2, protein structure initiative; NMR {Bordetella bronchiseptica RB50} Back     alignment and structure
>2hf1_A Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A biosynthes structural genomics, PSI-2, protein structure initiative; 1.90A {Chromobacterium violaceum} SCOP: b.171.1.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, structure initiative, northeast structural genomics consort NESG; NMR {Neisseria meningitidis} Back     alignment and structure
>2pk7_A Uncharacterized protein; NESG, PLR1, putative tetraacyldisaccharide-1-P 4-kinase, Q4K structural genomics, PSI-2; 2.20A {Pseudomonas fluorescens} SCOP: b.171.1.1 Back     alignment and structure
>2jny_A Uncharacterized BCR; structure, CGR1, NESG, structural genomics, PSI-2, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: b.171.1.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 317
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 2e-11
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 8e-10
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 3e-09
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 9e-09
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 1e-08
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 3e-08
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 3e-06
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 7e-06
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: HSC20 (HSCB), N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

 Score = 57.0 bits (137), Expect = 2e-11
 Identities = 14/73 (19%), Positives = 25/73 (34%), Gaps = 7/73 (9%)

Query: 68  DWYSILQIDRRTD-DQDLIKKQYRKLALLLHPDKNKYPFAD------QAFTLVVDAWGVL 120
           D++++  +  R   D   +  +++ L    HPDK             Q    +  AW  L
Sbjct: 2   DYFTLFGLPARYQLDTQALSLRFQDLQRQYHPDKFASGSQAEQLAAVQQSATINQAWQTL 61

Query: 121 SDTRKKTPYDHEL 133
                +  Y   L
Sbjct: 62  RHPLMRAEYLLSL 74
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query317
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.81
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.77
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.71
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.64
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.61
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.6
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.52
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 93.07
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 88.8
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 86.39
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 85.59
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 85.07
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 82.22
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 81.69
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.81  E-value=3.8e-21  Score=145.04  Aligned_cols=68  Identities=32%  Similarity=0.637  Sum_probs=62.9

Q ss_pred             ccCceeeeecccCCCCHHHHHHHHHHHHHHhCCCCCCc-chHHHHHHHHHHHHHHhcCCCCcchhccccC
Q 021106           66 HHDWYSILQIDRRTDDQDLIKKQYRKLALLLHPDKNKY-PFADQAFTLVVDAWGVLSDTRKKTPYDHELS  134 (317)
Q Consensus        66 ~~D~Y~VLgv~~~a~~~~eIkkaYr~La~~~HPDkn~~-~~A~~~f~~I~eAy~vLsDp~kR~~YD~~~~  134 (317)
                      .+|||+||||++++ +.++||++||+|++++|||++.. +.+++.|++|++||+||+||.+|..||+.+.
T Consensus         2 k~dyY~vLgv~~~A-s~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~   70 (75)
T d1xbla_           2 KQDYYEILGVSKTA-EEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGH   70 (75)
T ss_dssp             CCCTTTTTCCSSSC-CHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTT
T ss_pred             CCCHHHHcCCCCCc-CHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCc
Confidence            36999999999998 78999999999999999999974 6788899999999999999999999998763
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure