Citrus Sinensis ID: 021186
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 316 | ||||||
| 255547536 | 315 | Biotin carboxyl carrier protein subunit | 0.958 | 0.961 | 0.631 | 7e-86 | |
| 155967399 | 282 | biotin carboxyl carrier protein subunit | 0.765 | 0.858 | 0.606 | 7e-76 | |
| 307566894 | 285 | acetyl-CoA carboxylase BCCP subunit [Jat | 0.768 | 0.852 | 0.625 | 2e-75 | |
| 147860224 | 383 | hypothetical protein VITISV_040144 [Viti | 0.860 | 0.710 | 0.565 | 8e-75 | |
| 432278299 | 281 | biotin carboxyl carrier protein [Persea | 0.803 | 0.903 | 0.590 | 8e-75 | |
| 224144956 | 284 | predicted protein [Populus trichocarpa] | 0.822 | 0.915 | 0.590 | 3e-72 | |
| 388490766 | 279 | unknown [Lotus japonicus] | 0.772 | 0.874 | 0.529 | 1e-66 | |
| 359476751 | 286 | PREDICTED: biotin carboxyl carrier prote | 0.781 | 0.863 | 0.587 | 2e-65 | |
| 297735247 | 280 | unnamed protein product [Vitis vinifera] | 0.759 | 0.857 | 0.578 | 2e-64 | |
| 15237339 | 280 | biotin carboxyl carrier protein of acety | 0.857 | 0.967 | 0.507 | 6e-64 |
| >gi|255547536|ref|XP_002514825.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1) [Ricinus communis] gi|223545876|gb|EEF47379.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1) [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 323 bits (827), Expect = 7e-86, Method: Compositional matrix adjust.
Identities = 207/328 (63%), Positives = 233/328 (71%), Gaps = 25/328 (7%)
Query: 1 MASSSLATGTPSASAFSKNSSSLVHY--YRNGTVFFRLSSSKPKLRFFAKTETVLRIQGS 58
MASS T + SASA K + +L HY Y V F LS KP RFF+ QG
Sbjct: 1 MASSLSTTPSASASAVVKTTPNLSHYSSYTLSRVSFPLSP-KPNFRFFS--------QGQ 51
Query: 59 QPSWKCATVVKSQLNEVSFFQWFSFEDIFSNFRSFLDSLLGTPVEFKVAFDGSSNASAT- 117
P ++ VK+QLNEV FFQWFS ED+FSNF LD LLG+ V KVA DGSSNA+A+
Sbjct: 52 HPGRNSSSSVKAQLNEVRFFQWFSLEDLFSNF---LDMLLGSSV-VKVAVDGSSNAAAST 107
Query: 118 ------PAAETKDAKQPNEPSPSILASEESISEFISQVSSLIKLVDSRDIVELQLKQLDC 171
P + KDA NE S L SEESISEFISQV+SL+KLVDSRDIVELQLKQLDC
Sbjct: 108 STKSEVPLQDPKDANPSNETSSPALVSEESISEFISQVASLVKLVDSRDIVELQLKQLDC 167
Query: 172 ELIIRKKEALPQPPAPASMAMMHSPSPPPVMPPTQPAPAPTSSAPSASPAPPASPPSSTA 231
ELIIRKKEALPQPP+PA + MMH PSP P P +P +S+ ++SPA A PPSS +
Sbjct: 168 ELIIRKKEALPQPPSPAPVVMMHPPSPTPPPLMPMPPTSPAASSTASSPASSAPPPSSPS 227
Query: 232 GKSV---KSSLPPLKCPMAGTFYRSPAPGEPPFVKVGDRVQKGQVLCIIEAMKLMNEIEA 288
+ KSS PPLK PMAGTFYRSPAPGEP FVKVGD+VQKGQVLCIIEAMKLMNEIEA
Sbjct: 228 PPATKSPKSSHPPLKSPMAGTFYRSPAPGEPHFVKVGDKVQKGQVLCIIEAMKLMNEIEA 287
Query: 289 DRSGTIVEIIAEDRKPVSVDTPLFVIEP 316
D+SGTIVE + ED KPVSVDTPLFVIEP
Sbjct: 288 DQSGTIVEALLEDGKPVSVDTPLFVIEP 315
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|155967399|gb|ABU41516.1| biotin carboxyl carrier protein subunit [Gossypium hirsutum] | Back alignment and taxonomy information |
|---|
| >gi|307566894|gb|ADN52613.1| acetyl-CoA carboxylase BCCP subunit [Jatropha curcas] | Back alignment and taxonomy information |
|---|
| >gi|147860224|emb|CAN80851.1| hypothetical protein VITISV_040144 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|432278299|gb|AGB07441.1| biotin carboxyl carrier protein [Persea americana] | Back alignment and taxonomy information |
|---|
| >gi|224144956|ref|XP_002325474.1| predicted protein [Populus trichocarpa] gi|222862349|gb|EEE99855.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|388490766|gb|AFK33449.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|359476751|ref|XP_002276955.2| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297735247|emb|CBI17609.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|15237339|ref|NP_197143.1| biotin carboxyl carrier protein of acetyl-CoA carboxylase 1 [Arabidopsis thaliana] gi|17380471|sp|Q42533.2|BCCP1_ARATH RecName: Full=Biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic; Short=AtBCCP1; Short=BCCP-1; Flags: Precursor gi|8886873|gb|AAF80594.1|AF236873_1 biotin carboxyl carrier protein isoform 1 [Arabidopsis thaliana] gi|9759121|dbj|BAB09606.1| biotin carboxyl carrier protein of acetyl-CoA carboxylase precursor [Arabidopsis thaliana] gi|15451074|gb|AAK96808.1| biotin carboxyl carrier protein of acetyl-CoA carboxylase precursor [Arabidopsis thaliana] gi|18377418|gb|AAL66875.1| biotin carboxyl carrier protein of acetyl-CoA carboxylase precursor [Arabidopsis thaliana] gi|21593442|gb|AAM65409.1| biotin carboxyl carrier protein of acetyl-CoA carboxylase precursor (BCCP) [Arabidopsis thaliana] gi|332004903|gb|AED92286.1| biotin carboxyl carrier protein of acetyl-CoA carboxylase 1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 316 | ||||||
| TAIR|locus:2171307 | 280 | CAC1 "chloroplastic acetylcoen | 0.256 | 0.289 | 0.802 | 1.1e-60 | |
| TAIR|locus:2180927 | 255 | BCCP2 "biotin carboxyl carrier | 0.253 | 0.313 | 0.837 | 6e-48 | |
| TIGR_CMR|GSU_2020 | 158 | GSU_2020 "acetyl-CoA carboxyla | 0.227 | 0.455 | 0.597 | 6.9e-23 | |
| TIGR_CMR|CHY_1999 | 617 | CHY_1999 "oxaloacetate decarbo | 0.224 | 0.115 | 0.619 | 2.3e-22 | |
| UNIPROTKB|P0ABD8 | 156 | accB [Escherichia coli K-12 (t | 0.234 | 0.474 | 0.540 | 2.5e-21 | |
| UNIPROTKB|Q9KV61 | 196 | VC_0296 "Acetyl-CoA carboxylas | 0.224 | 0.362 | 0.563 | 8.4e-21 | |
| TIGR_CMR|VC_0296 | 196 | VC_0296 "acetyl-CoA carboxylas | 0.224 | 0.362 | 0.563 | 8.4e-21 | |
| TIGR_CMR|CPS_0947 | 148 | CPS_0947 "acetyl-CoA carboxyla | 0.234 | 0.5 | 0.513 | 2.8e-20 | |
| TIGR_CMR|BA_4409 | 164 | BA_4409 "acetyl-CoA carboxylas | 0.262 | 0.506 | 0.476 | 3.6e-20 | |
| TIGR_CMR|CJE_1483 | 151 | CJE_1483 "acetyl-CoA carboxyla | 0.262 | 0.549 | 0.542 | 9.2e-20 |
| TAIR|locus:2171307 CAC1 "chloroplastic acetylcoenzyme A carboxylase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 362 (132.5 bits), Expect = 1.1e-60, Sum P(3) = 1.1e-60
Identities = 65/81 (80%), Positives = 77/81 (95%)
Query: 236 KSSLPPLKCPMAGTFYRSPAPGEPPFVKVGDRVQKGQVLCIIEAMKLMNEIEADRSGTIV 295
KSSLP +K PMAGTFYRSPAPGEPPF+KVGD+VQKGQVLCI+EAMKLMNEIE+D +GT+V
Sbjct: 200 KSSLPTVKSPMAGTFYRSPAPGEPPFIKVGDKVQKGQVLCIVEAMKLMNEIESDHTGTVV 259
Query: 296 EIIAEDRKPVSVDTPLFVIEP 316
+I+AED KPVS+DTPLFV++P
Sbjct: 260 DIVAEDGKPVSLDTPLFVVQP 280
|
|
| TAIR|locus:2180927 BCCP2 "biotin carboxyl carrier protein 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_2020 GSU_2020 "acetyl-CoA carboxylase, biotin carboxyl carrier protein" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_1999 CHY_1999 "oxaloacetate decarboxylase, alpha subunit" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0ABD8 accB [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KV61 VC_0296 "Acetyl-CoA carboxylase, biotin carboxyl carrier protein" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_0296 VC_0296 "acetyl-CoA carboxylase, biotin carboxyl carrier protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_0947 CPS_0947 "acetyl-CoA carboxylase, biotin carboxyl carrier protein" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_4409 BA_4409 "acetyl-CoA carboxylase, biotin carboxyl carrier protein" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CJE_1483 CJE_1483 "acetyl-CoA carboxylase, biotin carboxyl carrier protein" [Campylobacter jejuni RM1221 (taxid:195099)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| grail3.0095003402 | hypothetical protein (284 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| estExt_fgenesh4_pm.C_LG_VI0248 | • | • | • | • | 0.974 | ||||||
| grail3.0164004802 | • | • | • | • | 0.974 | ||||||
| estExt_fgenesh4_pg.C_LG_IX0832 | • | • | • | • | 0.928 | ||||||
| estExt_fgenesh4_pm.C_LG_II0424 | • | • | 0.914 | ||||||||
| eugene3.00050761 | • | • | 0.913 | ||||||||
| gw1.XIV.1152.1 | • | • | • | • | 0.901 | ||||||
| gw1.XIX.2128.1 | • | • | 0.900 | ||||||||
| estExt_Genewise1_v1.C_410201 | • | • | 0.900 | ||||||||
| gw1.V.3049.1 | • | 0.899 | |||||||||
| gw1.III.1824.1 | • | 0.899 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 316 | |||
| PLN02983 | 274 | PLN02983, PLN02983, biotin carboxyl carrier protei | 1e-98 | |
| PRK06302 | 155 | PRK06302, PRK06302, acetyl-CoA carboxylase biotin | 2e-52 | |
| TIGR00531 | 156 | TIGR00531, BCCP, acetyl-CoA carboxylase, biotin ca | 2e-40 | |
| COG0511 | 140 | COG0511, AccB, Biotin carboxyl carrier protein [Li | 5e-34 | |
| PRK09282 | 592 | PRK09282, PRK09282, pyruvate carboxylase subunit B | 2e-27 | |
| cd06850 | 67 | cd06850, biotinyl_domain, The biotinyl-domain or b | 9e-25 | |
| pfam00364 | 73 | pfam00364, Biotin_lipoyl, Biotin-requiring enzyme | 9e-24 | |
| PRK07051 | 80 | PRK07051, PRK07051, hypothetical protein; Validate | 5e-20 | |
| PRK06549 | 130 | PRK06549, PRK06549, acetyl-CoA carboxylase biotin | 2e-14 | |
| cd06663 | 73 | cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_ | 5e-14 | |
| PRK14040 | 593 | PRK14040, PRK14040, oxaloacetate decarboxylase; Pr | 6e-14 | |
| PRK05641 | 153 | PRK05641, PRK05641, putative acetyl-CoA carboxylas | 2e-12 | |
| cd06849 | 74 | cd06849, lipoyl_domain, Lipoyl domain of the dihyd | 6e-12 | |
| COG4770 | 645 | COG4770, COG4770, Acetyl/propionyl-CoA carboxylase | 1e-10 | |
| TIGR02712 | 1201 | TIGR02712, urea_carbox, urea carboxylase | 2e-09 | |
| PRK11856 | 411 | PRK11856, PRK11856, branched-chain alpha-keto acid | 2e-08 | |
| PRK11855 | 547 | PRK11855, PRK11855, dihydrolipoamide acetyltransfe | 2e-08 | |
| COG1038 | 1149 | COG1038, PycA, Pyruvate carboxylase [Energy produc | 9e-08 | |
| PRK12999 | 1146 | PRK12999, PRK12999, pyruvate carboxylase; Reviewed | 1e-07 | |
| TIGR01108 | 582 | TIGR01108, oadA, oxaloacetate decarboxylase alpha | 1e-07 | |
| COG0508 | 404 | COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogena | 2e-07 | |
| TIGR01235 | 1143 | TIGR01235, pyruv_carbox, pyruvate carboxylase | 2e-07 | |
| PRK08225 | 70 | PRK08225, PRK08225, acetyl-CoA carboxylase biotin | 5e-07 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 6e-06 | |
| PRK14875 | 371 | PRK14875, PRK14875, acetoin dehydrogenase E2 subun | 1e-05 | |
| PHA03201 | 318 | PHA03201, PHA03201, uracil DNA glycosylase; Provis | 5e-05 | |
| TIGR02927 | 579 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena | 8e-05 | |
| PRK05704 | 407 | PRK05704, PRK05704, dihydrolipoamide succinyltrans | 1e-04 | |
| TIGR01347 | 403 | TIGR01347, sucB, 2-oxoglutarate dehydrogenase comp | 2e-04 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 3e-04 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 3e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 3e-04 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 3e-04 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 4e-04 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 4e-04 | |
| PRK14042 | 596 | PRK14042, PRK14042, pyruvate carboxylase subunit B | 4e-04 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 4e-04 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 5e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 7e-04 | |
| COG5373 | 931 | COG5373, COG5373, Predicted membrane protein [Func | 7e-04 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 7e-04 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 8e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 9e-04 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 0.001 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 0.002 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 0.002 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 0.002 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 0.002 | |
| PRK11854 | 633 | PRK11854, aceF, pyruvate dehydrogenase dihydrolipo | 0.002 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 0.002 | |
| PRK11892 | 464 | PRK11892, PRK11892, pyruvate dehydrogenase subunit | 0.002 | |
| PRK00404 | 141 | PRK00404, tatB, sec-independent translocase; Provi | 0.002 | |
| pfam01597 | 122 | pfam01597, GCV_H, Glycine cleavage H-protein | 0.003 | |
| cd06848 | 96 | cd06848, GCS_H, Glycine cleavage H-protein | 0.003 | |
| pfam09606 | 768 | pfam09606, Med15, ARC105 or Med15 subunit of Media | 0.003 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 0.003 | |
| PRK09111 | 598 | PRK09111, PRK09111, DNA polymerase III subunits ga | 0.003 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 0.004 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 0.004 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 0.004 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 0.004 |
| >gnl|CDD|215533 PLN02983, PLN02983, biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
Score = 291 bits (746), Expect = 1e-98
Identities = 169/313 (53%), Positives = 193/313 (61%), Gaps = 40/313 (12%)
Query: 4 SSLATGTPSASAFSKNSSSLVHYYRNGTVFFRLSSSKPKLRFFAKTETVLRIQGSQPSWK 63
+SL+ +A + N S R FRL KP + F +K G P
Sbjct: 2 ASLSVPCAKTAAAAANVGS-----RLSRSSFRLQP-KPNISFPSK--------GPNPKRS 47
Query: 64 CATVVKSQLNEVSFFQWFSFEDIFSNFRSFLDSLLGTPVEFKVAFDGSSNASATPAAETK 123
VK+QLNEV+ D SN D S +E K
Sbjct: 48 AVPKVKAQLNEVAV-------DGSSNSAKSDDP-----------------KSEVAPSEPK 83
Query: 124 DAKQPNEPSPSILASEESISEFISQVSSLIKLVDSRDIVELQLKQLDCELIIRKKEALPQ 183
D N S L EESISEF++QVSSL+KLVDSRDIVELQLKQLDCEL+IRKKEALPQ
Sbjct: 84 DEPPSNSSSKPNLPDEESISEFMTQVSSLVKLVDSRDIVELQLKQLDCELVIRKKEALPQ 143
Query: 184 PPAPASMAMMHSPSPPPVMPPTQPAPAPTSSAPSASPAPPASPPSSTAGKSVKSSLPPLK 243
PP PA + MM P P + P + PA P SAP++SP P +P S K+ KSS PPLK
Sbjct: 144 PPPPAPVVMMQPPPPHAMPPASPPAAQPAPSAPASSPPP--TPASPPPAKAPKSSHPPLK 201
Query: 244 CPMAGTFYRSPAPGEPPFVKVGDRVQKGQVLCIIEAMKLMNEIEADRSGTIVEIIAEDRK 303
PMAGTFYRSPAPGEPPFVKVGD+VQKGQV+CIIEAMKLMNEIEAD+SGTIVEI+AED K
Sbjct: 202 SPMAGTFYRSPAPGEPPFVKVGDKVQKGQVVCIIEAMKLMNEIEADQSGTIVEILAEDGK 261
Query: 304 PVSVDTPLFVIEP 316
PVSVDTPLFVIEP
Sbjct: 262 PVSVDTPLFVIEP 274
|
Length = 274 |
| >gnl|CDD|235777 PRK06302, PRK06302, acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|188060 TIGR00531, BCCP, acetyl-CoA carboxylase, biotin carboxyl carrier protein | Back alignment and domain information |
|---|
| >gnl|CDD|223585 COG0511, AccB, Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|236449 PRK09282, PRK09282, pyruvate carboxylase subunit B; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|133459 cd06850, biotinyl_domain, The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >gnl|CDD|201182 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|180811 PRK07051, PRK07051, hypothetical protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235826 PRK06549, PRK06549, acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|133456 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >gnl|CDD|237592 PRK14040, PRK14040, oxaloacetate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235540 PRK05641, PRK05641, putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|133458 cd06849, lipoyl_domain, Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|227111 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233980 TIGR02712, urea_carbox, urea carboxylase | Back alignment and domain information |
|---|
| >gnl|CDD|237001 PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223968 COG1038, PycA, Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|237263 PRK12999, PRK12999, pyruvate carboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233273 TIGR01108, oadA, oxaloacetate decarboxylase alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|223582 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|130302 TIGR01235, pyruv_carbox, pyruvate carboxylase | Back alignment and domain information |
|---|
| >gnl|CDD|181304 PRK08225, PRK08225, acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184875 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165468 PHA03201, PHA03201, uracil DNA glycosylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|235571 PRK05704, PRK05704, dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233365 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172536 PRK14042, PRK14042, pyruvate carboxylase subunit B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|227665 COG5373, COG5373, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|166942 PRK00404, tatB, sec-independent translocase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|201881 pfam01597, GCV_H, Glycine cleavage H-protein | Back alignment and domain information |
|---|
| >gnl|CDD|133457 cd06848, GCS_H, Glycine cleavage H-protein | Back alignment and domain information |
|---|
| >gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 316 | |||
| PLN02983 | 274 | biotin carboxyl carrier protein of acetyl-CoA carb | 100.0 | |
| TIGR00531 | 156 | BCCP acetyl-CoA carboxylase, biotin carboxyl carri | 99.97 | |
| PRK06302 | 155 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 99.97 | |
| COG0511 | 140 | AccB Biotin carboxyl carrier protein [Lipid metabo | 99.94 | |
| PRK05889 | 71 | putative acetyl-CoA carboxylase biotin carboxyl ca | 99.67 | |
| PF00364 | 74 | Biotin_lipoyl: Biotin-requiring enzyme; InterPro: | 99.67 | |
| PRK07051 | 80 | hypothetical protein; Validated | 99.64 | |
| PRK08225 | 70 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 99.63 | |
| PRK06748 | 83 | hypothetical protein; Validated | 99.61 | |
| PRK06549 | 130 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 99.59 | |
| PRK05641 | 153 | putative acetyl-CoA carboxylase biotin carboxyl ca | 99.55 | |
| cd06850 | 67 | biotinyl_domain The biotinyl-domain or biotin carb | 99.51 | |
| PRK14042 | 596 | pyruvate carboxylase subunit B; Provisional | 99.41 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 99.35 | |
| PRK09282 | 592 | pyruvate carboxylase subunit B; Validated | 99.34 | |
| cd06663 | 73 | Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar | 99.32 | |
| TIGR01108 | 582 | oadA oxaloacetate decarboxylase alpha subunit. Thi | 99.3 | |
| PRK14040 | 593 | oxaloacetate decarboxylase; Provisional | 99.3 | |
| TIGR02712 | 1201 | urea_carbox urea carboxylase. Members of this fami | 99.29 | |
| PLN02226 | 463 | 2-oxoglutarate dehydrogenase E2 component | 99.28 | |
| TIGR01235 | 1143 | pyruv_carbox pyruvate carboxylase. This enzyme pla | 99.27 | |
| COG4770 | 645 | Acetyl/propionyl-CoA carboxylase, alpha subunit [L | 99.26 | |
| PRK12999 | 1146 | pyruvate carboxylase; Reviewed | 99.24 | |
| PTZ00144 | 418 | dihydrolipoamide succinyltransferase; Provisional | 99.23 | |
| COG0508 | 404 | AceF Pyruvate/2-oxoglutarate dehydrogenase complex | 99.17 | |
| COG1038 | 1149 | PycA Pyruvate carboxylase [Energy production and c | 99.17 | |
| PRK05704 | 407 | dihydrolipoamide succinyltransferase; Validated | 99.14 | |
| TIGR01347 | 403 | sucB 2-oxoglutarate dehydrogenase complex dihydrol | 99.07 | |
| TIGR02927 | 590 | SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo | 99.02 | |
| PRK11854 | 633 | aceF pyruvate dehydrogenase dihydrolipoyltransacet | 99.01 | |
| PRK11854 | 633 | aceF pyruvate dehydrogenase dihydrolipoyltransacet | 98.97 | |
| TIGR01348 | 546 | PDHac_trf_long pyruvate dehydrogenase complex dihy | 98.95 | |
| PRK11855 | 547 | dihydrolipoamide acetyltransferase; Reviewed | 98.91 | |
| cd06849 | 74 | lipoyl_domain Lipoyl domain of the dihydrolipoyl a | 98.9 | |
| PLN02528 | 416 | 2-oxoisovalerate dehydrogenase E2 component | 98.89 | |
| KOG0369 | 1176 | consensus Pyruvate carboxylase [Energy production | 98.88 | |
| KOG0559 | 457 | consensus Dihydrolipoamide succinyltransferase (2- | 98.87 | |
| TIGR01348 | 546 | PDHac_trf_long pyruvate dehydrogenase complex dihy | 98.81 | |
| PRK11856 | 411 | branched-chain alpha-keto acid dehydrogenase subun | 98.79 | |
| PRK11855 | 547 | dihydrolipoamide acetyltransferase; Reviewed | 98.78 | |
| PLN02744 | 539 | dihydrolipoyllysine-residue acetyltransferase comp | 98.75 | |
| TIGR01349 | 435 | PDHac_trf_mito pyruvate dehydrogenase complex dihy | 98.75 | |
| KOG0238 | 670 | consensus 3-Methylcrotonyl-CoA carboxylase, biotin | 98.67 | |
| KOG0557 | 470 | consensus Dihydrolipoamide acetyltransferase [Ener | 98.65 | |
| PRK11892 | 464 | pyruvate dehydrogenase subunit beta; Provisional | 98.65 | |
| TIGR02927 | 590 | SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo | 98.61 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 98.38 | |
| PRK09783 | 409 | copper/silver efflux system membrane fusion protei | 98.37 | |
| PRK01202 | 127 | glycine cleavage system protein H; Provisional | 98.33 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 98.28 | |
| cd06848 | 96 | GCS_H Glycine cleavage H-protein. Glycine cleavage | 98.25 | |
| TIGR01730 | 322 | RND_mfp RND family efflux transporter, MFP subunit | 98.2 | |
| PRK10559 | 310 | p-hydroxybenzoic acid efflux subunit AaeA; Provisi | 98.14 | |
| PRK15136 | 390 | multidrug efflux system protein EmrA; Provisional | 98.11 | |
| PRK09578 | 385 | periplasmic multidrug efflux lipoprotein precursor | 98.08 | |
| PRK03598 | 331 | putative efflux pump membrane fusion protein; Prov | 98.07 | |
| KOG0368 | 2196 | consensus Acetyl-CoA carboxylase [Lipid transport | 98.06 | |
| KOG0558 | 474 | consensus Dihydrolipoamide transacylase (alpha-ket | 98.03 | |
| TIGR03309 | 256 | matur_yqeB selenium-dependent molybdenum hydroxyla | 98.0 | |
| PRK09859 | 385 | multidrug efflux system protein MdtE; Provisional | 97.96 | |
| TIGR03077 | 110 | not_gcvH glycine cleavage protein H-like protein, | 97.93 | |
| PRK15030 | 397 | multidrug efflux system transporter AcrA; Provisio | 97.89 | |
| PRK13380 | 144 | glycine cleavage system protein H; Provisional | 97.86 | |
| TIGR00527 | 127 | gcvH glycine cleavage system H protein. The genome | 97.85 | |
| PRK11578 | 370 | macrolide transporter subunit MacA; Provisional | 97.83 | |
| PRK11556 | 415 | multidrug efflux system subunit MdtA; Provisional | 97.78 | |
| PRK00624 | 114 | glycine cleavage system protein H; Provisional | 97.77 | |
| PF12700 | 328 | HlyD_2: HlyD family secretion protein; PDB: 3LNN_B | 97.66 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 97.65 | |
| PF13533 | 50 | Biotin_lipoyl_2: Biotin-lipoyl like | 97.63 | |
| PF13533 | 50 | Biotin_lipoyl_2: Biotin-lipoyl like | 97.52 | |
| cd06253 | 298 | M14_ASTE_ASPA_like_3 A functionally uncharacterize | 97.45 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 97.42 | |
| PRK12784 | 84 | hypothetical protein; Provisional | 97.41 | |
| cd06251 | 287 | M14_ASTE_ASPA_like_1 A functionally uncharacterize | 97.31 | |
| cd06252 | 316 | M14_ASTE_ASPA_like_2 A functionally uncharacterize | 97.24 | |
| TIGR02994 | 325 | ectoine_eutE ectoine utilization protein EutE. Mem | 97.11 | |
| cd06250 | 359 | M14_PaAOTO_like An uncharacterized subgroup of the | 97.08 | |
| PRK05889 | 71 | putative acetyl-CoA carboxylase biotin carboxyl ca | 97.06 | |
| PF01597 | 122 | GCV_H: Glycine cleavage H-protein; InterPro: IPR00 | 96.98 | |
| PF13375 | 101 | RnfC_N: RnfC Barrel sandwich hybrid domain | 96.9 | |
| COG0509 | 131 | GcvH Glycine cleavage system H protein (lipoate-bi | 96.86 | |
| cd06254 | 288 | M14_ASTE_ASPA_like_4 A functionally uncharacterize | 96.77 | |
| PRK06748 | 83 | hypothetical protein; Validated | 96.68 | |
| PRK08225 | 70 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 96.62 | |
| cd06850 | 67 | biotinyl_domain The biotinyl-domain or biotin carb | 96.4 | |
| COG1566 | 352 | EmrA Multidrug resistance efflux pump [Defense mec | 96.2 | |
| COG3608 | 331 | Predicted deacylase [General function prediction o | 96.14 | |
| PRK09439 | 169 | PTS system glucose-specific transporter subunit; P | 95.92 | |
| cd06255 | 293 | M14_ASTE_ASPA_like_5 A functionally uncharacterize | 95.91 | |
| COG0511 | 140 | AccB Biotin carboxyl carrier protein [Lipid metabo | 95.83 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 95.59 | |
| cd00210 | 124 | PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose s | 95.52 | |
| PRK06549 | 130 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 95.51 | |
| TIGR00830 | 121 | PTBA PTS system, glucose subfamily, IIA component. | 95.44 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 95.32 | |
| PF00364 | 74 | Biotin_lipoyl: Biotin-requiring enzyme; InterPro: | 95.32 | |
| PRK07051 | 80 | hypothetical protein; Validated | 95.23 | |
| PRK05641 | 153 | putative acetyl-CoA carboxylase biotin carboxyl ca | 95.11 | |
| PF00358 | 132 | PTS_EIIA_1: phosphoenolpyruvate-dependent sugar ph | 95.03 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 94.93 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 94.92 | |
| PRK15136 | 390 | multidrug efflux system protein EmrA; Provisional | 94.81 | |
| PF04952 | 292 | AstE_AspA: Succinylglutamate desuccinylase / Aspar | 94.81 | |
| PRK09859 | 385 | multidrug efflux system protein MdtE; Provisional | 94.78 | |
| PRK03598 | 331 | putative efflux pump membrane fusion protein; Prov | 94.7 | |
| PRK11578 | 370 | macrolide transporter subunit MacA; Provisional | 94.67 | |
| PRK09578 | 385 | periplasmic multidrug efflux lipoprotein precursor | 94.61 | |
| PRK11556 | 415 | multidrug efflux system subunit MdtA; Provisional | 94.6 | |
| PF09891 | 150 | DUF2118: Uncharacterized protein conserved in arch | 94.5 | |
| TIGR01936 | 447 | nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo | 94.49 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 94.48 | |
| PF13437 | 105 | HlyD_3: HlyD family secretion protein | 94.47 | |
| COG2190 | 156 | NagE Phosphotransferase system IIA components [Car | 94.43 | |
| PF00529 | 305 | HlyD: HlyD family secretion protein the correspond | 94.31 | |
| PRK15030 | 397 | multidrug efflux system transporter AcrA; Provisio | 94.16 | |
| TIGR01235 | 1143 | pyruv_carbox pyruvate carboxylase. This enzyme pla | 94.15 | |
| TIGR01945 | 435 | rnfC electron transport complex, RnfABCDGE type, C | 94.12 | |
| COG1566 | 352 | EmrA Multidrug resistance efflux pump [Defense mec | 93.89 | |
| PRK10559 | 310 | p-hydroxybenzoic acid efflux subunit AaeA; Provisi | 93.89 | |
| PRK05352 | 448 | Na(+)-translocating NADH-quinone reductase subunit | 93.75 | |
| TIGR00999 | 265 | 8a0102 Membrane Fusion Protein cluster 2 (function | 93.63 | |
| PF05896 | 257 | NQRA: Na(+)-translocating NADH-quinone reductase s | 93.45 | |
| PRK10255 | 648 | PTS system N-acetyl glucosamine specific transport | 93.38 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 92.85 | |
| PRK09824 | 627 | PTS system beta-glucoside-specific transporter sub | 92.83 | |
| PRK05035 | 695 | electron transport complex protein RnfC; Provision | 92.65 | |
| TIGR01995 | 610 | PTS-II-ABC-beta PTS system, beta-glucoside-specifi | 92.55 | |
| PRK09783 | 409 | copper/silver efflux system membrane fusion protei | 92.29 | |
| COG4656 | 529 | RnfC Predicted NADH:ubiquinone oxidoreductase, sub | 92.28 | |
| COG0845 | 372 | AcrA Membrane-fusion protein [Cell envelope biogen | 92.17 | |
| KOG3373 | 172 | consensus Glycine cleavage system H protein (lipoa | 91.98 | |
| PF06898 | 385 | YqfD: Putative stage IV sporulation protein YqfD; | 91.9 | |
| PRK14042 | 596 | pyruvate carboxylase subunit B; Provisional | 91.22 | |
| PRK05305 | 206 | phosphatidylserine decarboxylase; Provisional | 90.7 | |
| TIGR00164 | 189 | PS_decarb_rel phosphatidylserine decarboxylase pre | 90.47 | |
| TIGR00531 | 156 | BCCP acetyl-CoA carboxylase, biotin carboxyl carri | 90.3 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 90.07 | |
| PLN02983 | 274 | biotin carboxyl carrier protein of acetyl-CoA carb | 90.01 | |
| TIGR02876 | 382 | spore_yqfD sporulation protein YqfD. YqfD is part | 89.95 | |
| PRK06302 | 155 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 89.75 | |
| PRK14040 | 593 | oxaloacetate decarboxylase; Provisional | 89.56 | |
| TIGR01108 | 582 | oadA oxaloacetate decarboxylase alpha subunit. Thi | 89.44 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 89.01 | |
| PRK09282 | 592 | pyruvate carboxylase subunit B; Validated | 88.57 | |
| COG1726 | 447 | NqrA Na+-transporting NADH:ubiquinone oxidoreducta | 87.96 | |
| cd06663 | 73 | Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar | 87.89 | |
| PF07831 | 75 | PYNP_C: Pyrimidine nucleoside phosphorylase C-term | 87.39 | |
| PLN02226 | 463 | 2-oxoglutarate dehydrogenase E2 component | 87.3 | |
| COG4770 | 645 | Acetyl/propionyl-CoA carboxylase, alpha subunit [L | 86.31 | |
| COG4072 | 161 | Uncharacterized protein conserved in archaea [Func | 85.98 | |
| PF02666 | 202 | PS_Dcarbxylase: Phosphatidylserine decarboxylase; | 85.47 | |
| TIGR02712 | 1201 | urea_carbox urea carboxylase. Members of this fami | 85.28 | |
| cd06849 | 74 | lipoyl_domain Lipoyl domain of the dihydrolipoyl a | 84.61 | |
| PTZ00144 | 418 | dihydrolipoamide succinyltransferase; Provisional | 84.52 | |
| COG0845 | 372 | AcrA Membrane-fusion protein [Cell envelope biogen | 83.96 | |
| KOG0559 | 457 | consensus Dihydrolipoamide succinyltransferase (2- | 83.01 | |
| PRK12999 | 1146 | pyruvate carboxylase; Reviewed | 82.84 | |
| COG1038 | 1149 | PycA Pyruvate carboxylase [Energy production and c | 82.76 | |
| PRK09439 | 169 | PTS system glucose-specific transporter subunit; P | 81.98 | |
| TIGR01730 | 322 | RND_mfp RND family efflux transporter, MFP subunit | 81.11 | |
| TIGR00999 | 265 | 8a0102 Membrane Fusion Protein cluster 2 (function | 80.88 | |
| PRK05704 | 407 | dihydrolipoamide succinyltransferase; Validated | 80.83 | |
| COG2190 | 156 | NagE Phosphotransferase system IIA components [Car | 80.54 | |
| PRK14844 | 2836 | bifunctional DNA-directed RNA polymerase subunit b | 80.17 |
| >PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.6e-50 Score=374.98 Aligned_cols=267 Identities=62% Similarity=0.935 Sum_probs=216.1
Q ss_pred CCCCCCCCCCCccccccccCCcccceeecceEEEEecCCCCCceeeeechhhhhhcCCCCCCcccceEeeeccccccccc
Q 021186 1 MASSSLATGTPSASAFSKNSSSLVHYYRNGTVFFRLSSSKPKLRFFAKTETVLRIQGSQPSWKCATVVKSQLNEVSFFQW 80 (316)
Q Consensus 1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 80 (316)
|||++.++... +.++++.. +++++++||++ +||+|||++| |+++++..+++|||||||
T Consensus 1 mas~~~~~~~~--~~~~~~~~-----~~~~~~~~~~~-~~~~~~f~~~--------~~~~~~~~~~~~~a~~ne------ 58 (274)
T PLN02983 1 MASLSVPCAKT--AAAAANVG-----SRLSRSSFRLQ-PKPNISFPSK--------GPNPKRSAVPKVKAQLNE------ 58 (274)
T ss_pred CCccccCcccc--eeeccccc-----ccccccccccC-CCCCcccccC--------CCCcccceeeeEEeeece------
Confidence 78876555433 33444333 45568899999 9999999999 899999999999999999
Q ss_pred cchhhhhcchhhhcccccCCCceeEEEecCCCCCCCCCc-------cccccCCCCCCCCCCCccccchhcccHHHHHHHH
Q 021186 81 FSFEDIFSNFRSFLDSLLGTPVEFKVAFDGSSNASATPA-------AETKDAKQPNEPSPSILASEESISEFISQVSSLI 153 (316)
Q Consensus 81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~~~~~~~~~~i~qI~eLI 153 (316)
|+++||||++++.. .+++|.+.+++++++.++++++|+.|+.|+..|+
T Consensus 59 -------------------------~~~~~~sn~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~is~f~~qv~~lv 113 (274)
T PLN02983 59 -------------------------VAVDGSSNSAKSDDPKSEVAPSEPKDEPPSNSSSKPNLPDEESISEFMTQVSSLV 113 (274)
T ss_pred -------------------------eeeccccccccccCCcccccccccccccccccCCCcccCCHHHHHHHHHHHHHHH
Confidence 99999999998843 5788889999999999999999999999999999
Q ss_pred HHHhhCCCcEEEEEeCCeEEEEEecCCCCCCCCCccccccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q 021186 154 KLVDSRDIVELQLKQLDCELIIRKKEALPQPPAPASMAMMHSPSPPPVMPPTQPAPAPTSSAPSASPAPPASPPSSTAGK 233 (316)
Q Consensus 154 klld~S~IsELeLk~~d~~L~LrK~~~~~~~~~~a~~~~~~sp~~~~~a~~a~~~pa~a~~apaas~a~p~s~~~~~a~~ 233 (316)
|++|.+||.||+||+.||+|.|||+++.+++++++++++|+.+.+...++.++ ++...+.+.+..+.+...+.+.+.+
T Consensus 114 ~lv~~~di~e~~lk~~~~e~~irkkeal~~~~~~~~~~~~~~~~~~~~~p~~~--~~~~~~~~~~~~~~~~~~~~~~~~~ 191 (274)
T PLN02983 114 KLVDSRDIVELQLKQLDCELVIRKKEALPQPPPPAPVVMMQPPPPHAMPPASP--PAAQPAPSAPASSPPPTPASPPPAK 191 (274)
T ss_pred hhhccccceeeeccccceEEEEecccccCCCCCCCceEEecCCCcccCCCCCC--cccCCCCCCCCCCCCCCCCCCCCCC
Confidence 99999999999999999999999999887766666666666654433332221 1110010011011111112233345
Q ss_pred CCCCCCCCccCCcCeEEEcCCCCCCCCCccCCCEEecCCeEEEEEecceeeEEecCCCeEEEEEecCCCCccCCCCeEEE
Q 021186 234 SVKSSLPPLKCPMAGTFYRSPAPGEPPFVKVGDRVQKGQVLCIIEAMKLMNEIEADRSGTIVEIIAEDRKPVSVDTPLFV 313 (316)
Q Consensus 234 ~~~~~~~~V~APmvGtf~~sp~p~~~~~VkvGD~VkkGqvL~iIEamK~~~eI~Ap~sGtV~eIlVe~Gd~V~~GqpL~~ 313 (316)
...++...|+|||.|+||+.|.++..|+|++||.|++||+||+||+||+.++|+|+++|+|++|++++||.|.+|++|++
T Consensus 192 ~~~s~~~~V~APmaGtf~r~p~pge~w~VkvGDsVkkGQvLavIEAMKmeieV~AP~sGtV~eIlVkeGD~V~vGqpL~~ 271 (274)
T PLN02983 192 APKSSHPPLKSPMAGTFYRSPAPGEPPFVKVGDKVQKGQVVCIIEAMKLMNEIEADQSGTIVEILAEDGKPVSVDTPLFV 271 (274)
T ss_pred CCcCCCCeEeCCcCeEEEeccCCCCcceeCCCCEecCCCEEEEEEeeceeeEEecCCCeEEEEEecCCCCEeCCCCEEEE
Confidence 56677789999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EcC
Q 021186 314 IEP 316 (316)
Q Consensus 314 IeP 316 (316)
|+|
T Consensus 272 IEP 274 (274)
T PLN02983 272 IEP 274 (274)
T ss_pred ecC
Confidence 987
|
|
| >TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein | Back alignment and domain information |
|---|
| >PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional | Back alignment and domain information |
|---|
| >PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid | Back alignment and domain information |
|---|
| >PRK07051 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK06748 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >PRK14042 pyruvate carboxylase subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09282 pyruvate carboxylase subunit B; Validated | Back alignment and domain information |
|---|
| >cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >TIGR01108 oadA oxaloacetate decarboxylase alpha subunit | Back alignment and domain information |
|---|
| >PRK14040 oxaloacetate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >TIGR02712 urea_carbox urea carboxylase | Back alignment and domain information |
|---|
| >PLN02226 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >TIGR01235 pyruv_carbox pyruvate carboxylase | Back alignment and domain information |
|---|
| >COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK12999 pyruvate carboxylase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00144 dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG1038 PycA Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK05704 dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR01347 sucB 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >PRK11855 dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases | Back alignment and domain information |
|---|
| >PLN02528 2-oxoisovalerate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >KOG0369 consensus Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0559 consensus Dihydrolipoamide succinyltransferase (2-oxoglutarate dehydrogenase, E2 subunit) [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed | Back alignment and domain information |
|---|
| >PRK11855 dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PLN02744 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex | Back alignment and domain information |
|---|
| >TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >KOG0238 consensus 3-Methylcrotonyl-CoA carboxylase, biotin-containing subunit/Propionyl-CoA carboxylase, alpha chain/Acetyl-CoA carboxylase, biotin carboxylase subunit [Lipid transport and metabolism; Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0557 consensus Dihydrolipoamide acetyltransferase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK11892 pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional | Back alignment and domain information |
|---|
| >PRK01202 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >cd06848 GCS_H Glycine cleavage H-protein | Back alignment and domain information |
|---|
| >TIGR01730 RND_mfp RND family efflux transporter, MFP subunit | Back alignment and domain information |
|---|
| >PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional | Back alignment and domain information |
|---|
| >PRK15136 multidrug efflux system protein EmrA; Provisional | Back alignment and domain information |
|---|
| >PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed | Back alignment and domain information |
|---|
| >PRK03598 putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >KOG0368 consensus Acetyl-CoA carboxylase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0558 consensus Dihydrolipoamide transacylase (alpha-keto acid dehydrogenase E2 subunit) [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03309 matur_yqeB selenium-dependent molybdenum hydroxylase system protein, YqeB family | Back alignment and domain information |
|---|
| >PRK09859 multidrug efflux system protein MdtE; Provisional | Back alignment and domain information |
|---|
| >TIGR03077 not_gcvH glycine cleavage protein H-like protein, Chlamydial | Back alignment and domain information |
|---|
| >PRK15030 multidrug efflux system transporter AcrA; Provisional | Back alignment and domain information |
|---|
| >PRK13380 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >TIGR00527 gcvH glycine cleavage system H protein | Back alignment and domain information |
|---|
| >PRK11578 macrolide transporter subunit MacA; Provisional | Back alignment and domain information |
|---|
| >PRK11556 multidrug efflux system subunit MdtA; Provisional | Back alignment and domain information |
|---|
| >PRK00624 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >PF12700 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >PF13533 Biotin_lipoyl_2: Biotin-lipoyl like | Back alignment and domain information |
|---|
| >PF13533 Biotin_lipoyl_2: Biotin-lipoyl like | Back alignment and domain information |
|---|
| >cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PRK12784 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >TIGR02994 ectoine_eutE ectoine utilization protein EutE | Back alignment and domain information |
|---|
| >cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional | Back alignment and domain information |
|---|
| >PF01597 GCV_H: Glycine cleavage H-protein; InterPro: IPR002930 This is a family of glycine cleavage H-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes | Back alignment and domain information |
|---|
| >PF13375 RnfC_N: RnfC Barrel sandwich hybrid domain | Back alignment and domain information |
|---|
| >COG0509 GcvH Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd06254 M14_ASTE_ASPA_like_4 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PRK06748 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG3608 Predicted deacylase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09439 PTS system glucose-specific transporter subunit; Provisional | Back alignment and domain information |
|---|
| >cd06255 M14_ASTE_ASPA_like_5 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >cd00210 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose specific IIA subunit | Back alignment and domain information |
|---|
| >PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >TIGR00830 PTBA PTS system, glucose subfamily, IIA component | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid | Back alignment and domain information |
|---|
| >PRK07051 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PF00358 PTS_EIIA_1: phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1; InterPro: IPR001127 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) [, ] is a major carbohydrate transport system in bacteria | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PRK15136 multidrug efflux system protein EmrA; Provisional | Back alignment and domain information |
|---|
| >PF04952 AstE_AspA: Succinylglutamate desuccinylase / Aspartoacylase family; InterPro: IPR007036 This family describes both succinylglutamate desuccinylase that catalyses the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway and also includes aspartoacylase 3 | Back alignment and domain information |
|---|
| >PRK09859 multidrug efflux system protein MdtE; Provisional | Back alignment and domain information |
|---|
| >PRK03598 putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK11578 macrolide transporter subunit MacA; Provisional | Back alignment and domain information |
|---|
| >PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed | Back alignment and domain information |
|---|
| >PRK11556 multidrug efflux system subunit MdtA; Provisional | Back alignment and domain information |
|---|
| >PF09891 DUF2118: Uncharacterized protein conserved in archaea (DUF2118); InterPro: IPR019217 This entry represents a family of hypothetical proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >PF13437 HlyD_3: HlyD family secretion protein | Back alignment and domain information |
|---|
| >COG2190 NagE Phosphotransferase system IIA components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF00529 HlyD: HlyD family secretion protein the corresponding Prosite entry | Back alignment and domain information |
|---|
| >PRK15030 multidrug efflux system transporter AcrA; Provisional | Back alignment and domain information |
|---|
| >TIGR01235 pyruv_carbox pyruvate carboxylase | Back alignment and domain information |
|---|
| >TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit | Back alignment and domain information |
|---|
| >COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional | Back alignment and domain information |
|---|
| >PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional | Back alignment and domain information |
|---|
| >TIGR00999 8a0102 Membrane Fusion Protein cluster 2 (function with RND porters) | Back alignment and domain information |
|---|
| >PF05896 NQRA: Na(+)-translocating NADH-quinone reductase subunit A (NQRA); InterPro: IPR008703 This family consists of several bacterial Na+-translocating NADH-quinone reductase subunit A (NQRA) proteins | Back alignment and domain information |
|---|
| >PRK10255 PTS system N-acetyl glucosamine specific transporter subunits IIABC; Provisional | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >PRK09824 PTS system beta-glucoside-specific transporter subunits IIABC; Provisional | Back alignment and domain information |
|---|
| >PRK05035 electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >TIGR01995 PTS-II-ABC-beta PTS system, beta-glucoside-specific IIABC component | Back alignment and domain information |
|---|
| >PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional | Back alignment and domain information |
|---|
| >COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG0845 AcrA Membrane-fusion protein [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG3373 consensus Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF06898 YqfD: Putative stage IV sporulation protein YqfD; InterPro: IPR010690 This family consists of several putative bacterial stage IV sporulation (SpoIV) proteins | Back alignment and domain information |
|---|
| >PRK14042 pyruvate carboxylase subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK05305 phosphatidylserine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >TIGR00164 PS_decarb_rel phosphatidylserine decarboxylase precursor-related protein | Back alignment and domain information |
|---|
| >TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
| >TIGR02876 spore_yqfD sporulation protein YqfD | Back alignment and domain information |
|---|
| >PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK14040 oxaloacetate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01108 oadA oxaloacetate decarboxylase alpha subunit | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PRK09282 pyruvate carboxylase subunit B; Validated | Back alignment and domain information |
|---|
| >COG1726 NqrA Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >PF07831 PYNP_C: Pyrimidine nucleoside phosphorylase C-terminal domain; InterPro: IPR013102 This domain is found at the C-terminal end of the large alpha/beta domain making up various pyrimidine nucleoside phosphorylases [, ] | Back alignment and domain information |
|---|
| >PLN02226 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >COG4072 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >PF02666 PS_Dcarbxylase: Phosphatidylserine decarboxylase; InterPro: IPR003817 Phosphatidylserine decarboxylase plays a pivotal role in the synthesis of phospholipid by the mitochondria | Back alignment and domain information |
|---|
| >TIGR02712 urea_carbox urea carboxylase | Back alignment and domain information |
|---|
| >cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases | Back alignment and domain information |
|---|
| >PTZ00144 dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0845 AcrA Membrane-fusion protein [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG0559 consensus Dihydrolipoamide succinyltransferase (2-oxoglutarate dehydrogenase, E2 subunit) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK12999 pyruvate carboxylase; Reviewed | Back alignment and domain information |
|---|
| >COG1038 PycA Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK09439 PTS system glucose-specific transporter subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01730 RND_mfp RND family efflux transporter, MFP subunit | Back alignment and domain information |
|---|
| >TIGR00999 8a0102 Membrane Fusion Protein cluster 2 (function with RND porters) | Back alignment and domain information |
|---|
| >PRK05704 dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >COG2190 NagE Phosphotransferase system IIA components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14844 bifunctional DNA-directed RNA polymerase subunit beta/beta'; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 316 | ||||
| 1a6x_A | 87 | Structure Of The Apo-Biotin Carboxyl Carrier Protei | 4e-19 | ||
| 3bdo_A | 82 | Solution Structure Of Apo-Biotinyl Domain From Acet | 4e-19 | ||
| 1bdo_A | 80 | Structure Of The Biotinyl Domain Of Acetyl-Coenzyme | 4e-19 | ||
| 3n6r_A | 681 | Crystal Structure Of The Holoenzyme Of Propionyl-co | 2e-06 | ||
| 2d5d_A | 74 | Structure Of Biotin Carboxyl Carrier Protein (74val | 6e-06 | ||
| 2jku_A | 94 | Crystal Structure Of The N-Terminal Region Of The B | 3e-05 | ||
| 1o78_A | 84 | Biotin Carboxyl Carrier Domain Of Transcarboxylase | 6e-04 | ||
| 1dcz_A | 77 | Biotin Carboxyl Carrier Domain Of Transcarboxylase | 7e-04 |
| >pdb|1A6X|A Chain A, Structure Of The Apo-Biotin Carboxyl Carrier Protein (Apo- Bccp87) Of Escherichia Coli Acetyl-Coa Carboxylase, Nmr, 49 Structures Length = 87 | Back alignment and structure |
|
| >pdb|3BDO|A Chain A, Solution Structure Of Apo-Biotinyl Domain From Acetyl Coenzyme A Carboxylase Of Escherichia Coli Determined By Triple-Resonance Nmr Spectroscopy Length = 82 | Back alignment and structure |
| >pdb|1BDO|A Chain A, Structure Of The Biotinyl Domain Of Acetyl-Coenzyme A Carboxylase Determined By Mad Phasing Length = 80 | Back alignment and structure |
| >pdb|3N6R|A Chain A, Crystal Structure Of The Holoenzyme Of Propionyl-coa Carboxylase (pcc) Length = 681 | Back alignment and structure |
| >pdb|2D5D|A Chain A, Structure Of Biotin Carboxyl Carrier Protein (74val Start) From Pyrococcus Horikoshi Ot3 Ligand Free Form Ii Length = 74 | Back alignment and structure |
| >pdb|2JKU|A Chain A, Crystal Structure Of The N-Terminal Region Of The Biotin Acceptor Domain Of Human Propionyl-Coa Carboxylase Length = 94 | Back alignment and structure |
| >pdb|1O78|A Chain A, Biotin Carboxyl Carrier Domain Of Transcarboxylase (1.3s) [10-48] Deletion Mutant Length = 84 | Back alignment and structure |
| >pdb|1DCZ|A Chain A, Biotin Carboxyl Carrier Domain Of Transcarboxylase (Tc 1.3s) Length = 77 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 316 | |||
| 1bdo_A | 80 | Acetyl-COA carboxylase; BCCPSC, carboxyl transfera | 2e-42 | |
| 3bg3_A | 718 | Pyruvate carboxylase, mitochondrial; TIM barrel, A | 8e-17 | |
| 2jku_A | 94 | Propionyl-COA carboxylase alpha chain, mitochondri | 9e-16 | |
| 1z6h_A | 72 | Biotin/lipoyl attachment protein; solution structu | 2e-15 | |
| 2d5d_A | 74 | Methylmalonyl-COA decarboxylase gamma chain; bioti | 4e-15 | |
| 1dcz_A | 77 | Transcarboxylase 1.3S subunit; antiparallel beta s | 5e-14 | |
| 2ejm_A | 99 | Methylcrotonoyl-COA carboxylase subunit alpha; bio | 5e-14 | |
| 3u9t_A | 675 | MCC alpha, methylcrotonyl-COA carboxylase, alpha-s | 2e-13 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 2e-13 | |
| 3n6r_A | 681 | Propionyl-COA carboxylase, alpha subunit; protein | 2e-12 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 2e-11 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 5e-10 | |
| 3hbl_A | 1150 | Pyruvate carboxylase; TIM barrel, ligase; HET: BTI | 1e-09 | |
| 2qf7_A | 1165 | Pyruvate carboxylase protein; multi-domain, multi- | 2e-09 | |
| 2l5t_A | 77 | Lipoamide acyltransferase; E2 lipoyl domain; NMR { | 6e-09 | |
| 1k8m_A | 93 | E2 component of branched-chain ahpha-ketoacid dehy | 2e-08 | |
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 6e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-07 | |
| 2dnc_A | 98 | Pyruvate dehydrogenase protein X component; lipoic | 3e-06 | |
| 2dne_A | 108 | Dihydrolipoyllysine-residue acetyltransferase comp | 1e-05 | |
| 3crk_C | 87 | Dihydrolipoyllysine-residue acetyltransferase COM | 2e-05 | |
| 1y8o_B | 128 | Dihydrolipoyllysine-residue acetyltransferase COM | 2e-05 | |
| 1zy8_K | 229 | Pyruvate dehydrogenase protein X component, mitoch | 2e-05 | |
| 3na6_A | 331 | Succinylglutamate desuccinylase/aspartoacylase; st | 5e-05 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 6e-05 | |
| 1ghj_A | 79 | E2, E2, the dihydrolipoamide succinyltransferase c | 7e-05 | |
| 1pmr_A | 80 | Dihydrolipoyl succinyltransferase; 2-oxoglutarate | 2e-04 | |
| 2qj8_A | 332 | MLR6093 protein; structural genomics, joint center | 3e-04 | |
| 3cdx_A | 354 | Succinylglutamatedesuccinylase/aspartoacylase; str | 8e-04 |
| >1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A Length = 80 | Back alignment and structure |
|---|
Score = 140 bits (355), Expect = 2e-42
Identities = 40/74 (54%), Positives = 54/74 (72%)
Query: 242 LKCPMAGTFYRSPAPGEPPFVKVGDRVQKGQVLCIIEAMKLMNEIEADRSGTIVEIIAED 301
++ PM GTFYR+P+P F++VG +V G LCI+EAMK+MN+IEAD+SGT+ I+ E
Sbjct: 7 VRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVES 66
Query: 302 RKPVSVDTPLFVIE 315
+PV D PL VIE
Sbjct: 67 GQPVEFDEPLVVIE 80
|
| >3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Length = 718 | Back alignment and structure |
|---|
| >2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Length = 72 | Back alignment and structure |
|---|
| >2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A Length = 74 | Back alignment and structure |
|---|
| >1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Length = 77 | Back alignment and structure |
|---|
| >2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Length = 1236 | Back alignment and structure |
|---|
| >3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Length = 681 | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Length = 84 | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* Length = 1150 | Back alignment and structure |
|---|
| >2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Length = 1165 | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Length = 77 | Back alignment and structure |
|---|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Length = 93 | Back alignment and structure |
|---|
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
| >2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Length = 87 | Back alignment and structure |
|---|
| >1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Length = 128 | Back alignment and structure |
|---|
| >3na6_A Succinylglutamate desuccinylase/aspartoacylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Ruegeria SP} Length = 331 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Length = 79 | Back alignment and structure |
|---|
| >1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 | Back alignment and structure |
|---|
| >2qj8_A MLR6093 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.00A {Mesorhizobium loti} Length = 332 | Back alignment and structure |
|---|
| >3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2} Length = 354 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 316 | |||
| 1bdo_A | 80 | Acetyl-COA carboxylase; BCCPSC, carboxyl transfera | 99.68 | |
| 1z6h_A | 72 | Biotin/lipoyl attachment protein; solution structu | 99.58 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 99.57 | |
| 1ghj_A | 79 | E2, E2, the dihydrolipoamide succinyltransferase c | 99.54 | |
| 1dcz_A | 77 | Transcarboxylase 1.3S subunit; antiparallel beta s | 99.53 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 99.53 | |
| 2d5d_A | 74 | Methylmalonyl-COA decarboxylase gamma chain; bioti | 99.52 | |
| 3crk_C | 87 | Dihydrolipoyllysine-residue acetyltransferase COM | 99.52 | |
| 2l5t_A | 77 | Lipoamide acyltransferase; E2 lipoyl domain; NMR { | 99.49 | |
| 1k8m_A | 93 | E2 component of branched-chain ahpha-ketoacid dehy | 99.49 | |
| 2dnc_A | 98 | Pyruvate dehydrogenase protein X component; lipoic | 99.48 | |
| 3n6r_A | 681 | Propionyl-COA carboxylase, alpha subunit; protein | 99.48 | |
| 2dne_A | 108 | Dihydrolipoyllysine-residue acetyltransferase comp | 99.47 | |
| 2k7v_A | 85 | Dihydrolipoyllysine-residue acetyltransferase comp | 99.46 | |
| 2ejm_A | 99 | Methylcrotonoyl-COA carboxylase subunit alpha; bio | 99.46 | |
| 2jku_A | 94 | Propionyl-COA carboxylase alpha chain, mitochondri | 99.46 | |
| 1qjo_A | 80 | Dihydrolipoamide acetyltransferase; lipoyl domain, | 99.45 | |
| 1gjx_A | 81 | Pyruvate dehydrogenase; oxidoreductase, lipoyl dom | 99.43 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 99.42 | |
| 1y8o_B | 128 | Dihydrolipoyllysine-residue acetyltransferase COM | 99.42 | |
| 3hbl_A | 1150 | Pyruvate carboxylase; TIM barrel, ligase; HET: BTI | 99.41 | |
| 1iyu_A | 79 | E2P, dihydrolipoamide acetyltransferase component | 99.39 | |
| 1pmr_A | 80 | Dihydrolipoyl succinyltransferase; 2-oxoglutarate | 99.38 | |
| 3u9t_A | 675 | MCC alpha, methylcrotonyl-COA carboxylase, alpha-s | 99.35 | |
| 3bg3_A | 718 | Pyruvate carboxylase, mitochondrial; TIM barrel, A | 99.2 | |
| 2qf7_A | 1165 | Pyruvate carboxylase protein; multi-domain, multi- | 99.17 | |
| 1zko_A | 136 | Glycine cleavage system H protein; TM0212, structu | 99.16 | |
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 99.12 | |
| 2k32_A | 116 | A; NMR {Campylobacter jejuni} PDB: 2k33_A* | 99.1 | |
| 1zy8_K | 229 | Pyruvate dehydrogenase protein X component, mitoch | 99.09 | |
| 1hpc_A | 131 | H protein of the glycine cleavage system; transit | 98.74 | |
| 3a7l_A | 128 | H-protein, glycine cleavage system H protein; lipo | 98.73 | |
| 1onl_A | 128 | Glycine cleavage system H protein; hybrid barrel-s | 98.71 | |
| 3lnn_A | 359 | Membrane fusion protein (MFP) heavy metal cation Z | 98.49 | |
| 3ne5_B | 413 | Cation efflux system protein CUSB; transmembrane h | 98.39 | |
| 2f1m_A | 277 | Acriflavine resistance protein A; helical hairpin, | 98.38 | |
| 3fpp_A | 341 | Macrolide-specific efflux protein MACA; hexameric | 98.38 | |
| 1vf7_A | 369 | Multidrug resistance protein MEXA; alpha hairpin, | 98.22 | |
| 3klr_A | 125 | Glycine cleavage system H protein; antiparallel be | 98.0 | |
| 4dk0_A | 369 | Putative MACA; alpha-hairpin, lipoyl, beta-barrel, | 97.98 | |
| 3na6_A | 331 | Succinylglutamate desuccinylase/aspartoacylase; st | 97.85 | |
| 3mxu_A | 143 | Glycine cleavage system H protein; seattle structu | 97.7 | |
| 3tzu_A | 137 | GCVH, glycine cleavage system H protein 1; ssgcid, | 97.7 | |
| 3cdx_A | 354 | Succinylglutamatedesuccinylase/aspartoacylase; str | 97.66 | |
| 3fmc_A | 368 | Putative succinylglutamate desuccinylase / aspart; | 97.61 | |
| 1ax3_A | 162 | Iiaglc, glucose permease IIA domain; phosphotransf | 97.47 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 97.4 | |
| 1f3z_A | 161 | EIIA-GLC, glucose-specific phosphocarrier; phospho | 97.38 | |
| 2gpr_A | 154 | Glucose-permease IIA component; phosphotransferase | 97.38 | |
| 3hgb_A | 155 | Glycine cleavage system H protein; ssgcid, niaid, | 97.34 | |
| 2qj8_A | 332 | MLR6093 protein; structural genomics, joint center | 96.84 | |
| 1z6h_A | 72 | Biotin/lipoyl attachment protein; solution structu | 96.78 | |
| 2d5d_A | 74 | Methylmalonyl-COA decarboxylase gamma chain; bioti | 96.69 | |
| 1dcz_A | 77 | Transcarboxylase 1.3S subunit; antiparallel beta s | 96.53 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 96.35 | |
| 2xha_A | 193 | NUSG, transcription antitermination protein NUSG; | 95.85 | |
| 3fpp_A | 341 | Macrolide-specific efflux protein MACA; hexameric | 95.77 | |
| 2jku_A | 94 | Propionyl-COA carboxylase alpha chain, mitochondri | 95.76 | |
| 2ejm_A | 99 | Methylcrotonoyl-COA carboxylase subunit alpha; bio | 95.74 | |
| 3lnn_A | 359 | Membrane fusion protein (MFP) heavy metal cation Z | 95.65 | |
| 3our_B | 183 | EIIA, phosphotransferase system IIA component; exh | 95.57 | |
| 2l5t_A | 77 | Lipoamide acyltransferase; E2 lipoyl domain; NMR { | 95.57 | |
| 1bdo_A | 80 | Acetyl-COA carboxylase; BCCPSC, carboxyl transfera | 95.44 | |
| 1qjo_A | 80 | Dihydrolipoamide acetyltransferase; lipoyl domain, | 95.26 | |
| 1vf7_A | 369 | Multidrug resistance protein MEXA; alpha hairpin, | 95.0 | |
| 2xhc_A | 352 | Transcription antitermination protein NUSG; 2.45A | 94.95 | |
| 1iyu_A | 79 | E2P, dihydrolipoamide acetyltransferase component | 94.77 | |
| 4dk0_A | 369 | Putative MACA; alpha-hairpin, lipoyl, beta-barrel, | 94.57 | |
| 2gpr_A | 154 | Glucose-permease IIA component; phosphotransferase | 94.56 | |
| 3crk_C | 87 | Dihydrolipoyllysine-residue acetyltransferase COM | 94.48 | |
| 1ghj_A | 79 | E2, E2, the dihydrolipoamide succinyltransferase c | 94.43 | |
| 1gjx_A | 81 | Pyruvate dehydrogenase; oxidoreductase, lipoyl dom | 94.4 | |
| 1k8m_A | 93 | E2 component of branched-chain ahpha-ketoacid dehy | 94.25 | |
| 2dne_A | 108 | Dihydrolipoyllysine-residue acetyltransferase comp | 94.2 | |
| 3ne5_B | 413 | Cation efflux system protein CUSB; transmembrane h | 94.1 | |
| 3d4r_A | 169 | Domain of unknown function from the PFAM-B_34464; | 94.01 | |
| 2k7v_A | 85 | Dihydrolipoyllysine-residue acetyltransferase comp | 93.79 | |
| 1pmr_A | 80 | Dihydrolipoyl succinyltransferase; 2-oxoglutarate | 93.57 | |
| 2auk_A | 190 | DNA-directed RNA polymerase beta' chain; sandwich- | 93.49 | |
| 1y8o_B | 128 | Dihydrolipoyllysine-residue acetyltransferase COM | 92.92 | |
| 1ax3_A | 162 | Iiaglc, glucose permease IIA domain; phosphotransf | 92.74 | |
| 2dnc_A | 98 | Pyruvate dehydrogenase protein X component; lipoic | 92.56 | |
| 2xha_A | 193 | NUSG, transcription antitermination protein NUSG; | 92.54 | |
| 3n6r_A | 681 | Propionyl-COA carboxylase, alpha subunit; protein | 91.79 | |
| 1f3z_A | 161 | EIIA-GLC, glucose-specific phosphocarrier; phospho | 91.52 | |
| 2k32_A | 116 | A; NMR {Campylobacter jejuni} PDB: 2k33_A* | 91.37 | |
| 2bco_A | 350 | Succinylglutamate desuccinylase; NESG, VPR14, stru | 90.0 | |
| 3lu0_D | 1407 | DNA-directed RNA polymerase subunit beta'; E. coli | 88.92 | |
| 3bg3_A | 718 | Pyruvate carboxylase, mitochondrial; TIM barrel, A | 88.87 | |
| 3hbl_A | 1150 | Pyruvate carboxylase; TIM barrel, ligase; HET: BTI | 87.92 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 87.35 | |
| 3u9t_A | 675 | MCC alpha, methylcrotonyl-COA carboxylase, alpha-s | 86.89 | |
| 2xhc_A | 352 | Transcription antitermination protein NUSG; 2.45A | 85.95 | |
| 2qf7_A | 1165 | Pyruvate carboxylase protein; multi-domain, multi- | 85.3 | |
| 2f1m_A | 277 | Acriflavine resistance protein A; helical hairpin, | 83.14 |
| >1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A | Back alignment and structure |
|---|
Probab=99.68 E-value=1.5e-16 Score=121.12 Aligned_cols=76 Identities=53% Similarity=0.976 Sum_probs=73.3
Q ss_pred CCccCCcCeEEEcCCCCCCCCCccCCCEEecCCeEEEEEecceeeEEecCCCeEEEEEecCCCCccCCCCeEEEEc
Q 021186 240 PPLKCPMAGTFYRSPAPGEPPFVKVGDRVQKGQVLCIIEAMKLMNEIEADRSGTIVEIIAEDRKPVSVDTPLFVIE 315 (316)
Q Consensus 240 ~~V~APmvGtf~~sp~p~~~~~VkvGD~VkkGqvL~iIEamK~~~eI~Ap~sGtV~eIlVe~Gd~V~~GqpL~~Ie 315 (316)
..|++|+.|++++.+.+..+|++++||.|++||+|+.||+||+..+|+||++|+|.++++++|+.|..|++|+.|+
T Consensus 5 ~~v~a~~~G~v~~~~~~~~~~~v~~G~~V~~G~~l~~ie~~k~~~~i~Ap~~G~v~~~~v~~G~~V~~G~~L~~i~ 80 (80)
T 1bdo_A 5 HIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE 80 (80)
T ss_dssp EEEECSSSEEEESSSSTTSCCSCCTTCEECTTCEEEEEEETTEEEEEECSSCEEEEEECSCTTCEECTTCEEEEEC
T ss_pred eEEEcCCCeEEEEecccCcccccCCcCEECCCCEEEEEEeccEEEEEECCCCEEEEEEEcCCCCEECCCCEEEEEC
Confidence 3699999999999889999999999999999999999999999999999999999999999999999999999985
|
| >1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A | Back alignment and structure |
|---|
| >1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A | Back alignment and structure |
|---|
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A | Back alignment and structure |
|---|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} | Back alignment and structure |
|---|
| >1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A | Back alignment and structure |
|---|
| >3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* | Back alignment and structure |
|---|
| >1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A | Back alignment and structure |
|---|
| >1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A | Back alignment and structure |
|---|
| >2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* | Back alignment and structure |
|---|
| >1zko_A Glycine cleavage system H protein; TM0212, structural genomi center for structural genomics, JCSG, protein structure INI PSI; HET: MSE; 1.65A {Thermotoga maritima} PDB: 2ka7_A | Back alignment and structure |
|---|
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A | Back alignment and structure |
|---|
| >2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* | Back alignment and structure |
|---|
| >1hpc_A H protein of the glycine cleavage system; transit peptide; HET: LPA; 2.00A {Pisum sativum} SCOP: b.84.1.1 PDB: 1dxm_A* 1htp_A* | Back alignment and structure |
|---|
| >3a7l_A H-protein, glycine cleavage system H protein; lipoic acid, lipoyl, transport protein; 1.30A {Escherichia coli} PDB: 3a7a_B 3ab9_A* 3a8i_E* 3a8j_E* 3a8k_E* | Back alignment and structure |
|---|
| >1onl_A Glycine cleavage system H protein; hybrid barrel-sandwich structure, structural genomics, riken structural genomics/proteomics initiative; 2.50A {Thermus thermophilus} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} | Back alignment and structure |
|---|
| >3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B | Back alignment and structure |
|---|
| >2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} | Back alignment and structure |
|---|
| >3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} | Back alignment and structure |
|---|
| >1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A | Back alignment and structure |
|---|
| >3klr_A Glycine cleavage system H protein; antiparallel beta sheet, beta sandwich, oxidoreductase; HET: GOL; 0.88A {Bos taurus} SCOP: b.84.1.0 PDB: 2edg_A | Back alignment and structure |
|---|
| >4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A | Back alignment and structure |
|---|
| >3na6_A Succinylglutamate desuccinylase/aspartoacylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Ruegeria SP} | Back alignment and structure |
|---|
| >3mxu_A Glycine cleavage system H protein; seattle structural genomics center for infectious disease, S CAT-scratch disease, bacteremia; HET: CIT; 1.80A {Bartonella henselae} | Back alignment and structure |
|---|
| >3tzu_A GCVH, glycine cleavage system H protein 1; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >3fmc_A Putative succinylglutamate desuccinylase / aspart; S genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Shewanella amazonensis} PDB: 3lwu_A* | Back alignment and structure |
|---|
| >1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A | Back alignment and structure |
|---|
| >2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 | Back alignment and structure |
|---|
| >3hgb_A Glycine cleavage system H protein; ssgcid, niaid, decode, UW, SBRI, lipoyl; 1.75A {Mycobacterium tuberculosis} PDB: 3ift_A | Back alignment and structure |
|---|
| >2qj8_A MLR6093 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.00A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* | Back alignment and structure |
|---|
| >2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A | Back alignment and structure |
|---|
| >1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xha_A NUSG, transcription antitermination protein NUSG; 1.91A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} | Back alignment and structure |
|---|
| >2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} | Back alignment and structure |
|---|
| >3our_B EIIA, phosphotransferase system IIA component; exhibit no hydrolase activity1, lyase-transferase complex; 2.20A {Vibrio vulnificus} SCOP: b.84.3.1 | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A | Back alignment and structure |
|---|
| >1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A | Back alignment and structure |
|---|
| >2xhc_A Transcription antitermination protein NUSG; 2.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A | Back alignment and structure |
|---|
| >4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A | Back alignment and structure |
|---|
| >2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 | Back alignment and structure |
|---|
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* | Back alignment and structure |
|---|
| >1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A | Back alignment and structure |
|---|
| >1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A | Back alignment and structure |
|---|
| >2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B | Back alignment and structure |
|---|
| >3d4r_A Domain of unknown function from the PFAM-B_34464; structural genomics, joint center for structural genomics; HET: MSE; 2.20A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >2auk_A DNA-directed RNA polymerase beta' chain; sandwich-barrel hybrid motif, transferase; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A | Back alignment and structure |
|---|
| >1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A | Back alignment and structure |
|---|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xha_A NUSG, transcription antitermination protein NUSG; 1.91A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A | Back alignment and structure |
|---|
| >2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* | Back alignment and structure |
|---|
| >2bco_A Succinylglutamate desuccinylase; NESG, VPR14, structural genomics, PSI, protein structure initiative; 2.33A {Vibrio parahaemolyticus} SCOP: c.56.5.7 PDB: 2g9d_A | Back alignment and structure |
|---|
| >3lu0_D DNA-directed RNA polymerase subunit beta'; E. coli RNA polymerase, nucleotidyltransferase, transcription, transferase; 11.20A {Escherichia coli} PDB: 3iyd_D* | Back alignment and structure |
|---|
| >3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A | Back alignment and structure |
|---|
| >3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} | Back alignment and structure |
|---|
| >2xhc_A Transcription antitermination protein NUSG; 2.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* | Back alignment and structure |
|---|
| >2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 316 | ||||
| d1bdoa_ | 80 | b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carbox | 6e-23 | |
| d1dcza_ | 77 | b.84.1.1 (A:) Biotin carboxyl carrier domain of tr | 5e-17 | |
| d1laba_ | 80 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 6e-14 | |
| d1gjxa_ | 81 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 6e-14 | |
| d1k8ma_ | 87 | b.84.1.1 (A:) Lipoyl domain of the mitochondrial b | 7e-14 | |
| d1qjoa_ | 80 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 1e-13 | |
| d1iyua_ | 79 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 2e-13 | |
| d1pmra_ | 80 | b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate | 5e-12 | |
| d1ghja_ | 79 | b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate | 2e-11 | |
| d1y8ob1 | 102 | b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoa | 5e-08 |
| >d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Barrel-sandwich hybrid superfamily: Single hybrid motif family: Biotinyl/lipoyl-carrier proteins and domains domain: Biotinyl domain of acetyl-CoA carboxylase species: Escherichia coli [TaxId: 562]
Score = 88.5 bits (219), Expect = 6e-23
Identities = 40/73 (54%), Positives = 53/73 (72%)
Query: 243 KCPMAGTFYRSPAPGEPPFVKVGDRVQKGQVLCIIEAMKLMNEIEADRSGTIVEIIAEDR 302
+ PM GTFYR+P+P F++VG +V G LCI+EAMK+MN+IEAD+SGT+ I+ E
Sbjct: 8 RSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESG 67
Query: 303 KPVSVDTPLFVIE 315
+PV D PL VIE
Sbjct: 68 QPVEFDEPLVVIE 80
|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Length = 77 | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 80 | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Length = 81 | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Length = 79 | Back information, alignment and structure |
|---|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Length = 79 | Back information, alignment and structure |
|---|
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 316 | |||
| d1bdoa_ | 80 | Biotinyl domain of acetyl-CoA carboxylase {Escheri | 99.87 | |
| d1dcza_ | 77 | Biotin carboxyl carrier domain of transcarboxylase | 99.77 | |
| d1iyua_ | 79 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.64 | |
| d1ghja_ | 79 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 99.57 | |
| d1qjoa_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.57 | |
| d1laba_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.53 | |
| d1k8ma_ | 87 | Lipoyl domain of the mitochondrial branched-chain | 99.52 | |
| d1gjxa_ | 81 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.48 | |
| d1pmra_ | 80 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 99.42 | |
| d1y8ob1 | 102 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.42 | |
| d1vf7a_ | 237 | Multidrug resistance protein MexA domain {Pseudomo | 97.52 | |
| d1onla_ | 127 | Protein H of glycine cleavage system {Thermus ther | 97.01 | |
| d1hpca_ | 131 | Protein H of glycine cleavage system {Pea (Pisum s | 96.95 | |
| d1dcza_ | 77 | Biotin carboxyl carrier domain of transcarboxylase | 96.85 | |
| d1iyua_ | 79 | Lipoyl domain of dihydrolipoamide acetyltransferas | 96.04 | |
| d1gpra_ | 158 | Glucose permease IIa domain, IIa-glc {Bacillus sub | 96.01 | |
| d1qjoa_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 95.97 | |
| d1bdoa_ | 80 | Biotinyl domain of acetyl-CoA carboxylase {Escheri | 95.93 | |
| d2f3ga_ | 150 | Glucose-specific factor III (glsIII) {Escherichia | 95.92 | |
| d1k8ma_ | 87 | Lipoyl domain of the mitochondrial branched-chain | 95.73 | |
| d2gpra_ | 154 | Glucose permease IIa domain, IIa-glc {Mycoplasma c | 95.49 | |
| d1pmra_ | 80 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 95.36 | |
| d1ghja_ | 79 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 95.25 | |
| d1laba_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 95.11 | |
| d1gjxa_ | 81 | Lipoyl domain of dihydrolipoamide acetyltransferas | 94.59 | |
| d1y8ob1 | 102 | Lipoyl domain of dihydrolipoamide acetyltransferas | 92.99 | |
| d1gpra_ | 158 | Glucose permease IIa domain, IIa-glc {Bacillus sub | 88.31 | |
| d2gpra_ | 154 | Glucose permease IIa domain, IIa-glc {Mycoplasma c | 88.14 | |
| d2f3ga_ | 150 | Glucose-specific factor III (glsIII) {Escherichia | 86.36 | |
| d1brwa3 | 103 | Pyrimidine nucleoside phosphorylase {Bacillus stea | 83.63 |
| >d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Barrel-sandwich hybrid superfamily: Single hybrid motif family: Biotinyl/lipoyl-carrier proteins and domains domain: Biotinyl domain of acetyl-CoA carboxylase species: Escherichia coli [TaxId: 562]
Probab=99.87 E-value=1.3e-22 Score=157.15 Aligned_cols=75 Identities=53% Similarity=0.994 Sum_probs=73.8
Q ss_pred CccCCcCeEEEcCCCCCCCCCccCCCEEecCCeEEEEEecceeeEEecCCCeEEEEEecCCCCccCCCCeEEEEc
Q 021186 241 PLKCPMAGTFYRSPAPGEPPFVKVGDRVQKGQVLCIIEAMKLMNEIEADRSGTIVEIIAEDRKPVSVDTPLFVIE 315 (316)
Q Consensus 241 ~V~APmvGtf~~sp~p~~~~~VkvGD~VkkGqvL~iIEamK~~~eI~Ap~sGtV~eIlVe~Gd~V~~GqpL~~Ie 315 (316)
.|+|||+|+||++|.|+.++||++||+|++||+||+||+||+.++|+||++|+|.++++++|+.|++||+|+.|+
T Consensus 6 ~I~aPm~G~~~~~~~p~~~~~V~~Gd~V~~Gq~l~~iEamKm~~~i~a~~~G~v~~i~v~~G~~V~~G~~L~~ie 80 (80)
T d1bdoa_ 6 IVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE 80 (80)
T ss_dssp EEECSSSEEEESSSSTTSCCSCCTTCEECTTCEEEEEEETTEEEEEECSSCEEEEEECSCTTCEECTTCEEEEEC
T ss_pred EEeCCCcEEEEecCCCCCCeEccCCCeEeCCCEEEEEEcCcccEEEEcCCCeEEEEEEeCCCCEECCCCEEEEEC
Confidence 699999999999999999999999999999999999999999999999999999999999999999999999986
|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1onla_ b.84.1.1 (A:) Protein H of glycine cleavage system {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1hpca_ b.84.1.1 (A:) Protein H of glycine cleavage system {Pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f3ga_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Mycoplasma capricolum [TaxId: 2095]} | Back information, alignment and structure |
|---|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Mycoplasma capricolum [TaxId: 2095]} | Back information, alignment and structure |
|---|
| >d2f3ga_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1brwa3 d.41.3.1 (A:331-433) Pyrimidine nucleoside phosphorylase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|