Citrus Sinensis ID: 021192

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310------
MQKNQDRRSRSAKPATIHGCAQSGDLLAFQRLLRENPSLLNERNPVMAQTPLHVSAGYNKAEIVKSLLEWPGNDKVELEAQNMYGETPLHMAAKNGCNEAAKLLLAHGAFIEAKANNGMTPLHLSVWYSIRSEDYATVKTLLEYNADCSAKDNEGKTPLDHLSNGPGSAKLRELLLWHSEEQRKRRALEACSETKAKMDELENELSNIVGLHELKIQLRKWAKGMLLDERRKALGLKVGARRPPHMAFLGNPGTGKTMVARILGRLLYMVGILPTDRVTEVQRTDLVGEFVGHTGPKTRRRVGHLLSEITCLTFIW
ccccccccccccccHHHHHHHHcccHHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHHccccccHHHHHHHHHccccccccccccccHHHHHHccccHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHcccccccHHHHHHHHHHHHHHHccccccccHHcccccHHHHHHccccHHHHHHHHHHcccEEEEEEcc
cccccccccccccccHHHHHHHcccHHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccccccHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHccccHHHHHHHHcccHHHHHHcccccHHHHHHcccccHHHHHHcccccccccccccccHHHHHHHcccEEEEEEEEccccEEEEccccccHHEEccccccHHHHHHHHcccEEEEEEEc
mqknqdrrsrsakpatihgcaqsGDLLAFQRLLRenpsllnernpvmaqtplhvsagYNKAEIVKSLlewpgndkveLEAQnmygetplhmaaKNGCNEAAKLLLAHGAFIeakanngmtplHLSVWYSIRSEDYATVKTLLEYNadcsakdnegktpldhlsngpgsAKLRELLLWHSEEQRKRRALEACSETKAKMDELENELSNIVGLHELKIQLRKWAKGMLLDERRKALGlkvgarrpphmaflgnpgtgkTMVARILGRLLYMVGilptdrvtevqrtdlvgefvghtgpktrrRVGHLLSEITCLTFIW
mqknqdrrsrsakpatihgcaqsgDLLAFQRLLRENPSLLNERNPVMAQTPLHVSAGYNKAEIVKSLLEWPGNDKVELEAQNMYGETPLHMAAKNGCNEAAKLLLAHGAFIEAKANNGMTPLHLSVWYSIRSEDYATVKTLLEYNADCSakdnegktpldhlsngpGSAKLRELLLWHSEEQRKRRALEACSETKAKMDELENELSNIVGLHELKIQLRKWAKGMLLDERRKALglkvgarrpphmaflgnpgtgkTMVARILGRLLYMVGILPTDrvtevqrtdlvgefvghtgpktrrrvghllseitcltfiw
MQKNQDRRSRSAKPATIHGCAQSGDLLAFQRLLRENPSLLNERNPVMAQTPLHVSAGYNKAEIVKSLLEWPGNDKVELEAQNMYGETPLHMAAKNGCNEAAKLLLAHGAFIEAKANNGMTPLHLSVWYSIRSEDYATVKTLLEYNADCSAKDNEGKTPLDHLSNGPGSAKLRELLLWHSEEQRKRRALEACSETKAKMDELENELSNIVGLHELKIQLRKWAKGMLLDERRKALGLKVGARRPPHMAFLGNPGTGKTMVARILGRLLYMVGILPTDRVTEVQRTDLVGEFVGHTGPKTRRRVGHLLSEITCLTFIW
******************GCAQSGDLLAFQRLLRE**********VMAQTPLHVSAGYNKAEIVKSLLEWPGNDKVELEAQNMYGETPLHMAAKNGCNEAAKLLLAHGAFIEAKANNGMTPLHLSVWYSIRSEDYATVKTLLEYNADC*************************LLLW***************************LSNIVGLHELKIQLRKWAKGMLLDERRKALGLKVGARRPPHMAFLGNPGTGKTMVARILGRLLYMVGILPTDRVTEVQRTDLVGEFVGHTGPKTRRRVGHLLSEITCLTFIW
MQKNQDRRSRSAKPATIHGCAQSGDLLAFQRLLRENPSLLNERNPVMAQTPLHVSAGYNKAEIVKSLLEWPGNDKVELEAQNMYGETPLHMAAKNGCNEAAKLLLAHGAFIEAKANNGMTPLHLSVWYSIRSEDYATVKTLLEYNADCSAKDNEGKTPLDHLSNGPGSAKLRELLLWHSEEQRKRRALEACSETKAKMDELENELSNIVGLHELKIQLRKWAKGMLLDERRKALGLKVGARRPPHMAFLGNPGTGKTMVARILGRLLYMVGILPTDRVTEVQRTDLVGEFVGHTGPKTRRRVGHLLSEITCLTFIW
***************TIHGCAQSGDLLAFQRLLRENPSLLNERNPVMAQTPLHVSAGYNKAEIVKSLLEWPGNDKVELEAQNMYGETPLHMAAKNGCNEAAKLLLAHGAFIEAKANNGMTPLHLSVWYSIRSEDYATVKTLLEYNADCSAKDNEGKTPLDHLSNGPGSAKLRELLLWHSEEQRKRRALEACSETKAKMDELENELSNIVGLHELKIQLRKWAKGMLLDERRKALGLKVGARRPPHMAFLGNPGTGKTMVARILGRLLYMVGILPTDRVTEVQRTDLVGEFVGHTGPKTRRRVGHLLSEITCLTFIW
*****DRRSRSAKPATIHGCAQSGDLLAFQRLLRENPSLLNERNPVMAQTPLHVSAGYNKAEIVKSLLEWPGNDKVELEAQNMYGETPLHMAAKNGCNEAAKLLLAHGAFIEAKANNGMTPLHLSVWYSIRSEDYATVKTLLEYNADCSAKDNEGKTPLDHLSNGPGSAKLRELLLWHSEEQRKRRALEACSETKAKMDELENELSNIVGLHELKIQLRKWAKGMLLDERRKALGLKVGARRPPHMAFLGNPGTGKTMVARILGRLLYMVGILPTDRVTEVQRTDLVGEFVGHTGPKTRRRVGHLLSEITCLTFIW
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQKNQDRRSRSAKPATIHGCAQSGDLLAFQRLLRENPSLLNERNPVMAQTPLHVSAGYNKAEIVKSLLEWPGNDKVELEAQNMYGETPLHMAAKNGCNEAAKLLLAHGAFIEAKANNGMTPLHLSVWYSIRSEDYATVKTLLEYNADCSAKDNEGKTPLDHLSNGPGSAKLRELLLWHSEEQRxxxxxxxxxxxxxxxxxxxxxxxxxxxxHELKIQLRKWAKGMLLDERRKALGLKVGARRPPHMAFLGNPGTGKTMVARILGRLLYMVGILPTDRVTEVQRTDLVGEFVGHTGPKTRRRVGHLLSEITCLTFIW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query316 2.2.26 [Sep-21-2011]
P27643 322 Stage V sporulation prote yes no 0.319 0.313 0.431 2e-19
O22025 293 Protein cfxQ homolog OS=C N/A no 0.329 0.354 0.4 7e-16
O22034 286 Protein cfxQ homolog OS=C N/A no 0.329 0.363 0.390 4e-15
Q04540 317 Protein CbxX, plasmid OS= yes no 0.300 0.299 0.425 3e-14
P40118 317 Protein CbxX, chromosomal yes no 0.300 0.299 0.425 3e-14
P95648 309 Protein CbbX OS=Rhodobact yes no 0.341 0.349 0.413 5e-14
P23013 317 Protein CfxQ OS=Xanthobac N/A no 0.329 0.328 0.407 5e-14
P49826 291 Protein cfxQ homolog OS=O N/A no 0.313 0.340 0.415 6e-14
P51228 301 Protein cfxQ homolog OS=P N/A no 0.329 0.345 0.396 1e-13
Q9MS99 305 Protein cfxQ homolog OS=G N/A no 0.329 0.340 0.396 2e-13
>sp|P27643|SP5K_BACSU Stage V sporulation protein K OS=Bacillus subtilis (strain 168) GN=spoVK PE=2 SV=3 Back     alignment and function desciption
 Score = 97.1 bits (240), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 70/102 (68%), Gaps = 1/102 (0%)

Query: 198 MDELENELSNIVGLHELKIQLRKWAKGMLLDERRKALGLKVGARRPPHMAFLGNPGTGKT 257
           + E+E E+S +VG+ E+K  +++    + ++++R   GLKVG ++  HM F GNPGTGKT
Sbjct: 48  LKEIEKEMSALVGMEEMKRNIKEIYAWIFVNQKRAEQGLKVG-KQALHMMFKGNPGTGKT 106

Query: 258 MVARILGRLLYMVGILPTDRVTEVQRTDLVGEFVGHTGPKTR 299
            VAR++G+L + + +L    + E +R DLVGE++GHT  KTR
Sbjct: 107 TVARLIGKLFFEMNVLSKGHLIEAERADLVGEYIGHTAQKTR 148

Bacillus subtilis (strain 168) (taxid: 224308)
>sp|O22025|CFXQ_CYAME Protein cfxQ homolog OS=Cyanidioschyzon merolae GN=cfxQ PE=3 SV=2 Back     alignment and function description
>sp|O22034|CFXQ2_CYACA Protein cfxQ homolog OS=Cyanidium caldarium GN=cfxQ PE=3 SV=1 Back     alignment and function description
>sp|Q04540|CBXXP_CUPNH Protein CbxX, plasmid OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=cbxXP PE=3 SV=1 Back     alignment and function description
>sp|P40118|CBXXC_CUPNH Protein CbxX, chromosomal OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=cbxXC PE=3 SV=1 Back     alignment and function description
>sp|P95648|CBBX_RHOSH Protein CbbX OS=Rhodobacter sphaeroides GN=cbbX PE=1 SV=1 Back     alignment and function description
>sp|P23013|CFXQ_XANFL Protein CfxQ OS=Xanthobacter flavus GN=cfxQ PE=3 SV=1 Back     alignment and function description
>sp|P49826|CFXQ_ODOSI Protein cfxQ homolog OS=Odontella sinensis GN=cfxQ PE=3 SV=1 Back     alignment and function description
>sp|P51228|CFXQ_PORPU Protein cfxQ homolog OS=Porphyra purpurea GN=cfxQ PE=3 SV=1 Back     alignment and function description
>sp|Q9MS99|CFXQ_GALSU Protein cfxQ homolog OS=Galdieria sulphuraria GN=cfxQ PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query316
255546479 481 Protein cbxX, chromosomal, putative [Ric 0.939 0.617 0.865 1e-151
356520543 480 PREDICTED: protein CbxX, chromosomal-lik 0.949 0.625 0.826 1e-148
356531267 484 PREDICTED: protein CbxX, chromosomal-lik 0.949 0.619 0.813 1e-146
225445236 484 PREDICTED: caseinolytic peptidase B prot 0.955 0.623 0.821 1e-146
357500765 479 Ankyrin repeat domain-containing protein 0.955 0.630 0.811 1e-146
224119764 478 predicted protein [Populus trichocarpa] 0.958 0.633 0.819 1e-145
224143544 477 predicted protein [Populus trichocarpa] 0.955 0.633 0.809 1e-144
449459838 479 PREDICTED: ESX-1 secretion system protei 0.955 0.630 0.807 1e-142
21553510 481 rubisco expression protein, putative [Ar 0.952 0.625 0.777 1e-135
18404228 481 AAA-type ATPase family protein / ankyrin 0.952 0.625 0.774 1e-134
>gi|255546479|ref|XP_002514299.1| Protein cbxX, chromosomal, putative [Ricinus communis] gi|223546755|gb|EEF48253.1| Protein cbxX, chromosomal, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  540 bits (1392), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 258/298 (86%), Positives = 282/298 (94%), Gaps = 1/298 (0%)

Query: 6   DRRSRSAKPAT-IHGCAQSGDLLAFQRLLRENPSLLNERNPVMAQTPLHVSAGYNKAEIV 64
           D+RSRS+K  T IHG AQSGDLLAFQ+LLR NPSLLNERNPVMAQTPLHVSAG N+AEIV
Sbjct: 7   DQRSRSSKQVTTIHGFAQSGDLLAFQKLLRVNPSLLNERNPVMAQTPLHVSAGNNRAEIV 66

Query: 65  KSLLEWPGNDKVELEAQNMYGETPLHMAAKNGCNEAAKLLLAHGAFIEAKANNGMTPLHL 124
           K+LLEW G +KVELEA+NMYGETPLHMAAKNGCNEAA+LLLAHGAF+E+KANNGMTPLHL
Sbjct: 67  KTLLEWQGPEKVELEAKNMYGETPLHMAAKNGCNEAARLLLAHGAFVESKANNGMTPLHL 126

Query: 125 SVWYSIRSEDYATVKTLLEYNADCSAKDNEGKTPLDHLSNGPGSAKLRELLLWHSEEQRK 184
           +VWYSIRS+D++TVKTLLEYNADCSAKDNEG TP++HLS GPGS KLR+LL WH +EQRK
Sbjct: 127 AVWYSIRSDDFSTVKTLLEYNADCSAKDNEGMTPMNHLSRGPGSEKLRQLLQWHIDEQRK 186

Query: 185 RRALEACSETKAKMDELENELSNIVGLHELKIQLRKWAKGMLLDERRKALGLKVGARRPP 244
           RRALEACSETKAKM+ELEN LSNIVGLHELKIQLRKWAKGMLLDERR ALGLKVG RRPP
Sbjct: 187 RRALEACSETKAKMEELENALSNIVGLHELKIQLRKWAKGMLLDERRMALGLKVGVRRPP 246

Query: 245 HMAFLGNPGTGKTMVARILGRLLYMVGILPTDRVTEVQRTDLVGEFVGHTGPKTRRRV 302
           HMAFLGNPGTGKTMVARILGRLL++VGILPTDRVTEVQRTDLVGEFVGHTGPKTR+++
Sbjct: 247 HMAFLGNPGTGKTMVARILGRLLHLVGILPTDRVTEVQRTDLVGEFVGHTGPKTRKKI 304

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356520543|ref|XP_003528921.1| PREDICTED: protein CbxX, chromosomal-like [Glycine max] Back     alignment and taxonomy information
>gi|356531267|ref|XP_003534199.1| PREDICTED: protein CbxX, chromosomal-like [Glycine max] Back     alignment and taxonomy information
>gi|225445236|ref|XP_002280965.1| PREDICTED: caseinolytic peptidase B protein homolog [Vitis vinifera] gi|297738825|emb|CBI28070.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357500765|ref|XP_003620671.1| Ankyrin repeat domain-containing protein [Medicago truncatula] gi|355495686|gb|AES76889.1| Ankyrin repeat domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|224119764|ref|XP_002331155.1| predicted protein [Populus trichocarpa] gi|222873238|gb|EEF10369.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224143544|ref|XP_002324992.1| predicted protein [Populus trichocarpa] gi|222866426|gb|EEF03557.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449459838|ref|XP_004147653.1| PREDICTED: ESX-1 secretion system protein EccA1-like [Cucumis sativus] gi|449498823|ref|XP_004160644.1| PREDICTED: ESX-1 secretion system protein EccA1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|21553510|gb|AAM62603.1| rubisco expression protein, putative [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18404228|ref|NP_566752.1| AAA-type ATPase family protein / ankyrin repeat family protein [Arabidopsis thaliana] gi|13507553|gb|AAK28639.1|AF360342_1 putative rubisco expression protein [Arabidopsis thaliana] gi|15293291|gb|AAK93756.1| putative rubisco expression protein [Arabidopsis thaliana] gi|332643395|gb|AEE76916.1| AAA-type ATPase family protein / ankyrin repeat family protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query316
TAIR|locus:2091702 481 AT3G24530 [Arabidopsis thalian 0.952 0.625 0.774 4.9e-124
UNIPROTKB|Q81WX4 318 spoVK "Stage V sporulation pro 0.338 0.336 0.405 2.5e-18
TIGR_CMR|BA_3839 318 BA_3839 "stage V sporulation p 0.338 0.336 0.405 2.5e-18
TAIR|locus:2134786243 AT4G19150 [Arabidopsis thalian 0.556 0.724 0.287 3.6e-14
TIGR_CMR|CHY_1391 296 CHY_1391 "stage V sporulation 0.354 0.378 0.407 7.6e-14
UNIPROTKB|O53687 631 eccA3 "ESX-3 secretion system 0.386 0.193 0.354 3.9e-13
ZFIN|ZDB-GENE-091113-6 1923 si:ch211-263m18.3 "si:ch211-26 0.547 0.089 0.329 1.8e-12
UNIPROTKB|F1S492166 CDKN2D "Uncharacterized protei 0.468 0.891 0.319 4e-12
UNIPROTKB|Q29RV0166 CDKN2D "Cyclin-dependent kinas 0.468 0.891 0.307 1.4e-11
UNIPROTKB|F6Y5Y4 1151 TNKS2 "Uncharacterized protein 0.762 0.209 0.280 2.4e-11
TAIR|locus:2091702 AT3G24530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1219 (434.2 bits), Expect = 4.9e-124, P = 4.9e-124
 Identities = 233/301 (77%), Positives = 259/301 (86%)

Query:     2 QKNQDRRSRSAKPATIHGCAQSGDLLAFQRLLRENPSLLNERNPVMAQTPLHVSAGYNKA 61
             Q    +R RSA+P TIH CA SGDL+A QRLL++NPSLLNERNPVM  TPLHVSAG    
Sbjct:     4 QNGGGQRLRSARPTTIHDCALSGDLIALQRLLKDNPSLLNERNPVMYHTPLHVSAGNGNV 63

Query:    62 EIVKSLLEWPGNDKVELEAQNMYGETPLHMAAKNGCNEAAKLLLAHGAFIEAKANNGMTP 121
             +IVK LL W G+DKVELEA N YGETPLHMAAKNGCNEAAKLLL  GAFIEAKA+NGMTP
Sbjct:    64 DIVKYLLAWTGSDKVELEAMNTYGETPLHMAAKNGCNEAAKLLLESGAFIEAKASNGMTP 123

Query:   122 LHLSVWYSIRSEDYATVKTLLEYNADCSAKDNEGKTPLDHLSNGPGSAKLRELLLWHSEE 181
             LHL+VWYSI +++ +TVKTLL++NADCSAKDNEG TPLDHL  G GS KLRELL W  +E
Sbjct:   124 LHLAVWYSITAKEISTVKTLLDHNADCSAKDNEGMTPLDHLPQGQGSEKLRELLRWFLQE 183

Query:   182 QRKRRALEACSETKAKMDELENELSNIVGLHELKIQLRKWAKGMLLDERRKALGLKVGAR 241
             QRKR ALE C +TKAKM+ LE+ELSNIVGL ELK QLRKWAKGMLLDERR+ALGL +G R
Sbjct:   184 QRKRSALEQCGKTKAKMELLEDELSNIVGLSELKTQLRKWAKGMLLDERRRALGLNIGTR 243

Query:   242 RPPHMAFLGNPGTGKTMVARILGRLLYMVGILPTDRVTEVQRTDLVGEFVGHTGPKTRRR 301
             RPPHMAFLGNPGTGKTMVAR+LG+LL  VGILPTD+VTEVQRTDLVGEFVGHTGPKTRR+
Sbjct:   244 RPPHMAFLGNPGTGKTMVARVLGKLLNTVGILPTDKVTEVQRTDLVGEFVGHTGPKTRRK 303

Query:   302 V 302
             +
Sbjct:   304 I 304
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM
GO:0016887 "ATPase activity" evidence=ISS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0019538 "protein metabolic process" evidence=ISS
GO:0009507 "chloroplast" evidence=IDA
UNIPROTKB|Q81WX4 spoVK "Stage V sporulation protein K" [Bacillus anthracis (taxid:1392)] Back     alignment and assigned GO terms
TIGR_CMR|BA_3839 BA_3839 "stage V sporulation protein K" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TAIR|locus:2134786 AT4G19150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_1391 CHY_1391 "stage V sporulation protein K" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
UNIPROTKB|O53687 eccA3 "ESX-3 secretion system protein EccA3" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-091113-6 si:ch211-263m18.3 "si:ch211-263m18.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1S492 CDKN2D "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q29RV0 CDKN2D "Cyclin-dependent kinase 4 inhibitor D" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F6Y5Y4 TNKS2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00016741001
SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (484 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00035648001
RecName- Full=Ribulose bisphosphate carboxylase large chain; Short=RuBisCO large subunit; EC=4. [...] (327 aa)
•     • 0.742
GSVIVG00031354001
RecName- Full=Ribulose bisphosphate carboxylase small chain; EC=4.1.1.39;; RuBisCO catalyzes tw [...] (169 aa)
•     • 0.597
GSVIVG00016307001
SubName- Full=Chromosome chr17 scaffold_12, whole genome shotgun sequence; (286 aa)
•     • 0.565
GSVIVG00015908001
SubName- Full=Chromosome chr17 scaffold_12, whole genome shotgun sequence; (324 aa)
•     • 0.546
GSVIVG00017679001
RecName- Full=Ribulose bisphosphate carboxylase small chain; EC=4.1.1.39;; RuBisCO catalyzes tw [...] (180 aa)
•     • 0.491
GSVIVG00027605001
SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (230 aa)
•       0.425
GSVIVG00020537001
SubName- Full=Chromosome chr14 scaffold_21, whole genome shotgun sequence; (222 aa)
•     • 0.422

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query316
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-27
TIGR02881 261 TIGR02881, spore_V_K, stage V sporulation protein 3e-27
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-20
TIGR02880 284 TIGR02880, cbbX_cfxQ, probable Rubsico expression 3e-20
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-19
CHL00181 287 CHL00181, cbbX, CbbX; Provisional 1e-18
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 1e-18
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-18
TIGR03922 557 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPas 8e-18
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-16
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-14
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 6e-14
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 2e-13
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-12
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-11
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-11
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-11
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-10
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 9e-10
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 2e-09
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-09
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 2e-09
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 4e-09
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 6e-08
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 7e-08
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-07
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 5e-07
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 8e-07
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 3e-06
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-05
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 1e-05
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-05
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 2e-05
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 3e-05
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 4e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 8e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 8e-05
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 1e-04
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 2e-04
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 2e-04
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 2e-04
pfam00004131 pfam00004, AAA, ATPase family associated with vari 3e-04
smart0024830 smart00248, ANK, ankyrin repeats 3e-04
PHA02884300 PHA02884, PHA02884, ankyrin repeat protein; Provis 4e-04
PHA02884300 PHA02884, PHA02884, ankyrin repeat protein; Provis 5e-04
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 6e-04
COG0464 494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 7e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 0.001
PHA02716 764 PHA02716, PHA02716, CPXV016; CPX019; EVM010; Provi 0.001
PRK00440 319 PRK00440, rfc, replication factor C small subunit; 0.001
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 0.002
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 0.002
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.003
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 0.004
pfam06309127 pfam06309, Torsin, Torsin 0.004
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information 
 Score =  104 bits (260), Expect = 1e-27
 Identities = 54/128 (42%), Positives = 80/128 (62%), Gaps = 9/128 (7%)

Query: 49  QTPLHVSAGYNKAEIVKSLLEWPGNDKVELEAQNMYGETPLHMAAKNGCNEAAKLLLAHG 108
           +TPLH++A     E+VK LLE    +  ++ A++  G TPLH+AAKNG  E  KLLL  G
Sbjct: 8   RTPLHLAASNGHLEVVKLLLE----NGADVNAKDNDGRTPLHLAAKNGHLEIVKLLLEKG 63

Query: 109 AFIEAKANNGMTPLHLSVWYSIRSEDYATVKTLLEYNADCSAKDNEGKTPLDHLSNGPGS 168
           A + A+  +G TPLH     + R+ +   VK LL++ AD +A+D +G+TPL HL+   G 
Sbjct: 64  ADVNARDKDGNTPLH----LAARNGNLDVVKLLLKHGADVNARDKDGRTPL-HLAAKNGH 118

Query: 169 AKLRELLL 176
            ++ +LLL
Sbjct: 119 LEVVKLLL 126

The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126
>gnl|CDD|163057 TIGR02881, spore_V_K, stage V sporulation protein K Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|200217 TIGR02880, cbbX_cfxQ, probable Rubsico expression protein CbbX Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|177083 CHL00181, cbbX, CbbX; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|188437 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPase EccA Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|165212 PHA02884, PHA02884, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165212 PHA02884, PHA02884, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165089 PHA02716, PHA02716, CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>gnl|CDD|234763 PRK00440, rfc, replication factor C small subunit; Reviewed Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|148114 pfam06309, Torsin, Torsin Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 316
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02791284 ankyrin-like protein; Provisional 99.97
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.97
PHA02791284 ankyrin-like protein; Provisional 99.97
PHA02859209 ankyrin repeat protein; Provisional 99.97
PHA02878477 ankyrin repeat protein; Provisional 99.96
PHA02878477 ankyrin repeat protein; Provisional 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.96
PHA02875413 ankyrin repeat protein; Provisional 99.96
PHA02946446 ankyin-like protein; Provisional 99.96
PHA02875413 ankyrin repeat protein; Provisional 99.96
PHA02874434 ankyrin repeat protein; Provisional 99.96
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.95
PHA02874434 ankyrin repeat protein; Provisional 99.95
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.95
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.95
PHA03100480 ankyrin repeat protein; Provisional 99.95
KOG0508 615 consensus Ankyrin repeat protein [General function 99.95
PHA03100480 ankyrin repeat protein; Provisional 99.95
PHA02946446 ankyin-like protein; Provisional 99.95
PHA02795437 ankyrin-like protein; Provisional 99.94
KOG0508 615 consensus Ankyrin repeat protein [General function 99.94
PHA02989494 ankyrin repeat protein; Provisional 99.94
PHA02876682 ankyrin repeat protein; Provisional 99.94
PHA02798489 ankyrin-like protein; Provisional 99.94
PHA02917 661 ankyrin-like protein; Provisional 99.94
PHA03095 471 ankyrin-like protein; Provisional 99.94
PHA02798489 ankyrin-like protein; Provisional 99.94
PHA02989494 ankyrin repeat protein; Provisional 99.94
PHA03095471 ankyrin-like protein; Provisional 99.94
PHA02876 682 ankyrin repeat protein; Provisional 99.94
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.94
PHA02743166 Viral ankyrin protein; Provisional 99.93
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.93
KOG0510 929 consensus Ankyrin repeat protein [General function 99.93
PLN03192823 Voltage-dependent potassium channel; Provisional 99.93
KOG0514452 consensus Ankyrin repeat protein [General function 99.93
PHA02741169 hypothetical protein; Provisional 99.92
PLN03192823 Voltage-dependent potassium channel; Provisional 99.92
KOG0510 929 consensus Ankyrin repeat protein [General function 99.91
PHA02741169 hypothetical protein; Provisional 99.91
PHA02736154 Viral ankyrin protein; Provisional 99.91
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.91
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.91
PHA02795437 ankyrin-like protein; Provisional 99.9
PHA02884300 ankyrin repeat protein; Provisional 99.9
PHA02743166 Viral ankyrin protein; Provisional 99.9
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.89
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.89
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.89
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.88
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.88
PHA02917 661 ankyrin-like protein; Provisional 99.87
PHA02730672 ankyrin-like protein; Provisional 99.87
PHA02730 672 ankyrin-like protein; Provisional 99.87
COG1222 406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.87
PHA02736154 Viral ankyrin protein; Provisional 99.87
PHA02884300 ankyrin repeat protein; Provisional 99.87
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.86
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.85
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.84
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.84
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 99.84
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.83
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.83
COG1223 368 Predicted ATPase (AAA+ superfamily) [General funct 99.81
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.81
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.81
KOG0730 693 consensus AAA+-type ATPase [Posttranslational modi 99.81
KOG0736 953 consensus Peroxisome assembly factor 2 containing 99.81
KOG0514452 consensus Ankyrin repeat protein [General function 99.81
PHA02792 631 ankyrin-like protein; Provisional 99.8
KOG0739 439 consensus AAA+-type ATPase [Posttranslational modi 99.8
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.8
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 99.79
PHA02792631 ankyrin-like protein; Provisional 99.78
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.77
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.77
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 99.77
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.76
KOG0738 491 consensus AAA+-type ATPase [Posttranslational modi 99.76
KOG0727 408 consensus 26S proteasome regulatory complex, ATPas 99.74
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 99.74
CHL00181 287 cbbX CbbX; Provisional 99.73
TIGR02881 261 spore_V_K stage V sporulation protein K. Members o 99.73
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.72
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 99.71
TIGR02880 284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.7
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.69
KOG0729 435 consensus 26S proteasome regulatory complex, ATPas 99.69
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 99.67
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.66
KOG0728 404 consensus 26S proteasome regulatory complex, ATPas 99.66
KOG0651 388 consensus 26S proteasome regulatory complex, ATPas 99.66
KOG0652 424 consensus 26S proteasome regulatory complex, ATPas 99.65
PLN00020 413 ribulose bisphosphate carboxylase/oxygenase activa 99.65
KOG0726 440 consensus 26S proteasome regulatory complex, ATPas 99.65
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.65
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.64
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.63
KOG0737 386 consensus AAA+-type ATPase [Posttranslational modi 99.63
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 99.62
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.62
CHL00195 489 ycf46 Ycf46; Provisional 99.61
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.6
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.6
PTZ00454 398 26S protease regulatory subunit 6B-like protein; P 99.59
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.59
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.58
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.58
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.58
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.58
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.57
PTZ00361 438 26 proteosome regulatory subunit 4-like protein; P 99.57
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.56
PRK03992 389 proteasome-activating nucleotidase; Provisional 99.56
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.54
CHL00176 638 ftsH cell division protein; Validated 99.52
KOG0740 428 consensus AAA+-type ATPase [Posttranslational modi 99.51
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.49
TIGR01242 364 26Sp45 26S proteasome subunit P45 family. Many pro 99.43
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.38
CHL00206 2281 ycf2 Ycf2; Provisional 99.36
KOG0730 693 consensus AAA+-type ATPase [Posttranslational modi 99.33
PF00004132 AAA: ATPase family associated with various cellula 99.32
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 99.31
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 99.31
KOG0744 423 consensus AAA+-type ATPase [Posttranslational modi 99.2
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 99.17
KOG0783 1267 consensus Uncharacterized conserved protein, conta 99.15
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 99.15
COG2256 436 MGS1 ATPase related to the helicase subunit of the 99.14
PF05496 233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.13
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 99.06
PF1360630 Ank_3: Ankyrin repeat 99.06
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 99.03
KOG0783 1267 consensus Uncharacterized conserved protein, conta 99.01
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 99.0
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.99
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.99
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.98
PF1360630 Ank_3: Ankyrin repeat 98.93
TIGR00390 441 hslU ATP-dependent protease HslVU, ATPase subunit. 98.91
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.9
PRK05201 443 hslU ATP-dependent protease ATP-binding subunit Hs 98.9
KOG0522 560 consensus Ankyrin repeat protein [General function 98.87
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 98.85
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.79
CHL00095 821 clpC Clp protease ATP binding subunit 98.78
PRK05342 412 clpX ATP-dependent protease ATP-binding subunit Cl 98.76
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.75
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.74
KOG0522 560 consensus Ankyrin repeat protein [General function 98.72
COG2255 332 RuvB Holliday junction resolvasome, helicase subun 98.71
KOG2028 554 consensus ATPase related to the helicase subunit o 98.71
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 98.67
KOG0511 516 consensus Ankyrin repeat protein [General function 98.62
KOG2384223 consensus Major histocompatibility complex protein 98.58
KOG0736 953 consensus Peroxisome assembly factor 2 containing 98.57
PRK13342 413 recombination factor protein RarA; Reviewed 98.55
KOG0989 346 consensus Replication factor C, subunit RFC4 [Repl 98.53
TIGR00382 413 clpX endopeptidase Clp ATP-binding regulatory subu 98.53
PRK10865 857 protein disaggregation chaperone; Provisional 98.53
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.52
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.52
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 98.51
KOG2384223 consensus Major histocompatibility complex protein 98.49
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 98.49
KOG0520 975 consensus Uncharacterized conserved protein, conta 98.48
KOG0511 516 consensus Ankyrin repeat protein [General function 98.46
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 98.45
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 98.44
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 98.44
KOG0742 630 consensus AAA+-type ATPase [Posttranslational modi 98.4
PRK04195 482 replication factor C large subunit; Provisional 98.37
KOG0743 457 consensus AAA+-type ATPase [Posttranslational modi 98.37
smart00382148 AAA ATPases associated with a variety of cellular 98.36
PLN03025 319 replication factor C subunit; Provisional 98.36
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 98.35
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 98.33
COG1220 444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 98.31
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 98.31
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 98.3
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 98.28
smart00763 361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.28
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 98.26
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 98.26
KOG0520 975 consensus Uncharacterized conserved protein, conta 98.24
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 98.23
PRK13341 725 recombination factor protein RarA/unknown domain f 98.22
PRK12402 337 replication factor C small subunit 2; Reviewed 98.22
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 98.21
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 98.21
PF05673 249 DUF815: Protein of unknown function (DUF815); Inte 98.19
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 98.17
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 98.17
PF06068 398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 98.16
KOG0991 333 consensus Replication factor C, subunit RFC2 [Repl 98.16
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 98.14
TIGR02640 262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 98.13
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 98.1
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.08
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 98.07
COG1224 450 TIP49 DNA helicase TIP49, TBP-interacting protein 98.06
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.04
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 98.04
PRK08118167 topology modulation protein; Reviewed 98.02
CHL00095 821 clpC Clp protease ATP binding subunit 98.0
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 97.99
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 97.99
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 97.99
PHA02544 316 44 clamp loader, small subunit; Provisional 97.99
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 97.98
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 97.94
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 97.94
PRK07261171 topology modulation protein; Provisional 97.94
PRK07940 394 DNA polymerase III subunit delta'; Validated 97.93
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 97.92
PF01078 206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 97.92
PRK11331 459 5-methylcytosine-specific restriction enzyme subun 97.92
KOG1969 877 consensus DNA replication checkpoint protein CHL12 97.9
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 97.9
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 97.9
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 97.9
PRK00440 319 rfc replication factor C small subunit; Reviewed 97.89
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 97.89
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 97.87
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 97.87
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 97.86
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 97.86
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 97.83
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 97.83
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 97.81
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.8
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 97.79
PRK08181269 transposase; Validated 97.78
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 97.77
KOG0745 564 consensus Putative ATP-dependent Clp-type protease 97.76
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 97.75
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 97.74
PRK00131175 aroK shikimate kinase; Reviewed 97.7
PF07726131 AAA_3: ATPase family associated with various cellu 97.69
TIGR03420 226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 97.68
TIGR01650 327 PD_CobS cobaltochelatase, CobS subunit. This model 97.67
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 97.67
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 97.67
PRK08116268 hypothetical protein; Validated 97.67
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 97.67
PRK07952244 DNA replication protein DnaC; Validated 97.67
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 97.66
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.66
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 97.65
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [P 97.65
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 97.65
PRK06526254 transposase; Provisional 97.64
PRK09183259 transposase/IS protein; Provisional 97.62
PHA02244 383 ATPase-like protein 97.6
PRK06762166 hypothetical protein; Provisional 97.59
PRK12377248 putative replication protein; Provisional 97.59
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.57
PRK10865 857 protein disaggregation chaperone; Provisional 97.57
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 97.54
PRK08939306 primosomal protein DnaI; Reviewed 97.52
KOG2505591 consensus Ankyrin repeat protein [General function 97.52
KOG1942 456 consensus DNA helicase, TBP-interacting protein [R 97.51
COG0703 172 AroK Shikimate kinase [Amino acid transport and me 97.5
PRK13947171 shikimate kinase; Provisional 97.5
PRK13948 182 shikimate kinase; Provisional 97.49
COG0470 325 HolB ATPase involved in DNA replication [DNA repli 97.48
COG2607 287 Predicted ATPase (AAA+ superfamily) [General funct 97.48
PRK06835329 DNA replication protein DnaC; Validated 97.48
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 97.48
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 97.47
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 97.46
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 97.46
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 97.45
COG0606 490 Predicted ATPase with chaperone activity [Posttran 97.44
PRK08903 227 DnaA regulatory inactivator Hda; Validated 97.43
PRK00411 394 cdc6 cell division control protein 6; Reviewed 97.43
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 97.43
PRK05564 313 DNA polymerase III subunit delta'; Validated 97.42
CHL00081 350 chlI Mg-protoporyphyrin IX chelatase 97.41
PRK06921266 hypothetical protein; Provisional 97.41
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 97.41
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 97.39
PRK00149 450 dnaA chromosomal replication initiation protein; R 97.39
PRK14532 188 adenylate kinase; Provisional 97.39
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 97.38
KOG1051 898 consensus Chaperone HSP104 and related ATP-depende 97.37
PRK00625 173 shikimate kinase; Provisional 97.34
PRK13407 334 bchI magnesium chelatase subunit I; Provisional 97.33
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 97.33
PRK12422 445 chromosomal replication initiation protein; Provis 97.31
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.31
PRK15455 644 PrkA family serine protein kinase; Provisional 97.3
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 97.3
PRK06893 229 DNA replication initiation factor; Validated 97.3
PRK13949169 shikimate kinase; Provisional 97.3
PRK13946 184 shikimate kinase; Provisional 97.29
COG0714 329 MoxR-like ATPases [General function prediction onl 97.28
PRK03839 180 putative kinase; Provisional 97.27
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 97.26
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 97.26
PLN02200 234 adenylate kinase family protein 97.26
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 97.26
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 97.25
PRK06217 183 hypothetical protein; Validated 97.25
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 97.24
KOG2170 344 consensus ATPase of the AAA+ superfamily [General 97.24
PF1324576 AAA_19: Part of AAA domain 97.23
PRK13531 498 regulatory ATPase RavA; Provisional 97.23
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 97.22
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 97.21
COG0563 178 Adk Adenylate kinase and related kinases [Nucleoti 97.21
TIGR03574 249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 97.2
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 97.18
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 97.16
PHA00729 226 NTP-binding motif containing protein 97.16
cd01428 194 ADK Adenylate kinase (ADK) catalyzes the reversibl 97.15
TIGR00362 405 DnaA chromosomal replication initiator protein Dna 97.15
PRK14088 440 dnaA chromosomal replication initiation protein; P 97.14
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.14
PTZ00088 229 adenylate kinase 1; Provisional 97.14
PRK07471 365 DNA polymerase III subunit delta'; Validated 97.12
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 97.12
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 97.11
PRK14531 183 adenylate kinase; Provisional 97.09
PRK05057172 aroK shikimate kinase I; Reviewed 97.08
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome 97.07
TIGR01359 183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 97.06
PRK14530 215 adenylate kinase; Provisional 97.03
COG1102 179 Cmk Cytidylate kinase [Nucleotide transport and me 97.03
PRK14527 191 adenylate kinase; Provisional 97.03
PLN02674 244 adenylate kinase 97.03
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 97.03
PRK08084 235 DNA replication initiation factor; Provisional 97.02
KOG2505591 consensus Ankyrin repeat protein [General function 97.01
PRK00279 215 adk adenylate kinase; Reviewed 97.01
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 96.99
PRK07399 314 DNA polymerase III subunit delta'; Validated 96.99
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 96.98
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 96.97
PRK09112 351 DNA polymerase III subunit delta'; Validated 96.96
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 96.95
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 96.95
PRK08233 182 hypothetical protein; Provisional 96.94
PRK11608 326 pspF phage shock protein operon transcriptional ac 96.94
TIGR00235 207 udk uridine kinase. Model contains a number of lon 96.94
PLN02459 261 probable adenylate kinase 96.94
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 96.93
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 96.93
PF13173128 AAA_14: AAA domain 96.92
PRK06547172 hypothetical protein; Provisional 96.92
TIGR01351 210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 96.91
PRK14529 223 adenylate kinase; Provisional 96.91
COG4088 261 Predicted nucleotide kinase [Nucleotide transport 96.91
PRK05642 234 DNA replication initiation factor; Validated 96.88
PRK06620214 hypothetical protein; Validated 96.88
PRK05541176 adenylylsulfate kinase; Provisional 96.86
PRK14528 186 adenylate kinase; Provisional 96.86
PRK13765 637 ATP-dependent protease Lon; Provisional 96.85
PRK02496 184 adk adenylate kinase; Provisional 96.84
PRK08727 233 hypothetical protein; Validated 96.83
PRK00889175 adenylylsulfate kinase; Provisional 96.83
PRK14526 211 adenylate kinase; Provisional 96.81
PRK15429 686 formate hydrogenlyase transcriptional activator Fh 96.79
PRK03846 198 adenylylsulfate kinase; Provisional 96.78
TIGR01618 220 phage_P_loop phage nucleotide-binding protein. Thi 96.78
PF08303 168 tRNA_lig_kinase: tRNA ligase kinase domain; InterP 96.77
TIGR01360 188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 96.75
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 96.71
PHA02774613 E1; Provisional 96.7
PRK04040 188 adenylate kinase; Provisional 96.7
PF00485 194 PRK: Phosphoribulokinase / Uridine kinase family; 96.68
PRK03731 171 aroL shikimate kinase II; Reviewed 96.68
PRK14086 617 dnaA chromosomal replication initiation protein; P 96.68
COG1936 180 Predicted nucleotide kinase (related to CMP and AM 96.67
cd01131 198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.66
TIGR02974 329 phageshock_pspF psp operon transcriptional activat 96.66
PRK09435 332 membrane ATPase/protein kinase; Provisional 96.66
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 96.65
TIGR03575 340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 96.64
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 96.64
PF00308 219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 96.64
PRK05480 209 uridine/cytidine kinase; Provisional 96.63
TIGR00678 188 holB DNA polymerase III, delta' subunit. At positi 96.61
PRK08058 329 DNA polymerase III subunit delta'; Validated 96.6
cd01129 264 PulE-GspE PulE/GspE The type II secretory pathway 96.59
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.58
TIGR00368 499 Mg chelatase-related protein. The N-terminal end m 96.58
PRK10646153 ADP-binding protein; Provisional 96.56
KOG0990 360 consensus Replication factor C, subunit RFC5 [Repl 96.56
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.55
PRK10536 262 hypothetical protein; Provisional 96.54
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 96.54
PRK10078 186 ribose 1,5-bisphosphokinase; Provisional 96.53
PRK06696 223 uridine kinase; Validated 96.51
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 96.51
PRK05439 311 pantothenate kinase; Provisional 96.5
TIGR02030 337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 96.5
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 96.5
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 96.5
PRK14087 450 dnaA chromosomal replication initiation protein; P 96.49
cd02024 187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 96.48
PRK15424 538 propionate catabolism operon regulatory protein Pr 96.47
PF13086 236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 96.47
TIGR02329 526 propionate_PrpR propionate catabolism operon regul 96.45
PHA02530 300 pseT polynucleotide kinase; Provisional 96.44
KOG2035 351 consensus Replication factor C, subunit RFC3 [Cell 96.44
PRK08154 309 anaerobic benzoate catabolism transcriptional regu 96.43
PRK04220 301 2-phosphoglycerate kinase; Provisional 96.42
PTZ00112 1164 origin recognition complex 1 protein; Provisional 96.41
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 96.4
COG0802149 Predicted ATPase or kinase [General function predi 96.39
PRK13975 196 thymidylate kinase; Provisional 96.39
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 96.38
TIGR02322 179 phosphon_PhnN phosphonate metabolism protein/1,5-b 96.38
COG1618 179 Predicted nucleotide kinase [Nucleotide transport 96.36
PF08433 270 KTI12: Chromatin associated protein KTI12 ; InterP 96.35
TIGR01526325 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr 96.35
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 96.35
cd03283 199 ABC_MutS-like MutS-like homolog in eukaryotes. The 96.35
TIGR00750 300 lao LAO/AO transport system ATPase. Mutations have 96.33
PRK09376 416 rho transcription termination factor Rho; Provisio 96.32
PRK14021 542 bifunctional shikimate kinase/3-dehydroquinate syn 96.32
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.32
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 96.3
PRK09087 226 hypothetical protein; Validated 96.3
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 96.29
TIGR02237 209 recomb_radB DNA repair and recombination protein R 96.28
PF01745 233 IPT: Isopentenyl transferase; InterPro: IPR002648 96.27
COG1117 253 PstB ABC-type phosphate transport system, ATPase c 96.26
PHA02624 647 large T antigen; Provisional 96.26
PRK07667 193 uridine kinase; Provisional 96.26
PRK12339 197 2-phosphoglycerate kinase; Provisional 96.24
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 96.23
COG1855 604 ATPase (PilT family) [General function prediction 96.22
PF12774 231 AAA_6: Hydrolytic ATP binding site of dynein motor 96.21
PRK10820 520 DNA-binding transcriptional regulator TyrR; Provis 96.2
PRK13894319 conjugal transfer ATPase TrbB; Provisional 96.2
PRK01184 184 hypothetical protein; Provisional 96.2
PRK09270 229 nucleoside triphosphate hydrolase domain-containin 96.19
TIGR00554 290 panK_bact pantothenate kinase, bacterial type. Sho 96.18
cd02022 179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 96.17
COG1221 403 PspF Transcriptional regulators containing an AAA- 96.17
TIGR01817 534 nifA Nif-specific regulatory protein. This model r 96.16
PRK08099 399 bifunctional DNA-binding transcriptional repressor 96.16
COG1126 240 GlnQ ABC-type polar amino acid transport system, A 96.16
KOG1970 634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 96.16
TIGR00041 195 DTMP_kinase thymidylate kinase. Function: phosphor 96.16
PRK13808 333 adenylate kinase; Provisional 96.15
PRK13833 323 conjugal transfer protein TrbB; Provisional 96.15
TIGR03015 269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 96.15
cd02023 198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 96.15
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 96.14
COG1116 248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 96.14
PRK12338 319 hypothetical protein; Provisional 96.13
PRK15453 290 phosphoribulokinase; Provisional 96.11
TIGR01420 343 pilT_fam pilus retraction protein PilT. This model 96.11
PRK00300 205 gmk guanylate kinase; Provisional 96.11
PF13604 196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 96.11
PRK11388 638 DNA-binding transcriptional regulator DhaR; Provis 96.1
cd01672 200 TMPK Thymidine monophosphate kinase (TMPK), also k 96.09
cd02028 179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 96.09
PF05729166 NACHT: NACHT domain 96.08
COG4650 531 RtcR Sigma54-dependent transcription regulator con 96.08
PRK09825176 idnK D-gluconate kinase; Provisional 96.07
PF1355562 AAA_29: P-loop containing region of AAA domain 96.05
PRK14730 195 coaE dephospho-CoA kinase; Provisional 96.05
PF01202 158 SKI: Shikimate kinase; InterPro: IPR000623 Shikima 96.04
PRK04182 180 cytidylate kinase; Provisional 96.03
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 96.02
cd02025 220 PanK Pantothenate kinase (PanK) catalyzes the phos 96.02
PTZ00301 210 uridine kinase; Provisional 96.01
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 96.01
PRK14738 206 gmk guanylate kinase; Provisional 95.99
TIGR01663526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 95.99
PRK10416 318 signal recognition particle-docking protein FtsY; 95.98
PRK06761 282 hypothetical protein; Provisional 95.98
PRK08356 195 hypothetical protein; Provisional 95.98
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 95.98
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 95.97
PRK11889 436 flhF flagellar biosynthesis regulator FlhF; Provis 95.97
COG1703 323 ArgK Putative periplasmic protein kinase ArgK and 95.96
PRK14722 374 flhF flagellar biosynthesis regulator FlhF; Provis 95.96
TIGR00064 272 ftsY signal recognition particle-docking protein F 95.95
cd03115173 SRP The signal recognition particle (SRP) mediates 95.95
TIGR02524 358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 95.92
TIGR02525 372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 95.91
cd01124 187 KaiC KaiC is a circadian clock protein primarily f 95.91
PF03308 266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 95.9
PF01591 222 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR0130 95.88
TIGR03263 180 guanyl_kin guanylate kinase. Members of this famil 95.87
cd01918149 HprK_C HprK/P, the bifunctional histidine-containi 95.86
COG0645170 Predicted kinase [General function prediction only 95.86
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 95.84
PRK05707 328 DNA polymerase III subunit delta'; Validated 95.83
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 95.82
KOG2680 454 consensus DNA helicase TIP49, TBP-interacting prot 95.8
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=3.6e-39  Score=237.48  Aligned_cols=170  Identities=28%  Similarity=0.382  Sum_probs=155.9

Q ss_pred             cCCCCChhhHHHHHhcCCHHHHHHHHhhCCCcccCCCCCCCCcHHHHHHhCCCHHHHHHHHcCCCCCccccccccCCCCh
Q 021192            8 RSRSAKPATIHGCAQSGDLLAFQRLLRENPSLLNERNPVMAQTPLHVSAGYNKAEIVKSLLEWPGNDKVELEAQNMYGET   87 (316)
Q Consensus         8 ~~~~~~~t~L~~A~~~g~~~~v~~ll~~~~~~~~~~~~~~g~t~Lh~A~~~g~~~~v~~Ll~~~~~~~~~~~~~~~~g~t   87 (316)
                      +.+.+|.|||||||..|+.+++.+|+...+..+|..|+. |+||||.|+..|+.++|+.|+.+   .++|+|..++.|+|
T Consensus        33 r~dqD~Rt~LHwa~S~g~~eiv~fLlsq~nv~~ddkDda-GWtPlhia~s~g~~evVk~Ll~r---~~advna~tn~G~T  108 (226)
T KOG4412|consen   33 RDDQDGRTPLHWACSFGHVEIVYFLLSQPNVKPDDKDDA-GWTPLHIAASNGNDEVVKELLNR---SGADVNATTNGGQT  108 (226)
T ss_pred             cccccCCceeeeeeecCchhHHHHHHhcCCCCCCCcccc-CCchhhhhhhcCcHHHHHHHhcC---CCCCcceecCCCcc
Confidence            345689999999999999999999998888889999887 99999999999999999999994   59999999999999


Q ss_pred             HHHHHHHcCCHHHHHHHHhcCCCccccccCCCcHHHHHhhhhhccCcHHHHHHHHhcCCCCCCCCCCCCCccccccCCCC
Q 021192           88 PLHMAAKNGCNEAAKLLLAHGAFIEAKANNGMTPLHLSVWYSIRSEDYATVKTLLEYNADCSAKDNEGKTPLDHLSNGPG  167 (316)
Q Consensus        88 ~Lh~a~~~~~~~~~~~Ll~~g~~~~~~~~~g~t~L~~a~~~~~~~~~~~~~~~Ll~~ga~~~~~~~~g~tpl~~~a~~~~  167 (316)
                      |||||+..|+.+++++|++.|+.++++|..|.||||-|+    ..|..+++++|+..|+.+|.+|..|+||||++.+.+ 
T Consensus       109 ~LHyAagK~r~eIaqlLle~ga~i~~kD~~~qtplHRAA----avGklkvie~Li~~~a~~n~qDk~G~TpL~~al~e~-  183 (226)
T KOG4412|consen  109 CLHYAAGKGRLEIAQLLLEKGALIRIKDKQGQTPLHRAA----AVGKLKVIEYLISQGAPLNTQDKYGFTPLHHALAEG-  183 (226)
T ss_pred             eehhhhcCChhhHHHHHHhcCCCCcccccccCchhHHHH----hccchhhHHHHHhcCCCCCcccccCccHHHHHHhcc-
Confidence            999999999999999999999999999999999999999    899999999999999999999999999999885544 


Q ss_pred             hHHHHHHHHHhHHHHHHHh
Q 021192          168 SAKLRELLLWHSEEQRKRR  186 (316)
Q Consensus       168 ~~~~~~lL~~~~~~~~~~~  186 (316)
                      +.++..+|.+++++....+
T Consensus       184 ~~d~a~lLV~~gAd~~~ed  202 (226)
T KOG4412|consen  184 HPDVAVLLVRAGADTDRED  202 (226)
T ss_pred             CchHHHHHHHhccceeecc
Confidence            7788888888886654433

>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>PF08303 tRNA_lig_kinase: tRNA ligase kinase domain; InterPro: IPR015966 This entry represents a kinase domain found in fungal tRNA ligases [] Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PRK10646 ADP-binding protein; Provisional Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>COG0802 Predicted ATPase or kinase [General function prediction only] Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>PF01591 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR013079 6-Phosphofructo-2-kinase (2 Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria Back     alignment and domain information
>COG0645 Predicted kinase [General function prediction only] Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query316
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 5e-18
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 3e-17
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 2e-07
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 6e-16
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 2e-05
3syl_A 309 Crystal Structure Of The Aaa+ Protein Cbbx, Native 3e-15
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 4e-15
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 2e-07
3zuh_A 289 Negative Stain Em Map Of The Aaa Protein Cbbx, A Re 4e-15
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 5e-15
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 9e-08
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 9e-15
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 6e-07
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-14
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-06
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-14
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 4e-07
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-14
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-06
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 4e-14
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 8e-06
3syk_A 309 Crystal Structure Of The Aaa+ Protein Cbbx, Selenom 4e-14
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 5e-14
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 3e-06
2xee_A157 Structural Determinants For Improved Thermal Stabil 8e-14
2xee_A157 Structural Determinants For Improved Thermal Stabil 3e-08
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 9e-14
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 5e-06
2xeh_A157 Structural Determinants For Improved Thermal Stabil 1e-13
2xeh_A157 Structural Determinants For Improved Thermal Stabil 2e-11
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 2e-13
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 9e-08
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 2e-13
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 2e-13
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 2e-08
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-13
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-08
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 2e-13
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 7e-08
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 3e-13
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 5e-05
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 4e-13
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 2e-06
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 5e-13
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 2e-06
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 6e-13
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 1e-10
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 2e-12
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 9e-08
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 3e-12
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 7e-05
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 3e-12
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 7e-05
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 3e-12
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 7e-05
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 3e-12
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 7e-12
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 7e-11
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 8e-11
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 2e-10
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 2e-10
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 2e-10
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 3e-10
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 2e-09
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 6e-10
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 8e-10
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 1e-09
1uoh_A226 Human Gankyrin Length = 226 3e-09
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 3e-09
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 4e-09
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 5e-09
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 1e-08
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 1e-08
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 1e-08
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 1e-08
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 1e-08
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 2e-08
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 4e-08
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 5e-08
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 6e-08
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 7e-08
3uxg_A172 Crystal Structure Of Rfxank Length = 172 7e-08
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 8e-08
2rfa_A232 Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat 5e-07
2xen_A91 Structural Determinants For Improved Thermal Stabil 1e-06
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 2e-06
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 2e-06
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 2e-06
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 2e-06
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 3e-06
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 3e-06
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 3e-06
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 4e-06
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 6e-06
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 6e-06
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 6e-06
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 1e-05
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 1e-05
1oy3_D282 Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer 2e-05
1k3z_D282 X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodi 2e-05
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 2e-05
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 3e-05
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 6e-05
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 6e-05
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 7e-05
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 7e-05
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 1e-04
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 2e-04
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 2e-04
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 7e-04
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure 
Iteration: 1

 Score = 88.2 bits (217), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 77/128 (60%), Gaps = 9/128 (7%)
Query: 49  QTPLHVSAGYNKAEIVKSLLEWPGNDKVELEAQNMYGETPLHMAAKNGCNEAAKLLLAHG 108
           +TPLH++A     E+VK LLE       ++ A++  G TPLH+AA+NG  E  KLLL  G
Sbjct: 3   RTPLHLAARNGHLEVVKLLLEA----GADVNAKDKNGRTPLHLAARNGHLEVVKLLLEAG 58
Query: 109 AFIEAKANNGMTPLHLSVWYSIRSEDYATVKTLLEYNADCSAKDNEGKTPLDHLSNGPGS 168
           A + AK  NG TPLHL+     R+     VK LLE  AD +AKD  G+TPL HL+   G 
Sbjct: 59  ADVNAKDKNGRTPLHLAA----RNGHLEVVKLLLEAGADVNAKDKNGRTPL-HLAARNGH 113
Query: 169 AKLRELLL 176
            ++ +LLL
Sbjct: 114 LEVVKLLL 121
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|3SYL|A Chain A, Crystal Structure Of The Aaa+ Protein Cbbx, Native Structure Length = 309 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3ZUH|A Chain A, Negative Stain Em Map Of The Aaa Protein Cbbx, A Red-Type Rubisco Activase From R. Sphaeroides Length = 289 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3SYK|A Chain A, Crystal Structure Of The Aaa+ Protein Cbbx, Selenomethionine Structure Length = 309 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|2RFA|A Chain A, Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat Domain Length = 232 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|1OY3|D Chain D, Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|1K3Z|D Chain D, X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query316
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-34
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-31
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-19
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 8e-14
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-05
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-33
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-22
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-13
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-32
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-29
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-20
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-32
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-30
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-29
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-18
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-32
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-27
3hra_A201 Ankyrin repeat family protein; structural protein; 7e-21
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-32
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 8e-31
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-21
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-11
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-32
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-23
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-23
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-15
3deo_A183 Signal recognition particle 43 kDa protein; chloro 7e-14
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 7e-32
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-22
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-06
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-31
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-31
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-31
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-25
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-22
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-31
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-30
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-26
3v31_A167 Ankyrin repeat family A protein 2; structural geno 8e-21
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-05
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-31
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-24
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-22
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-07
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 5e-31
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 6e-30
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-21
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-31
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-27
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-23
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-15
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 8e-31
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 9e-24
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-22
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 5e-15
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 9e-06
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-30
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-27
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-27
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-26
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-21
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-20
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-30
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-30
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-28
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-21
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-21
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-30
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-30
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-24
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-23
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-18
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-12
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-30
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-29
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-28
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-23
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-22
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-30
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-23
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-21
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 7e-13
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-11
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-30
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-26
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-25
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-25
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-21
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 8e-05
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-30
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-23
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-19
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-12
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-30
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-27
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-21
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 7e-15
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-05
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 8e-30
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-22
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-21
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-07
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 8e-30
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-29
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-17
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-30
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-29
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-28
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-28
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-28
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-26
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-24
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-21
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-09
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-29
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-27
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-26
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-23
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-22
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-29
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-29
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-26
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-25
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-25
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-17
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-11
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-29
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-28
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-26
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-22
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-19
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-14
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 4e-29
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-26
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-26
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-28
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-26
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-24
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-19
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-13
2rfa_A232 Transient receptor potential cation channel subfa 2e-28
2rfa_A232 Transient receptor potential cation channel subfa 3e-27
2rfa_A232 Transient receptor potential cation channel subfa 9e-25
2rfa_A232 Transient receptor potential cation channel subfa 3e-22
2rfa_A232 Transient receptor potential cation channel subfa 9e-20
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 5e-28
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-24
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 8e-21
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-19
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-18
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 5e-14
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-06
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-27
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-26
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-24
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-21
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-14
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-27
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-27
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-22
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-16
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-04
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-26
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-24
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-22
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-22
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-19
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-13
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 6e-26
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-20
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-20
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 8e-14
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 9e-08
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-26
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-24
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-24
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-20
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-12
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 9e-26
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-23
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-18
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 7e-15
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 8e-14
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-25
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-25
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-24
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-23
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-21
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 5e-20
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-18
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 2e-07
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-25
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-22
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-18
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-16
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-04
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-25
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-24
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 5e-20
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-19
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-09
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 6e-05
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-25
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 8e-25
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-18
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-18
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 4e-24
2etb_A256 Transient receptor potential cation channel subfam 2e-23
2etb_A256 Transient receptor potential cation channel subfam 2e-20
2etb_A256 Transient receptor potential cation channel subfam 2e-07
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-23
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-21
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-15
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-05
2pnn_A273 Transient receptor potential cation channel subfa 7e-23
2pnn_A273 Transient receptor potential cation channel subfa 1e-17
2pnn_A273 Transient receptor potential cation channel subfa 3e-12
2pnn_A273 Transient receptor potential cation channel subfa 1e-07
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-22
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-19
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-12
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-21
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-16
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-20
1sw6_A327 Regulatory protein SWI6; transcription regulation, 5e-16
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-14
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-13
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-12
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-11
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-08
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 5e-08
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-08
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-05
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-04
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-12
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 6e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 4e-07
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 4e-11
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-10
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 7e-07
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-07
2chg_A 226 Replication factor C small subunit; DNA-binding pr 8e-05
2chq_A 319 Replication factor C small subunit; DNA-binding pr 1e-04
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 2e-04
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 4e-04
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
 Score =  121 bits (307), Expect = 4e-34
 Identities = 37/162 (22%), Positives = 69/162 (42%), Gaps = 10/162 (6%)

Query: 17  IHGCAQSGDLLAFQRLLRENPSLLNERNPVMAQTPLHVSAGYNKAEIVKSLLEWPGNDKV 76
           I    + G+ +A +  L    + LN+ +     +PLH +    ++ +V+ L+        
Sbjct: 9   IFTQCREGNAVAVRLWLDNTENDLNQGDD-HGFSPLHWACREGRSAVVEMLIMR----GA 63

Query: 77  ELEAQNMYGETPLHMAAKNGCNEAAKLLLAHGAFIEAKANNGMTPLHLSVWYSIRSEDYA 136
            +   N   +TPLH+AA +G  +  + LL + A I A   +G  PLH + ++    +   
Sbjct: 64  RINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWG--QDQ-- 119

Query: 137 TVKTLLEYNADCSAKDNEGKTPLDHLSNGPGSAKLRELLLWH 178
             + L+   A  S  +  G+ P+   +  P    LRE     
Sbjct: 120 VAEDLVANGALVSICNKYGEMPV-DKAKAPLRELLRERAEKM 160
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Length = 226 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Length = 319 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Length = 327 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query316
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 100.0
3v30_A172 DNA-binding protein rfxank; structural genomics co 100.0
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 100.0
3v31_A167 Ankyrin repeat family A protein 2; structural geno 100.0
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 100.0
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.98
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.98
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.98
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.98
2rfa_A232 Transient receptor potential cation channel subfa 99.98
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.98
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.98
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.98
3hra_A201 Ankyrin repeat family protein; structural protein; 99.98
2rfa_A232 Transient receptor potential cation channel subfa 99.97
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.97
2etb_A256 Transient receptor potential cation channel subfam 99.97
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.97
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.97
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.97
3hra_A201 Ankyrin repeat family protein; structural protein; 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.97
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.97
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.97
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.97
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.97
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.97
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.97
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.97
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.97
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.97
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.97
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.97
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.97
2etb_A256 Transient receptor potential cation channel subfam 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.97
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.97
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.97
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.97
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.97
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.97
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.97
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.97
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.96
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.96
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.96
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.96
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.96
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.96
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.96
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.96
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.96
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.96
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.96
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.96
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.96
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.96
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.96
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.96
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.96
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.96
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.96
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.95
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.95
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.95
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.95
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.95
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.95
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.95
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.94
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.94
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.94
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.94
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.94
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.94
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.94
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.94
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.94
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.94
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.94
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.94
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.94
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.93
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.93
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.93
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.92
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.92
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.92
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.92
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.91
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.91
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.91
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.9
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.89
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.89
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.89
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.88
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.88
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.88
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.86
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 99.83
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.83
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.81
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 99.81
4b4t_H 467 26S protease regulatory subunit 7 homolog; hydrola 99.8
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.79
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 99.79
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 99.79
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 99.67
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 99.67
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.54
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 99.54
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.54
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 99.51
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 99.5
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.5
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 99.48
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.46
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 99.46
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.43
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.4
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 99.39
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 99.39
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 99.38
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.38
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.36
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.35
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 99.34
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.32
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.3
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.24
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.22
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.16
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 99.12
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.05
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 98.85
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 98.83
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 98.78
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 98.77
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 98.77
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 98.69
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 98.67
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 98.66
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 98.66
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 98.65
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 98.58
3pvs_A 447 Replication-associated recombination protein A; ma 98.58
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 98.54
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 98.52
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 98.51
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 98.5
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 98.46
3co5_A143 Putative two-component system transcriptional RES 98.43
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 98.38
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 98.35
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 98.34
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 98.3
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 98.28
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 98.24
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 98.21
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 98.16
2chg_A 226 Replication factor C small subunit; DNA-binding pr 98.12
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 98.09
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 98.06
2chq_A 319 Replication factor C small subunit; DNA-binding pr 98.06
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 98.06
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 98.05
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 98.03
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 98.02
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 97.97
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 97.97
1njg_A 250 DNA polymerase III subunit gamma; rossman-like fol 97.96
1tue_A212 Replication protein E1; helicase, replication, E1E 97.91
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.9
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 97.9
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 97.85
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 97.82
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 97.81
2r44_A 331 Uncharacterized protein; putative ATPase, structur 97.8
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 97.77
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.75
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 97.74
2gno_A 305 DNA polymerase III, gamma subunit-related protein; 97.73
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 97.72
2qgz_A308 Helicase loader, putative primosome component; str 97.7
3bos_A 242 Putative DNA replication factor; P-loop containing 97.61
1qhx_A 178 CPT, protein (chloramphenicol phosphotransferase); 97.59
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.55
2vhj_A 331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 97.51
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 97.49
3vaa_A 199 Shikimate kinase, SK; structural genomics, center 97.46
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 97.43
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 97.36
3trf_A 185 Shikimate kinase, SK; amino acid biosynthesis, tra 97.32
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 97.31
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 97.21
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 97.2
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 97.16
2cdn_A 201 Adenylate kinase; phosphoryl transfer, associative 97.14
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 97.13
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 97.12
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 97.12
2iyv_A 184 Shikimate kinase, SK; transferase, aromatic amino 97.12
1via_A175 Shikimate kinase; structural genomics, transferase 97.12
2ze6_A 253 Isopentenyl transferase; crown GALL tumor, cytokin 97.11
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 97.11
2rhm_A 193 Putative kinase; P-loop containing nucleoside trip 97.08
3umf_A 217 Adenylate kinase; rossmann fold, transferase; 2.05 97.05
1aky_A 220 Adenylate kinase; ATP:AMP phosphotransferase, myok 97.04
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 97.03
1nn5_A 215 Similar to deoxythymidylate kinase (thymidylate K; 97.02
1nks_A 194 Adenylate kinase; thermophilic, transferase; HET: 97.02
3t61_A 202 Gluconokinase; PSI-biology, structural genomics, p 97.02
1kag_A173 SKI, shikimate kinase I; transferase, structural g 97.01
3tlx_A 243 Adenylate kinase 2; structural genomics, structura 96.96
1zp6_A 191 Hypothetical protein ATU3015; alpha-beta protein., 96.96
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 96.94
2c95_A 196 Adenylate kinase 1; transferase, AP4A, nucleotide 96.94
3uie_A 200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 96.93
3sr0_A 206 Adenylate kinase; phosphoryl transfer analogue, AL 96.93
1ak2_A 233 Adenylate kinase isoenzyme-2; nucleoside monophosp 96.9
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 96.88
1ly1_A 181 Polynucleotide kinase; PNK, phosphatase, transfera 96.88
2wwf_A 212 Thymidilate kinase, putative; transferase, malaria 96.87
1zak_A 222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 96.87
2vli_A 183 Antibiotic resistance protein; transferase, tunica 96.86
1kht_A 192 Adenylate kinase; phosphotransferase, signaling pr 96.86
1tev_A 196 UMP-CMP kinase; ploop, NMP binding region, LID reg 96.86
3fb4_A 216 Adenylate kinase; psychrophIle, phosphotransferase 96.85
3dl0_A 216 Adenylate kinase; phosphotransferase, zinc coordin 96.85
1qf9_A 194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 96.84
2bwj_A 199 Adenylate kinase 5; phosphoryl transfer reaction, 96.84
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 96.82
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 96.82
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 96.81
3cm0_A 186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 96.81
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 96.8
1ukz_A 203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 96.8
1zd8_A 227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 96.79
3lw7_A 179 Adenylate kinase related protein (ADKA-like); AMP, 96.78
1ye8_A 178 Protein THEP1, hypothetical UPF0334 kinase-like pr 96.76
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 96.76
2plr_A 213 DTMP kinase, probable thymidylate kinase; TMP-bind 96.74
3be4_A 217 Adenylate kinase; malaria, cryptosporidium parvum 96.72
1e4v_A 214 Adenylate kinase; transferase(phosphotransferase); 96.65
1jjv_A 206 Dephospho-COA kinase; P-loop nucleotide-binding fo 96.63
2bbw_A 246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 96.6
2pbr_A 195 DTMP kinase, thymidylate kinase; transferase, nucl 96.58
2qor_A 204 Guanylate kinase; phosphotransferase, purine metab 96.57
2z0h_A 197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 96.55
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 96.54
2pez_A 179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 96.49
2jaq_A 205 Deoxyguanosine kinase; transferase, deoxyribonucle 96.47
1cke_A 227 CK, MSSA, protein (cytidine monophosphate kinase); 96.47
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 96.47
3c8u_A 208 Fructokinase; YP_612366.1, putative fructose trans 96.45
2if2_A 204 Dephospho-COA kinase; alpha-beta protein, structur 96.44
3r20_A 233 Cytidylate kinase; structural genomics, seattle st 96.44
2xb4_A 223 Adenylate kinase; ATP-binding, nucleotide-binding, 96.43
2r2a_A 199 Uncharacterized protein; zonular occludens toxin, 96.42
2bdt_A 189 BH3686; alpha-beta protein, structural genomics, P 96.42
3tau_A 208 Guanylate kinase, GMP kinase; structural genomics, 96.41
2j41_A 207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 96.4
2qt1_A 207 Nicotinamide riboside kinase 1; non-protein kinase 96.4
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 96.4
3tr0_A 205 Guanylate kinase, GMP kinase; purines, pyrimidines 96.38
1kgd_A 180 CASK, peripheral plasma membrane CASK; maguk, guan 96.37
1z6g_A 218 Guanylate kinase; structural genomics, SGC, struct 96.36
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 96.35
3nwj_A 250 ATSK2; P loop, shikimate, nucleoside monophosphate 96.34
1lvg_A 198 Guanylate kinase, GMP kinase; transferase; HET: AD 96.34
3a00_A 186 Guanylate kinase, GMP kinase; domain movement, dim 96.33
2grj_A 192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 96.33
1svm_A 377 Large T antigen; AAA+ fold, viral protein; HET: AT 96.31
2v54_A 204 DTMP kinase, thymidylate kinase; nucleotide biosyn 96.3
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 96.26
3asz_A 211 Uridine kinase; cytidine phosphorylation, transfer 96.24
3tqc_A 321 Pantothenate kinase; biosynthesis of cofactors, pr 96.18
1m7g_A 211 Adenylylsulfate kinase; APS kinase, transferase, s 96.15
3ney_A 197 55 kDa erythrocyte membrane protein; structural ge 96.11
2jeo_A 245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 96.07
1uj2_A 252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 96.05
3b9q_A 302 Chloroplast SRP receptor homolog, alpha subunit CP 96.03
3ake_A 208 Cytidylate kinase; CMP kinase, CMP complex, open c 96.03
1uf9_A 203 TT1252 protein; P-loop, nucleotide binding domain, 96.03
1zu4_A 320 FTSY; GTPase, signal recognition particle, SRP, re 95.98
4e22_A 252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 95.95
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 95.94
1znw_A 207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 95.93
4eaq_A 229 DTMP kinase, thymidylate kinase; structural genomi 95.92
2i3b_A 189 HCR-ntpase, human cancer-related ntpase; AAA, ross 95.9
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 95.89
1xjc_A169 MOBB protein homolog; structural genomics, midwest 95.88
1gtv_A 214 TMK, thymidylate kinase; transferase, transferase 95.87
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 95.86
2fna_A 357 Conserved hypothetical protein; structural genomic 95.8
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 95.79
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 95.77
1ex7_A 186 Guanylate kinase; substrate-induced FIT, domain mo 95.77
2f6r_A 281 COA synthase, bifunctional coenzyme A synthase; 18 95.76
1rz3_A 201 Hypothetical protein rbstp0775; MCSG, structural g 95.76
1vht_A 218 Dephospho-COA kinase; structural genomics, transfe 95.76
2v9p_A 305 Replication protein E1; AAA+ molecular motor, DNA 95.75
1q3t_A 236 Cytidylate kinase; nucleotide monophosphate kinase 95.73
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 95.67
2og2_A 359 Putative signal recognition particle receptor; nuc 95.66
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 95.66
3gmt_A 230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 95.65
2h92_A 219 Cytidylate kinase; rossmann fold, transferase; HET 95.64
1s96_A 219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 95.61
2w0m_A 235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 95.6
3aez_A 312 Pantothenate kinase; transferase, homodimer, COA b 95.6
3lnc_A 231 Guanylate kinase, GMP kinase; ALS collaborative cr 95.6
2yhs_A 503 FTSY, cell division protein FTSY; cell cycle, prot 95.58
4a74_A 231 DNA repair and recombination protein RADA; hydrola 95.56
2ehv_A 251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 95.56
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 95.54
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 95.53
1vma_A 306 Cell division protein FTSY; TM0570, structural gen 95.53
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 95.53
1rj9_A 304 FTSY, signal recognition protein; SRP-GTPase domai 95.52
4edh_A 213 DTMP kinase, thymidylate kinase; structural genomi 95.48
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 95.46
2cvh_A 220 DNA repair and recombination protein RADB; filamen 95.43
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 95.4
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 95.39
1m8p_A 573 Sulfate adenylyltransferase; rossmann fold, phosph 95.38
3fdi_A 201 Uncharacterized protein; cytidylate kinase like pr 95.37
3lv8_A 236 DTMP kinase, thymidylate kinase; structural genomi 95.35
1n0w_A 243 DNA repair protein RAD51 homolog 1; DNA repair, ho 95.33
2eyu_A 261 Twitching motility protein PILT; pilus retraction 95.29
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 95.25
3e70_C 328 DPA, signal recognition particle receptor; FTSY, S 95.22
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 95.21
2onk_A 240 Molybdate/tungstate ABC transporter, ATP-binding p 95.21
3tif_A 235 Uncharacterized ABC transporter ATP-binding prote; 95.14
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 95.1
2r8r_A 228 Sensor protein; KDPD, PFAM02702, MCSG, structural 95.1
3b85_A 208 Phosphate starvation-inducible protein; PHOH2, ATP 95.09
1sq5_A 308 Pantothenate kinase; P-loop, transferase; HET: PAU 95.08
1ny5_A 387 Transcriptional regulator (NTRC family); AAA+ ATPa 95.05
3ld9_A 223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 95.01
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 94.98
4tmk_A 213 Protein (thymidylate kinase); ATP:DTMP phosphotran 94.98
1xp8_A 366 RECA protein, recombinase A; recombination, radior 94.96
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 94.95
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 94.95
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 94.94
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 94.94
3v9p_A 227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 94.93
2pcj_A 224 ABC transporter, lipoprotein-releasing system ATP- 94.9
1a7j_A 290 Phosphoribulokinase; transferase, calvin cycle; 2. 94.88
1b0u_A 262 Histidine permease; ABC transporter, transport pro 94.87
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 94.83
2px0_A 296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 94.83
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 94.82
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 94.82
2cbz_A 237 Multidrug resistance-associated protein 1; ABC pro 94.79
2dr3_A 247 UPF0273 protein PH0284; RECA superfamily ATPase, h 94.76
2olj_A 263 Amino acid ABC transporter; ABC domain, ATPase, hy 94.76
3hdt_A 223 Putative kinase; structura genomics, PSI-2, protei 94.75
1g6h_A 257 High-affinity branched-chain amino acid transport 94.74
1lw7_A 365 Transcriptional regulator NADR; NMN, NMN adenylyl 94.74
3p32_A 355 Probable GTPase RV1496/MT1543; structural genomics 94.69
2gks_A 546 Bifunctional SAT/APS kinase; transferase, sulfuryl 94.68
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 94.67
1sgw_A 214 Putative ABC transporter; structural genomics, P p 94.67
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 94.64
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 94.62
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 94.62
2orw_A 184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 94.61
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 94.6
2zu0_C 267 Probable ATP-dependent transporter SUFC; iron-sulf 94.59
2ocp_A 241 DGK, deoxyguanosine kinase; protein-nucleotide com 94.58
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 94.55
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 94.54
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 94.53
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 94.5
2d2e_A 250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 94.5
1vpl_A 256 ABC transporter, ATP-binding protein; TM0544, stru 94.5
2ff7_A 247 Alpha-hemolysin translocation ATP-binding protein 94.49
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 94.48
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 94.47
4g1u_C 266 Hemin import ATP-binding protein HMUV; membrane tr 94.47
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 94.46
3sop_A 270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 94.45
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 94.44
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 94.42
1ji0_A 240 ABC transporter; ATP binding protein, structural g 94.42
2ghi_A 260 Transport protein; multidrug resistance protein, M 94.39
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 94.39
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 94.38
1mv5_A 243 LMRA, multidrug resistance ABC transporter ATP-bin 94.38
3kta_A182 Chromosome segregation protein SMC; structural mai 94.37
2pze_A 229 Cystic fibrosis transmembrane conductance regulat; 94.37
2xxa_A 433 Signal recognition particle protein; protein trans 94.36
2ewv_A 372 Twitching motility protein PILT; pilus retraction 94.34
2qi9_C 249 Vitamin B12 import ATP-binding protein BTUD; inner 94.32
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 94.3
1pzn_A 349 RAD51, DNA repair and recombination protein RAD51, 94.27
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 94.27
3cr8_A 552 Sulfate adenylyltranferase, adenylylsulfate kinase 94.26
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 94.25
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 94.25
3bc1_A 195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 94.23
2f9l_A 199 RAB11B, member RAS oncogene family; RAB11B GTPase, 94.19
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 94.17
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 94.17
3tmk_A 216 Thymidylate kinase; phosphotransferase; HET: T5A; 94.17
2nq2_C 253 Hypothetical ABC transporter ATP-binding protein H 94.16
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 94.13
1nrj_B 218 SR-beta, signal recognition particle receptor beta 94.12
1p5z_B 263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 93.98
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 93.97
2b8t_A 223 Thymidine kinase; deoxyribonucleoside kinase, zinc 93.97
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 93.9
1u94_A 356 RECA protein, recombinase A; homologous recombinat 93.88
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 93.81
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 93.77
4i1u_A 210 Dephospho-COA kinase; structural genomics, niaid, 93.74
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 93.72
1p9r_A 418 General secretion pathway protein E; bacterial typ 93.7
3hjn_A 197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 93.61
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 93.6
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 93.51
2zts_A 251 Putative uncharacterized protein PH0186; KAIC like 93.51
2zej_A 184 Dardarin, leucine-rich repeat kinase 2; parkinson' 93.47
3bh0_A 315 DNAB-like replicative helicase; ATPase, replicatio 93.42
2ged_A193 SR-beta, signal recognition particle receptor beta 93.42
2z43_A 324 DNA repair and recombination protein RADA; archaea 93.4
3lda_A 400 DNA repair protein RAD51; DNA binding protein, ATP 93.4
1v5w_A 343 DMC1, meiotic recombination protein DMC1/LIM15 hom 93.35
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 93.33
3clv_A 208 RAB5 protein, putative; malaria, GTPase, structura 93.32
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 93.32
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 93.31
2ew1_A 201 RAS-related protein RAB-30; G-protein, GTP analogu 93.26
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 93.25
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 93.23
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 93.22
3io5_A 333 Recombination and repair protein; storage dimer, i 93.21
2wji_A165 Ferrous iron transport protein B homolog; membrane 93.21
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 93.2
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 93.15
2gza_A 361 Type IV secretion system protein VIRB11; ATPase, h 93.12
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 93.11
1c9k_A 180 COBU, adenosylcobinamide kinase; alpha/beta struct 93.1
2vp4_A 230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 93.07
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 93.05
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 93.02
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 93.02
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 92.98
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 92.97
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 92.96
2i1q_A 322 DNA repair and recombination protein RADA; ATPase, 92.95
1ls1_A 295 Signal recognition particle protein; FFH, SRP54, S 92.92
3dzd_A 368 Transcriptional regulator (NTRC family); sigma43 a 92.91
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 92.88
1j8m_F 297 SRP54, signal recognition 54 kDa protein; signalin 92.85
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 92.84
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 92.79
1ky3_A 182 GTP-binding protein YPT7P; vesicular traffic, GTP 92.79
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 92.77
1pui_A 210 ENGB, probable GTP-binding protein ENGB; structura 92.75
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 92.75
2j0v_A 212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 92.75
2wsm_A 221 Hydrogenase expression/formation protein (HYPB); m 92.72
3bwd_D 182 RAC-like GTP-binding protein ARAC6; G domain, cyto 92.7
1yrb_A 262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 92.7
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 92.65
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 92.61
1m7b_A 184 RND3/RHOE small GTP-binding protein; small GTPase, 92.61
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 92.61
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 92.59
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 92.56
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 92.56
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 92.56
2hf9_A 226 Probable hydrogenase nickel incorporation protein 92.53
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 92.52
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 92.51
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 92.49
3k53_A 271 Ferrous iron transport protein B; GTPase fold, hel 92.48
3ice_A 422 Transcription termination factor RHO; transcriptio 92.43
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 92.4
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 92.4
2wjg_A 188 FEOB, ferrous iron transport protein B homolog; me 92.38
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 92.38
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 92.37
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=100.00  E-value=1.1e-36  Score=236.70  Aligned_cols=158  Identities=33%  Similarity=0.482  Sum_probs=145.0

Q ss_pred             hhhHHHHHhcCCHHHHHHHHhhCCCcccCCCCCCCCcHHHHHHhCCCHHHHHHHHcCCCCCccccccccCCCChHHHHHH
Q 021192           14 PATIHGCAQSGDLLAFQRLLRENPSLLNERNPVMAQTPLHVSAGYNKAEIVKSLLEWPGNDKVELEAQNMYGETPLHMAA   93 (316)
Q Consensus        14 ~t~L~~A~~~g~~~~v~~ll~~~~~~~~~~~~~~g~t~Lh~A~~~g~~~~v~~Ll~~~~~~~~~~~~~~~~g~t~Lh~a~   93 (316)
                      .++|+.||+.|+.++|+.|| +.|+++|.++.. |.||||+|+..++.+++++|++    .|++++.+|..|+||||+|+
T Consensus         5 g~~L~~Aa~~G~~~~v~~Ll-~~Gadvn~~d~~-g~t~l~~a~~~~~~~~~~~ll~----~gad~~~~d~~g~TpLh~A~   78 (169)
T 4gpm_A            5 GKRLIEAAENGNKDRVKDLI-ENGADVNASDSD-GRTPLHHAAENGHKEVVKLLIS----KGADVNAKDSDGRTPLHHAA   78 (169)
T ss_dssp             HHHHHHHHHTTCHHHHHHHH-HTTCCTTCCCTT-SCCHHHHHHHTTCHHHHHHHHH----TTCCTTCCCTTSCCHHHHHH
T ss_pred             HHHHHHHHHcCCHHHHHHHH-HCCCCCCCcCCC-CCCHHHHHHHcCCHHHHHHHHh----cccchhhhccCCCCHHHHHH
Confidence            35799999999999999998 578999999987 9999999999999999999999    88999999999999999999


Q ss_pred             HcCCHHHHHHHHhcCCCccccccCCCcHHHHHhhhhhccCcHHHHHHHHhcCCCCCCCCCCCCCccccccCCCChHHHHH
Q 021192           94 KNGCNEAAKLLLAHGAFIEAKANNGMTPLHLSVWYSIRSEDYATVKTLLEYNADCSAKDNEGKTPLDHLSNGPGSAKLRE  173 (316)
Q Consensus        94 ~~~~~~~~~~Ll~~g~~~~~~~~~g~t~L~~a~~~~~~~~~~~~~~~Ll~~ga~~~~~~~~g~tpl~~~a~~~~~~~~~~  173 (316)
                      ..|+.+++++|+++|+++|.+|.+|+||||+|+    ..|+.+++++|+++|+|++.+|..|+||||+|+. .+..++++
T Consensus        79 ~~g~~~~v~~Ll~~gadvn~~d~~G~TpLh~A~----~~g~~~~v~~Ll~~gad~~~~d~~G~TpL~~A~~-~g~~~iv~  153 (169)
T 4gpm_A           79 ENGHKEVVKLLISKGADVNAKDSDGRTPLHHAA----ENGHKEVVKLLISKGADVNTSDSDGRTPLDLARE-HGNEEVVK  153 (169)
T ss_dssp             HTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHH----HTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHH-TTCHHHHH
T ss_pred             HcCCHHHHHHHHHCcCCCCCCCCCCCCHHHHHH----HcCCHHHHHHHHHcCCCccccCCCCCCHHHHHHH-cCCHHHHH
Confidence            999999999999999999999999999999999    8999999999999999999999999999976665 45678889


Q ss_pred             HHHHhHHHH
Q 021192          174 LLLWHSEEQ  182 (316)
Q Consensus       174 lL~~~~~~~  182 (316)
                      +|+++|++.
T Consensus       154 ~Ll~~GA~i  162 (169)
T 4gpm_A          154 LLEKQGGWL  162 (169)
T ss_dssp             HHHTC----
T ss_pred             HHHHCCCCc
Confidence            999888764
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 316
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-18
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-15
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-15
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 8e-15
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 7e-14
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-14
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-13
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-11
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-06
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-17
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-10
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-06
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-16
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-16
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-14
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-07
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-07
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-05
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 8e-15
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 4e-13
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 4e-11
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-13
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-11
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 5e-09
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-07
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 7e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-12
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 5e-12
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 0.001
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-12
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-09
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-08
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 6e-05
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-10
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 9e-10
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-09
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-08
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-08
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-09
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-08
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-07
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-08
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 4e-08
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 8e-08
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-07
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 7e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 0.001
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-08
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 5e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 6e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-06
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-06
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-07
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-07
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-06
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 4e-05
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-07
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-05
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 0.003
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-06
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 3e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 3e-06
d1ixza_ 247 c.37.1.20 (A:) AAA domain of cell division protein 6e-06
d1sxja2 253 c.37.1.20 (A:295-547) Replication factor C1 {Baker 1e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 9e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 5e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 0.001
d1lv7a_ 256 c.37.1.20 (A:) AAA domain of cell division protein 1e-04
d1g8pa_ 333 c.37.1.20 (A:) ATPase subunit of magnesium chelata 4e-04
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 0.001
d1ixsb2 239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 0.002
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 0.002
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 0.002
d1in4a2 238 c.37.1.20 (A:17-254) Holliday junction helicase Ru 0.004
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 83.9 bits (206), Expect = 1e-18
 Identities = 44/112 (39%), Positives = 56/112 (50%), Gaps = 8/112 (7%)

Query: 50  TPLHVSAGYNKAEIVKSLLEWPGNDKVELEAQNMYGETPLHMAAKNGCNEAAKLLLAHGA 109
           TPLHV++      IVK+LL+            N+  ETPLHMAA+ G  E AK LL + A
Sbjct: 2   TPLHVASFMGHLPIVKNLLQ----RGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKA 57

Query: 110 FIEAKANNGMTPLHLSVWYSIRSEDYATVKTLLEYNADCSAKDNEGKTPLDH 161
            + AKA +  TPLH +            VK LLE NA+ +     G TPL  
Sbjct: 58  KVNAKAKDDQTPLHCAARIG----HTNMVKLLLENNANPNLATTAGHTPLHI 105
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query316
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.98
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.97
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.97
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.96
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.96
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.96
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.96
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.96
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.96
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.95
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.95
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.95
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.94
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.94
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.94
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.94
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.93
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.93
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.92
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.92
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.91
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.9
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.9
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.9
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.89
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.89
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.87
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.86
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.84
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.81
d1ixza_ 247 AAA domain of cell division protein FtsH {Thermus 99.8
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.8
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 99.8
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.71
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.61
d1w44a_ 321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.51
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 99.5
d1d2na_ 246 Hexamerization domain of N-ethylmalemide-sensitive 99.49
d1in4a2 238 Holliday junction helicase RuvB {Thermotoga mariti 99.13
d1ixsb2 239 Holliday junction helicase RuvB {Thermus thermophi 99.02
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 98.79
d1sxja2 253 Replication factor C1 {Baker's yeast (Saccharomyce 98.78
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 98.67
d1svma_ 362 Papillomavirus large T antigen helicase domain {Si 98.65
d1sxjc2 227 Replication factor C3 {Baker's yeast (Saccharomyce 98.62
d1iqpa2 231 Replication factor C {Archaeon Pyrococcus furiosus 98.62
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.61
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 98.61
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.56
d1sxjb2 224 Replication factor C4 {Baker's yeast (Saccharomyce 98.44
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.4
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 98.4
d1njfa_ 239 delta prime subunit of DNA polymerase III, N-domai 98.37
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.24
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 98.13
d1sxjd2 237 Replication factor C2 {Baker's yeast (Saccharomyce 98.11
d1lw7a2 192 Transcriptional regulator NadR, ribosylnicotinamid 97.94
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.91
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 97.88
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.83
d1zaka1 189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.78
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.77
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.75
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 97.74
d1m8pa3 183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.7
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.66
d1e6ca_ 170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.65
d1zp6a1 176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.64
d2i3ba1 189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.63
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 97.6
d1qhxa_ 178 Chloramphenicol phosphotransferase {Streptomyces v 97.6
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.58
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 97.57
d2bdta1 176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.53
d1qf9a_ 194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.52
d1l8qa2 213 Chromosomal replication initiation factor DnaA {Aq 97.41
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.41
d3adka_ 194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 97.4
d1bifa1 213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.38
d1ak2a1 190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.38
d1x6va3 195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.37
d2cdna1 181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 97.36
d1zina1 182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.34
d1a5ta2 207 delta prime subunit of DNA polymerase III, N-domai 97.33
d1ukza_ 196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.32
d1ye8a1 178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.32
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.32
d1teva_ 194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 97.31
d1akya1 180 Adenylate kinase {Baker's yeast (Saccharomyces cer 97.29
d1s3ga1 182 Adenylate kinase {Bacillus globisporus [TaxId: 145 97.24
d2ak3a1 189 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.22
d1e4va1 179 Adenylate kinase {Escherichia coli [TaxId: 562]} 97.21
d1khta_ 190 Adenylate kinase {Archaeon Methanococcus voltae [T 97.06
d1ckea_ 225 CMP kinase {Escherichia coli [TaxId: 562]} 97.03
d1rz3a_ 198 Hypothetical protein rbstp0775 {Bacillus stearothe 97.01
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 96.99
d2gnoa2 198 gamma subunit of DNA polymerase III, N-domain {The 96.98
d1q3ta_ 223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.92
d1nksa_ 194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.85
d1m7ga_ 208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.68
d2qy9a2 211 GTPase domain of the signal recognition particle r 96.68
d1ny5a2 247 Transcriptional activator sigm54 (NtrC1), C-termin 96.66
d1tuea_205 Replication protein E1 helicase domain {Human papi 96.43
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.37
d1uj2a_ 213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 96.35
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 96.31
d1vmaa2 213 GTPase domain of the signal recognition particle r 96.29
d1gkya_ 186 Guanylate kinase {Baker's yeast (Saccharomyces cer 96.24
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 96.21
d1lvga_ 190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 96.2
d1w36d1 359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.05
d1znwa1 182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.05
d1j8yf2 211 GTPase domain of the signal sequence recognition p 95.98
d1sq5a_ 308 Pantothenate kinase PanK {Escherichia coli [TaxId: 95.93
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.88
d1okkd2 207 GTPase domain of the signal recognition particle r 95.79
d1nn5a_ 209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 95.67
d4tmka_ 210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 95.51
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 95.41
d1gsia_ 208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 95.33
d2awna2 232 Maltose transport protein MalK, N-terminal domain 95.16
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 95.15
d2onka1 240 Molybdate/tungstate import ATP-binding protein Wtp 95.13
d2vp4a1 197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 95.12
d1szpa2 251 DNA repair protein Rad51, catalytic domain {Baker' 95.11
d1ls1a2 207 GTPase domain of the signal sequence recognition p 95.06
d1n0wa_ 242 DNA repair protein Rad51, catalytic domain {Human 95.05
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.02
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 95.02
d1v43a3 239 Hypothetical protein PH0022, N-terminal domain {Py 95.01
d1tf7a2 242 Circadian clock protein KaiC {Synechococcus sp. st 95.01
d1l2ta_ 230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 95.0
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 94.98
d1kgda_ 178 Guanylate kinase-like domain of Cask {Human (Homo 94.96
d1uf9a_ 191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 94.93
d1yrba1 244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 94.93
d1g2912 240 Maltose transport protein MalK, N-terminal domain 94.91
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 94.9
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 94.88
d3dhwc1 240 Methionine import ATP-binding protein MetN {Escher 94.79
d3d31a2 229 Sulfate/molybdate ABC transporter, ATP-binding pro 94.74
d3b60a1 253 Multidrug resistance ABC transporter MsbA, C-termi 94.73
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 94.69
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 94.66
d1s96a_ 205 Guanylate kinase {Escherichia coli [TaxId: 562]} 94.63
d1nrjb_ 209 Signal recognition particle receptor beta-subunit 94.62
d1mo6a1 269 RecA protein, ATPase-domain {Mycobacterium tubercu 94.58
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 94.45
d1oxxk2 242 Glucose transport protein GlcV, N-terminal domain 94.45
d1b0ua_ 258 ATP-binding subunit of the histidine permease {Sal 94.43
d2pmka1 241 Haemolysin B ATP-binding protein {Escherichia coli 94.43
d1jj7a_ 251 Peptide transporter Tap1, C-terminal ABC domain {H 94.41
d1v5wa_ 258 Meiotic recombination protein DMC1/LIM15 homolog { 94.39
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 94.36
d1mv5a_ 242 Multidrug resistance ABC transporter LmrA, C-termi 94.32
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.25
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.16
d1l7vc_ 231 ABC transporter involved in vitamin B12 uptake, Bt 94.12
d1a7ja_ 288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 94.12
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 94.09
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 93.99
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 93.95
d2a5yb3 277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 93.92
d2ocpa1 241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 93.87
d1vpla_ 238 Putative ABC transporter TM0544 {Thermotoga mariti 93.85
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 93.85
d1ji0a_ 240 Branched chain aminoacid ABC transporter {Thermoto 93.85
d1xp8a1 268 RecA protein, ATPase-domain {Deinococcus radiodura 93.84
d2fh5b1 207 Signal recognition particle receptor beta-subunit 93.8
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 93.78
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 93.77
d1tf7a1 242 Circadian clock protein KaiC {Synechococcus sp. st 93.74
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 93.7
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 93.59
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 93.56
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 93.54
d2i1qa2 258 DNA repair protein Rad51, catalytic domain {Archae 93.53
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 93.52
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 93.45
d1g6ha_ 254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 93.44
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.39
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 93.39
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 93.36
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 93.28
d1jjva_ 205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 93.24
d1u94a1 263 RecA protein, ATPase-domain {Escherichia coli [Tax 93.22
d2f7sa1 186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 93.17
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 93.12
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 93.12
d1p5zb_ 241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 93.09
d2hyda1 255 Putative multidrug export ATP-binding/permease pro 93.07
d1wb9a2 234 DNA repair protein MutS, the C-terminal domain {Es 93.07
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 92.95
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 92.93
d1vhta_ 208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 92.93
d1tmka_ 214 Thymidylate kinase {Baker's yeast (Saccharomyces c 92.88
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 92.85
d1ihua1 296 Arsenite-translocating ATPase ArsA {Escherichia co 92.73
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 92.73
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 92.65
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 92.65
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 92.62
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 92.58
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 92.58
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 92.58
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 92.57
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 92.5
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 92.46
d1ewqa2 224 DNA repair protein MutS, the C-terminal domain {Th 92.43
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 92.31
d1vg8a_ 184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 92.28
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 92.21
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 92.18
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 92.18
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 92.08
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 92.02
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 92.02
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 92.01
d2cxxa1 184 GTP-binding protein engB {Pyrococcus horikoshii [T 91.92
d2bcgy1 194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 91.82
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 91.79
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 91.69
d1kmqa_ 177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 91.69
d1mkya2 186 Probable GTPase Der, N-terminal and middle domains 91.62
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 91.61
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 91.6
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 91.46
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 91.46
d1udxa2 180 Obg GTP-binding protein middle domain {Thermus the 91.18
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 91.18
d1lnza2 185 Obg GTP-binding protein middle domain {Bacillus su 91.11
d1m7ba_ 179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 91.07
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 91.07
d1mh1a_ 183 Rac {Human (Homo sapiens) [TaxId: 9606]} 91.03
d2atxa1 185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 90.81
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 90.81
d1deka_ 241 Deoxynucleoside monophosphate kinase {Bacteriophag 90.77
d2ngra_ 191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 90.67
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 90.56
d1egaa1 179 GTPase Era, N-terminal domain {Escherichia coli [T 90.43
d1xpua3 289 Transcription termination factor Rho, ATPase domai 90.23
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 90.11
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 90.01
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 89.89
d1qhla_ 222 Cell division protein MukB {Escherichia coli [TaxI 89.74
d1zcba2 200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 89.7
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 89.64
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 89.31
d1j3ba1 318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 89.2
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 89.14
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 89.02
d1azta2 221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 88.87
d2olra1 313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 88.83
d1h65a_ 257 Chloroplast protein translocon GTPase Toc34 {Garde 88.76
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 88.74
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 88.28
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 88.19
d1nija1 222 Hypothetical protein YjiA, N-terminal domain {Esch 87.86
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 87.81
d1ii2a1 323 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 87.6
d1wb1a4 179 Elongation factor SelB, N-terminal domain {Methano 87.31
d2bcjq2 200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 86.61
d2jdid3 276 Central domain of beta subunit of F1 ATP synthase 86.41
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 86.35
d1e69a_ 308 Smc head domain {Thermotoga maritima [TaxId: 2336] 86.32
d1cp2a_ 269 Nitrogenase iron protein {Clostridium pasteurianum 86.15
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 86.08
d1ihua2 279 Arsenite-translocating ATPase ArsA {Escherichia co 86.08
d1p6xa_ 333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 85.77
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 85.57
d1svsa1 195 Transducin (alpha subunit) {Rat (Rattus norvegicus 85.09
d1osna_ 331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 84.66
d1wp9a1 200 putative ATP-dependent RNA helicase PF2015 {Pyroco 84.37
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 83.51
d1e2ka_ 329 Thymidine kinase {Herpes simplex virus type 1, dif 83.19
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 81.48
d2c78a3 204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 81.27
d2bv3a2 276 Elongation factor G (EF-G), N-terminal (G) domain 81.09
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 81.07
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: 26S proteasome non-ATPase regulatory subunit 10, gankyrin
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.98  E-value=1.2e-31  Score=216.46  Aligned_cols=157  Identities=27%  Similarity=0.347  Sum_probs=102.5

Q ss_pred             CCCCChhhHHHHHhcCCHHHHHHHHhh--------------------------------CCCcccCCCCCCCCcHHHHHH
Q 021192            9 SRSAKPATIHGCAQSGDLLAFQRLLRE--------------------------------NPSLLNERNPVMAQTPLHVSA   56 (316)
Q Consensus         9 ~~~~~~t~L~~A~~~g~~~~v~~ll~~--------------------------------~~~~~~~~~~~~g~t~Lh~A~   56 (316)
                      .|..|+||||+||..|+.++++.++..                                .+.+++.++.. |.||||+|+
T Consensus        33 ~D~~G~TpLh~Aa~~g~~e~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~Ll~~~~d~~~~d~~-g~tpL~~A~  111 (223)
T d1uoha_          33 TDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQN-GCTPLHYAA  111 (223)
T ss_dssp             CCTTSCCHHHHHHHHTCHHHHHHHHHHTCCSCCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCTTCCCTT-CCCHHHHHH
T ss_pred             cCCCCCCHHHHHHHhhhhcccccccccccccccccccccccccccccccccchhHHHhccCceeEeeCCC-CCchhhHHH
Confidence            477899999999999998888877543                                33344555544 666666666


Q ss_pred             hCCCHHHHHHHHcCCCCCccccccccCCCChHHHHHHHcCCHHHHHHHHhcCCCccccccCCCcHHHHHhhhhhccCcHH
Q 021192           57 GYNKAEIVKSLLEWPGNDKVELEAQNMYGETPLHMAAKNGCNEAAKLLLAHGAFIEAKANNGMTPLHLSVWYSIRSEDYA  136 (316)
Q Consensus        57 ~~g~~~~v~~Ll~~~~~~~~~~~~~~~~g~t~Lh~a~~~~~~~~~~~Ll~~g~~~~~~~~~g~t~L~~a~~~~~~~~~~~  136 (316)
                      ..|+.+++++|++    .|++++.+|.+|.||||+|+..++.+++++|++.+.+++..|.+|+||||+|+    ..++.+
T Consensus       112 ~~~~~e~~~~Ll~----~g~d~~~~~~~~~t~L~~a~~~~~~~~~~~L~~~~~~i~~~d~~g~TpL~~Aa----~~g~~~  183 (223)
T d1uoha_         112 SKNRHEIAVMLLE----GGANPDAKDHYEATAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLAC----DEERVE  183 (223)
T ss_dssp             HHTCHHHHHHHHH----TTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCSCCCCTTCCCHHHHHH----HTTCHH
T ss_pred             HcCCHHHHHHHHH----CCCCCCCcCCCCCccchhhhhcCCcchhhhhccccceeeeccCCCCceecccc----ccCcHH
Confidence            6666666666666    55566666666666666666666666666666666666666666666666666    566666


Q ss_pred             HHHHHHhcCCCCCCCCCCCCCccccccCCCChHHHHHHHH
Q 021192          137 TVKTLLEYNADCSAKDNEGKTPLDHLSNGPGSAKLRELLL  176 (316)
Q Consensus       137 ~~~~Ll~~ga~~~~~~~~g~tpl~~~a~~~~~~~~~~lL~  176 (316)
                      ++++|+++|+|++.+|..|+||||+| . +++..++++|+
T Consensus       184 ~v~~LL~~Gad~~~~d~~g~tpl~~A-~-~~~~~i~~~Ll  221 (223)
T d1uoha_         184 EAKLLVSQGASIYIENKEEKTPLQVA-K-GGLGLILKRMV  221 (223)
T ss_dssp             HHHHHHHTTCCSCCCCTTSCCHHHHC-C-TTHHHHHHHHH
T ss_pred             HHHHHHHCCCCCCCCCCCCCCHHHHH-H-CCCHHHHhccc
Confidence            66666666666666666666666443 2 34444555544
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure