Citrus Sinensis ID: 021196


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310------
MCGSKRVWVSELIFILLVVKGWWSEGCLEQERYALLQLRHFFNDDQCLQNCWVDDENYSDCCQWERVECNDTTGRVIKLDLRDTRNWESAEWYMNASLFTPFQQLESLYLIGNNIAGCVENEGLDTLSRLNNLKFLYLDYNHFNNSIFSSLGGLSSLRNLSLIGNRLIGSIDIKGLDSLGNLEELDMSDNAINNLVIPKDYRGLRKLNTLYLGGTEIAMIDGSKVLQSIGSLPSLKTLYLSSTNFKGTVVNQELHNFTNLEELILDDSDLHISQLLQSIASFTSLKYLSMGFCTLTGALHGQGKLRVSEAFMILIR
ccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccccccccccccccccccccccEEEccccccEEEEEccccccccccccccccccccccccccEEEcccccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccEEEccccccccccccHHccccccccEEEcccccccccccccccccccccccccEEEccccccccccccHHHcccccccEEEccccccccccccHHHHccccccEEEccccccEEEccccccccccHHHHHHcc
ccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccccccccccccccccccEEEEEEcccccEEEEEEccccccccccccccccHHHcccccccEEEcccccccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHcccccccEEEccccccccccccHHHcccccccEEEEccccccccccccccHHHccccccEEEEcccccccccccHHHHcccccccEEEccccccccccccHHHccccccEEEEccccccccccccccccHHHHHHHHHcc
MCGSKRVWVSELIFILLVVKGWWSEGCLEQERYALLQLRhffnddqclqncwvddenysdccqwervecndttgrvikldlrdtrnwESAEWYMnaslftpfqQLESLYLIGNNiagcvenegldtlsrlNNLKFLYLDynhfnnsifsslgglsslrnlsLIGNRLigsidikgldslgnleeldmsdnainnlvipkdyrglrKLNTLYLGGTEIAMIDgskvlqsigslpslktLYLSSTNFKGTVVNQelhnftnleelilddsdLHISQLLQSIASFTSLKYLSMGFCTltgalhgqgklrVSEAFMILIR
mcgskrvwVSELIFILLVVKGWWSEGCLEQERYALLQLRHFFNDDQCLQNCWVDDENYSDCCQWErvecndttgrvikldlrdtRNWESAEWYMNASLFTPFQQLESLYLIGNNIAGCVENEGLDTLSRLNNLKFLYLDYNHFNNSIFSSLGGLSSLRNLSLIGNRLIGSIDIKGLDSLGNLEELDMSDNAINNlvipkdyrglRKLNTLYLGGTEIAMIDGSKVLQSIGSLPSLKTLYLSSTNFKGTVVNQELHNFTNLEELILDDSDLHISQLLQSIASFTSLKYLSMGFCTLTgalhgqgklrVSEAFMILIR
MCGSKRVWVSELIFILLVVKGWWSEGCLEQERYALLQLRHFFNDDQCLQNCWVDDENYSDCCQWERVECNDTTGRVIKLDLRDTRNWESAEWYMNASLFTPFQQLESLYLIGNNIAGCVENEGLDTLSRLNNLKFLYLDYNHFnnsifsslgglsslrnlslignrliGSIDIKGLDSLGNLEELDMSDNAINNLVIPKDYRGLRKLNTLYLGGTEIAMIDGSKVLQSIGSLPSLKTLYLSSTNFKGTVVNQELHNFTNLEELILDDSDLHISQLLQSIASFTSLKYLSMGFCTLTGALHGQGKLRVSEAFMILIR
*****RVWVSELIFILLVVKGWWSEGCLEQERYALLQLRHFFNDDQCLQNCWVDDENYSDCCQWERVECNDTTGRVIKLDLRDTRNWESAEWYMNASLFTPFQQLESLYLIGNNIAGCVENEGLDTLSRLNNLKFLYLDYNHFNNSIFSSLGGLSSLRNLSLIGNRLIGSIDIKGLDSLGNLEELDMSDNAINNLVIPKDYRGLRKLNTLYLGGTEIAMIDGSKVLQSIGSLPSLKTLYLSSTNFKGTVVNQELHNFTNLEELILDDSDLHISQLLQSIASFTSLKYLSMGFCTLTGALHGQGKLRVSEAFMILI*
*****RV**SELIFILLVVKGWWSEGCLEQERYALLQLRHFFNDDQCLQNCWVDDENYSDCCQWERVECNDTTGRVIKLDLRDTRNWESAEWYMNASLFTPFQQLESLYLIGNNIAGCVENEGLDTLSRLNNLKFLYLDYNHFNNSIFSSLGGLSSLRNLSLIGNRLIGSIDIKGLDSLGNLEELDMSDNAINNLVIPKDYRGLRKLNTLYLGGTEIAMIDGSKVLQSIGSLPSLKTLYLSSTNFKGTVVNQELHNFTNLEELILDDSDLHISQLLQSIASFTSLKYLSMGFCTLTGALHGQGKLRVSEAFMILIR
MCGSKRVWVSELIFILLVVKGWWSEGCLEQERYALLQLRHFFNDDQCLQNCWVDDENYSDCCQWERVECNDTTGRVIKLDLRDTRNWESAEWYMNASLFTPFQQLESLYLIGNNIAGCVENEGLDTLSRLNNLKFLYLDYNHFNNSIFSSLGGLSSLRNLSLIGNRLIGSIDIKGLDSLGNLEELDMSDNAINNLVIPKDYRGLRKLNTLYLGGTEIAMIDGSKVLQSIGSLPSLKTLYLSSTNFKGTVVNQELHNFTNLEELILDDSDLHISQLLQSIASFTSLKYLSMGFCTLTGALHGQGKLRVSEAFMILIR
*CGSKRVWVSELIFILLVVKGWWSEGCLEQERYALLQLRHFFNDDQCLQNCWVDDENYSDCCQWERVECNDTTGRVIKLDLRDTRNWESAEWYMNASLFTPFQQLESLYLIGNNIAGCVENEGLDTLSRLNNLKFLYLDYNHFNNSIFSSLGGLSSLRNLSLIGNRLIGSIDIKGLDSLGNLEELDMSDNAINNLVIPKDYRGLRKLNTLYLGGTEIAMIDGSKVLQSIGSLPSLKTLYLSSTNFKGTVVNQELHNFTNLEELILDDSDLHISQLLQSIASFTSLKYLSMGFCTLTGALHGQGKLRVSEAFMILIR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCGSKRVWVSELIFILLVVKGWWSEGCLEQERYALLQLRHFFNDDQCLQNCWVDDENYSDCCQWERVECNDTTGRVIKLDLRDTRNWESAEWYMNASLFTPFQQLESLYLIGNNIAGCVENEGLDTLSRLNNLKFLYLDYNHFNNSIFSSLGGLSSLRNLSLIGNRLIGSIDIKGLDSLGNLEELDMSDNAINNLVIPKDYRGLRKLNTLYLGGTEIAMIDGSKVLQSIGSLPSLKTLYLSSTNFKGTVVNQELHNFTNLEELILDDSDLHISQLLQSIASFTSLKYLSMGFCTLTGALHGQGKLRVSEAFMILIR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query316 2.2.26 [Sep-21-2011]
Q9C9H7 847 Receptor-like protein 12 no no 0.905 0.337 0.303 3e-18
Q05091330 Polygalacturonase inhibit N/A no 0.531 0.509 0.316 5e-13
Q8VZG8 1045 Probable LRR receptor-lik no no 0.876 0.265 0.270 7e-12
P93194 1109 Receptor-like protein kin N/A no 0.734 0.209 0.284 3e-11
O82318 960 Probably inactive leucine no no 0.575 0.189 0.312 4e-10
O65440 992 Leucine-rich repeat recep no no 0.778 0.247 0.253 5e-10
Q9LRT1 1016 Probably inactive leucine no no 0.778 0.242 0.272 6e-10
P47735 999 Receptor-like protein kin no no 0.784 0.248 0.263 2e-09
Q8R5M3 578 Leucine-rich repeat-conta yes no 0.623 0.340 0.307 3e-09
Q9LP24 1120 Probable leucine-rich rep no no 0.816 0.230 0.267 5e-09
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score = 92.8 bits (229), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 100/330 (30%), Positives = 146/330 (44%), Gaps = 44/330 (13%)

Query: 1   MCGSKRVWVSE---LIFILLVVKGWWSEG---CLEQERYALLQLRHFF--NDDQCLQNCW 52
           M  S R WV     +IF+ L+V    S     C + +R ALL+ R  F  N    + N W
Sbjct: 2   MIRSHRHWVFSSRIIIFLSLLVHSLASSSPHFCRDDQRDALLEFRGEFPINASWHIMNQW 61

Query: 53  VDDENYS-DCCQWERVECNDTTGRVIKLDLRDTRNWESAEWYMNASLFTPFQQLESLYLI 111
               N S DCC W  V CND +G+VI LD+ +T  + +     N+SLF   Q L  L L 
Sbjct: 62  RGPWNKSTDCCLWNGVTCNDKSGQVISLDIPNT--FLNNYLKTNSSLFK-LQYLRHLDLT 118

Query: 112 GNNIAGCVEN--------------------EGLDTLSRLNNLKFLYLDYNHFNNSIFSSL 151
             N+ G + +                    E   ++  LN L+ L L  N     I SSL
Sbjct: 119 NCNLYGEIPSSLGNLSHLTLVNLYFNKFVGEIPASIGNLNQLRHLILANNVLTGEIPSSL 178

Query: 152 GGLSSLRNLSLIGNRLIGSIDIKGLDSLGNLEELDMSDNAINNLV--IPKDYRGLRKLNT 209
           G LS L NL L  NRL+G I     DS+G+L++L     A NNL+  IP     L  L  
Sbjct: 179 GNLSRLVNLELFSNRLVGKIP----DSIGDLKQLRNLSLASNNLIGEIPSSLGNLSNLVH 234

Query: 210 LYLGGTEIAMIDGSKVLQSIGSLPSLKTLYLSSTNFKGTVVNQELHNFTNLEELILDDSD 269
           L L   ++      +V  SIG+L  L+ +   + +  G +      N T L   +L  ++
Sbjct: 235 LVLTHNQLV----GEVPASIGNLIELRVMSFENNSLSGNIP-ISFANLTKLSIFVLSSNN 289

Query: 270 LHISQLLQSIASFTSLKYLSMGFCTLTGAL 299
              S     ++ F +L+Y  + + + +G  
Sbjct: 290 F-TSTFPFDMSIFHNLEYFDVSYNSFSGPF 318




Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|Q05091|PGIP_PYRCO Polygalacturonase inhibitor OS=Pyrus communis GN=PGIP PE=1 SV=1 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 Back     alignment and function description
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description
>sp|O65440|BAME3_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3 OS=Arabidopsis thaliana GN=BAM3 PE=2 SV=3 Back     alignment and function description
>sp|Q9LRT1|Y3804_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 OS=Arabidopsis thaliana GN=At3g28040 PE=2 SV=1 Back     alignment and function description
>sp|P47735|RLK5_ARATH Receptor-like protein kinase 5 OS=Arabidopsis thaliana GN=RLK5 PE=1 SV=1 Back     alignment and function description
>sp|Q8R5M3|LRC15_RAT Leucine-rich repeat-containing protein 15 OS=Rattus norvegicus GN=Lrrc15 PE=2 SV=1 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query316
224120284 929 predicted protein [Populus trichocarpa] 0.895 0.304 0.420 5e-53
224134597 947 predicted protein [Populus trichocarpa] 0.886 0.295 0.425 1e-46
224112233 976 leucine rich repeat family protein with 0.848 0.274 0.436 3e-46
224145105280 predicted protein [Populus trichocarpa] 0.819 0.925 0.419 4e-45
224142721 926 predicted protein [Populus trichocarpa] 0.882 0.301 0.436 4e-45
224142717 876 predicted protein [Populus trichocarpa] 0.889 0.320 0.416 3e-43
224144186 973 predicted protein [Populus trichocarpa] 0.857 0.278 0.431 3e-43
224142723 923 predicted protein [Populus trichocarpa] 0.841 0.288 0.425 2e-42
255585991 743 serine-threonine protein kinase, plant-t 0.879 0.374 0.413 5e-41
224111186 960 predicted protein [Populus trichocarpa] 0.895 0.294 0.370 2e-40
>gi|224120284|ref|XP_002331010.1| predicted protein [Populus trichocarpa] gi|222872940|gb|EEF10071.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  214 bits (544), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 134/319 (42%), Positives = 192/319 (60%), Gaps = 36/319 (11%)

Query: 12  LIFILLVVKGWWSEGCLEQERYALLQLRHFFN-DDQCLQNCWVDDENYSDCCQWERVECN 70
           +I ++++++GW   GCLE+ER ALLQ++  F+  +    + W  D N   CC+W++V+CN
Sbjct: 13  IINVVVLIQGWRCHGCLEEERVALLQIKDAFSYPNGSFPHSWGRDAN---CCEWKQVQCN 69

Query: 71  DTTGRVIKLDLRDTRNWESAEWYMNASLFTPFQQLESLYLIGNNIAGCVENEGLDTLSRL 130
            TT RV+K+DL  +R WE  +W +NASLF PF +L +L L GN IAGC+ENEG + LS L
Sbjct: 70  STTLRVVKIDLSFSRGWELGDWLLNASLFLPFPELNALNLYGNRIAGCLENEGFERLSVL 129

Query: 131 NNLKFLYLDYNHFNNSIFSSLGGLSSLRNLSLIGNRLIGSIDIKGLD----SLGNLEELD 186
            NL+ L L  N FN+SIFSSLGGLSSL+NLSL  N + G+I ++G +     + NLE LD
Sbjct: 130 GNLEILELGQNKFNSSIFSSLGGLSSLKNLSLHNNEIEGTISVEGGEDEVLKMSNLEYLD 189

Query: 187 MSDNAINNLVIPKDYRGLRKLNTL-----YLGGT-EIAMIDG----SKV----------- 225
           +  N  +N ++   ++GL  L  L     +L GT  +  I G    S+V           
Sbjct: 190 LGGNRFDNSIL-SSFKGLSSLKNLGLEKNHLKGTFNMKGIRGFGNLSRVRLFNITANGRR 248

Query: 226 -----LQSIGSLPSLKTLYLSSTNFKGTVVNQELHNFTNLEELILDDSDLHISQLLQSIA 280
                LQS+  LP+LKTL L + NF+GT++ Q L +  NL +L L  S L  S  LQ+I 
Sbjct: 249 ISLPLLQSLAKLPNLKTLDLGNNNFEGTILAQALPSLKNLHKLDLSSSTLDNS-FLQTIG 307

Query: 281 SFTSLKYLSMGFCTLTGAL 299
             T+L  L +  C L+G++
Sbjct: 308 RITTLTSLKLNGCRLSGSI 326




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224134597|ref|XP_002327443.1| predicted protein [Populus trichocarpa] gi|222835997|gb|EEE74418.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224112233|ref|XP_002332812.1| leucine rich repeat family protein with ABC domain [Populus trichocarpa] gi|222833206|gb|EEE71683.1| leucine rich repeat family protein with ABC domain [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224145105|ref|XP_002336200.1| predicted protein [Populus trichocarpa] gi|222832534|gb|EEE71011.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142721|ref|XP_002324703.1| predicted protein [Populus trichocarpa] gi|222866137|gb|EEF03268.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142717|ref|XP_002324701.1| predicted protein [Populus trichocarpa] gi|222866135|gb|EEF03266.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224144186|ref|XP_002336117.1| predicted protein [Populus trichocarpa] gi|222873047|gb|EEF10178.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142723|ref|XP_002324704.1| predicted protein [Populus trichocarpa] gi|222866138|gb|EEF03269.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255585991|ref|XP_002533665.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223526433|gb|EEF28711.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224111186|ref|XP_002332969.1| predicted protein [Populus trichocarpa] gi|222834328|gb|EEE72805.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query316
TAIR|locus:2037308 976 RLP14 "AT1G74180" [Arabidopsis 0.895 0.289 0.296 6.4e-24
TAIR|locus:2040075 935 RLP21 "AT2G25470" [Arabidopsis 0.832 0.281 0.309 2.6e-23
TAIR|locus:2155909 908 RLP56 "AT5G49290" [Arabidopsis 0.803 0.279 0.322 6.7e-23
TAIR|locus:2019662 965 RLP15 "AT1G74190" [Arabidopsis 0.879 0.288 0.288 1e-20
TAIR|locus:2074633 943 RLP35 "AT3G11080" [Arabidopsis 0.816 0.273 0.278 5.4e-17
TAIR|locus:2101943 891 RLP45 "AT3G53240" [Arabidopsis 0.705 0.250 0.286 5.9e-13
TAIR|locus:2825384 847 RLP12 "AT1G71400" [Arabidopsis 0.848 0.316 0.283 5.6e-12
TAIR|locus:2090754 711 RLP43 "receptor like protein 4 0.708 0.315 0.259 5.7e-12
TAIR|locus:2154463 589 AT5G23400 [Arabidopsis thalian 0.829 0.444 0.265 3e-11
TAIR|locus:2037313 1000 RLP13 "AT1G74170" [Arabidopsis 0.743 0.235 0.261 3.8e-11
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 286 (105.7 bits), Expect = 6.4e-24, P = 6.4e-24
 Identities = 91/307 (29%), Positives = 146/307 (47%)

Query:     3 GSKRVWVSELIFILLVVKGWWSEGCLEQERYALLQLRHFF---NDDQCLQNC---WVDDE 56
             G   +WV   + +L+ ++G+  + C+E+ER ALL+L+ +      D  L +    W +D 
Sbjct:     8 GQNLIWV---MLLLVQLRGY--KCCIEKERKALLELKKYMISKTADWGLDSVLPTWTNDT 62

Query:    57 NYSDCCQWERVECNDTTGRVIKLDLRDTRNWESAEWYMNASLFTPFQQLESLYLIG---N 113
               S+CC+WE ++CN T+GR+I+L +  T   ES+   +N SL  PF++L SL L G   N
Sbjct:    63 K-SNCCRWEGLKCNQTSGRIIELSIGQTNFKESS--LLNLSLLHPFEELRSLNLSGEIYN 119

Query:   114 NIAGCVEN-EGLDTLSRLNNLKFLYLDYNHFXXXXXXXXXXXXXXXXXXXXXXXXXGSID 172
                G  ++ EG ++L RL NL+ L L  N F                         G + 
Sbjct:   120 EFNGLFDDVEGYESLRRLRNLEILDLSSNSFNNSIFPFLNAATSLTTLFIQSNYIGGPLP 179

Query:   173 IKGLDSLGNLEELDMSDNAINNLVIPKDYRGLRKLNTLYLGGTEIAMIDGSKVLQSIGSL 232
             IK L +L  LE LD+S +  N   IP ++  L KL  L L   + + +     LQ +  L
Sbjct:   180 IKELKNLTKLELLDLSRSGYNGS-IP-EFTHLEKLKALDLSANDFSSL---VELQELKVL 234

Query:   233 PSLKTLYLSSTNFKGTVVNQELHNFTNLEELILDDSDLHISQLLQSIASFTSLKYLSMGF 292
              +L+ L L+  +  G +  +      NL +L L  +     QL   + +   L+ L +  
Sbjct:   235 TNLEVLGLAWNHLDGPIPKEVFCEMKNLRQLDLRGNYFE-GQLPVCLGNLNKLRVLDLSS 293

Query:   293 CTLTGAL 299
               L+G L
Sbjct:   294 NQLSGNL 300




GO:0007165 "signal transduction" evidence=IC
GO:0009507 "chloroplast" evidence=IDA
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090754 RLP43 "receptor like protein 43" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154463 AT5G23400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.01520050
hypothetical protein (929 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query316
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-06
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.002
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score = 63.7 bits (155), Expect = 4e-11
 Identities = 50/152 (32%), Positives = 76/152 (50%), Gaps = 14/152 (9%)

Query: 100 TPFQQLESLYLIGNNIAGCVENEGLDTLSRLNNLKFLYLDYNHFNNSIFSSLGGLSSLRN 159
           T    LE L L  N + G +  E    L ++ +LK++YL YN+ +  I   +GGL+SL +
Sbjct: 185 TNLTSLEFLTLASNQLVGQIPRE----LGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNH 240

Query: 160 LSLIGNRLIGSIDIKGLDSLGNLEELDMSDNAINNLV--IPKDYRGLRKLNTLYLGGTEI 217
           L L+ N L G I      SLGNL+ L       N L   IP     L+KL +L L    +
Sbjct: 241 LDLVYNNLTGPIPS----SLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSL 296

Query: 218 AMIDGSKVLQSIGSLPSLKTLYLSSTNFKGTV 249
           +     ++ + +  L +L+ L+L S NF G +
Sbjct: 297 S----GEIPELVIQLQNLEILHLFSNNFTGKI 324


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 316
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.95
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.86
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.85
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.82
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.8
KOG0617264 consensus Ras suppressor protein (contains leucine 99.8
KOG0617264 consensus Ras suppressor protein (contains leucine 99.79
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.77
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.73
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.71
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.71
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.7
PLN03150623 hypothetical protein; Provisional 99.7
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.69
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.68
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.66
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.66
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.65
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.65
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.6
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.57
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.5
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.5
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.42
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.42
PLN03150623 hypothetical protein; Provisional 99.38
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 99.35
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.32
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.3
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.3
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.29
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.25
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.19
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.19
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.06
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 99.0
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.93
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.87
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.85
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.79
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.78
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.69
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.66
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.61
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.6
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.57
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.55
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.54
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.51
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.51
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.45
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.31
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.31
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.27
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.22
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.19
PRK15386 426 type III secretion protein GogB; Provisional 97.97
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.87
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.81
PRK15386 426 type III secretion protein GogB; Provisional 97.68
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.53
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.29
KOG4308 478 consensus LRR-containing protein [Function unknown 97.26
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.24
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.18
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.16
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.07
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.2
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.09
KOG4341 483 consensus F-box protein containing LRR [General fu 96.01
KOG4308 478 consensus LRR-containing protein [Function unknown 95.93
KOG1947 482 consensus Leucine rich repeat proteins, some prote 95.62
KOG1947 482 consensus Leucine rich repeat proteins, some prote 95.39
KOG4341483 consensus F-box protein containing LRR [General fu 94.05
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.66
smart0037026 LRR Leucine-rich repeats, outliers. 92.89
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.89
KOG0473 326 consensus Leucine-rich repeat protein [Function un 92.01
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 91.64
KOG0473 326 consensus Leucine-rich repeat protein [Function un 91.36
KOG3864221 consensus Uncharacterized conserved protein [Funct 90.98
KOG3864221 consensus Uncharacterized conserved protein [Funct 87.28
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.3e-37  Score=314.00  Aligned_cols=266  Identities=27%  Similarity=0.412  Sum_probs=186.8

Q ss_pred             cHHHHHHHHHHhhhCCCCCCCCCCCCCCCCCCCCCcccceEEcCCCCcEEEEEcCCCCcccccccccccccccCCCCCcE
Q 021196           28 LEQERYALLQLRHFFNDDQCLQNCWVDDENYSDCCQWERVECNDTTGRVIKLDLRDTRNWESAEWYMNASLFTPFQQLES  107 (316)
Q Consensus        28 ~~~~~~aL~~~~~~~~~~~~~~~~W~~~~~~~~~c~w~gv~c~~~~~~v~~l~L~~~~~~~~~~~~~~~~~~~~l~~L~~  107 (316)
                      .++|++||++||+++.+|...+.+|   +...+||.|.||+|+. .++|+.|+|+++++.+  ..   +..+..+++|+.
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~~~~~w---~~~~~~c~w~gv~c~~-~~~v~~L~L~~~~i~~--~~---~~~~~~l~~L~~   97 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLKYLSNW---NSSADVCLWQGITCNN-SSRVVSIDLSGKNISG--KI---SSAIFRLPYIQT   97 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcccCCCC---CCCCCCCcCcceecCC-CCcEEEEEecCCCccc--cC---ChHHhCCCCCCE
Confidence            5689999999999998887778899   4577899999999985 5799999999987632  21   334566777777


Q ss_pred             EEccCCccCCccccccccccCC----------------------CCCCcEEECCCCCCCcccccccCCCCCCCEEEeeCc
Q 021196          108 LYLIGNNIAGCVENEGLDTLSR----------------------LNNLKFLYLDYNHFNNSIFSSLGGLSSLRNLSLIGN  165 (316)
Q Consensus       108 L~L~~n~~~~~~~~~~~~~l~~----------------------l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n  165 (316)
                      |+|++|.+.|.+|...   +..                      +++|++|++++|.+++.+|..++++++|++|++++|
T Consensus        98 L~Ls~n~~~~~ip~~~---~~~l~~L~~L~Ls~n~l~~~~p~~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n  174 (968)
T PLN00113         98 INLSNNQLSGPIPDDI---FTTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGN  174 (968)
T ss_pred             EECCCCccCCcCChHH---hccCCCCCEEECcCCccccccCccccCCCCEEECcCCcccccCChHHhcCCCCCEEECccC
Confidence            7777777766666431   223                      445555555555555555666666666666666666


Q ss_pred             ccccccCcccccCCCCCCEEEcCCCcCCCccccccccCCCCCCEEEcCCccccccccchhhhhcCCCCCCCEEECCCCCC
Q 021196          166 RLIGSIDIKGLDSLGNLEELDMSDNAINNLVIPKDYRGLRKLNTLYLGGTEIAMIDGSKVLQSIGSLPSLKTLYLSSTNF  245 (316)
Q Consensus       166 ~l~g~ip~~~l~~l~~L~~L~L~~n~~~~~~p~~~~~~l~~L~~L~l~~n~l~~~~~~~~p~~~~~l~~L~~L~l~~n~l  245 (316)
                      .+.+.+|. .+.++++|++|++++|.+.+.+|. .+.++++|++|++++|.++ +   .+|..++++++|++|++++|.+
T Consensus       175 ~l~~~~p~-~~~~l~~L~~L~L~~n~l~~~~p~-~l~~l~~L~~L~L~~n~l~-~---~~p~~l~~l~~L~~L~L~~n~l  248 (968)
T PLN00113        175 VLVGKIPN-SLTNLTSLEFLTLASNQLVGQIPR-ELGQMKSLKWIYLGYNNLS-G---EIPYEIGGLTSLNHLDLVYNNL  248 (968)
T ss_pred             cccccCCh-hhhhCcCCCeeeccCCCCcCcCCh-HHcCcCCccEEECcCCccC-C---cCChhHhcCCCCCEEECcCcee
Confidence            66666665 566666666666666666666655 6666667777777776665 5   5666667777777777777777


Q ss_pred             CCccchhhhcCCCCCCEEECCCCCCCcchhhhhhcCCCCCcEEEccCcccccccCC-Cccccchhhhhh
Q 021196          246 KGTVVNQELHNFTNLEELILDDSDLHISQLLQSIASFTSLKYLSMGFCTLTGALHG-QGKLRVSEAFMI  313 (316)
Q Consensus       246 ~g~~p~~~~~~l~~L~~L~L~~n~l~g~~ip~~l~~~~~L~~L~l~~N~l~g~ip~-~~~l~~L~~l~i  313 (316)
                      ++.+|. .++++++|++|++++|.+.+ .+|..+..+++|++|++++|++.|.+|. ++++++|+.|++
T Consensus       249 ~~~~p~-~l~~l~~L~~L~L~~n~l~~-~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l  315 (968)
T PLN00113        249 TGPIPS-SLGNLKNLQYLFLYQNKLSG-PIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHL  315 (968)
T ss_pred             ccccCh-hHhCCCCCCEEECcCCeeec-cCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEEC
Confidence            766665 66777777777777777776 6777777777777777777777777776 666777776654



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query316
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 5e-04
4fho_A231 Crystal Structure Of An Internalin C2 (Inlc2) From 6e-04
1h6u_A 308 Internalin H: Crystal Structure Of Fused N-Terminal 7e-04
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure

Iteration: 1

Score = 41.6 bits (96), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 31/94 (32%), Positives = 48/94 (51%), Gaps = 6/94 (6%) Query: 169 GSIDIKGLDSLGNLEELDMSDNAINNLVIPKDYRGLRKLNTLYLGGTEIAMIDGSKVLQS 228 ID L LE+LD+SDNA +V P +RGL L+TL+L + + G + + Sbjct: 68 AGIDAAAFTGLTLLEQLDLSDNAQLRVVDPTTFRGLGHLHTLHLDRCGLQEL-GPGLFRG 126 Query: 229 IGSLPSLKTLYLSSTNFKGTVVN--QELHNFTNL 260 + +L+ LYL N + N ++L N T+L Sbjct: 127 LA---ALQYLYLQDNNLQALPDNTFRDLGNLTHL 157
>pdb|4FHO|A Chain A, Crystal Structure Of An Internalin C2 (Inlc2) From Listeria Monocytogenes Str. 4b F2365 At 1.90 A Resolution Length = 231 Back     alignment and structure
>pdb|1H6U|A Chain A, Internalin H: Crystal Structure Of Fused N-Terminal Domains Length = 308 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query316
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-39
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-23
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-20
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-16
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-14
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-25
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-20
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-18
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-18
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-17
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-16
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-15
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-23
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-23
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-21
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-20
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-20
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-19
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-19
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-19
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-11
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-23
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-10
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-22
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-21
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-20
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-20
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-19
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-18
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-16
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-21
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-19
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-18
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-17
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-15
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-20
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-19
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 6e-18
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 4e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-20
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-19
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-14
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 2e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-20
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-18
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-17
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-16
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-15
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-16
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-20
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-19
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-18
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-18
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-18
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-17
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-14
1o6v_A 466 Internalin A; bacterial infection, extracellular r 6e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-20
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-19
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-17
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-19
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-19
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-08
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-19
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-18
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-17
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-14
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-12
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-10
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-19
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-18
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-19
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-18
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-10
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-16
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-18
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-17
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 6e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-18
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-14
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 2e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-17
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-17
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-15
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-17
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-17
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-17
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-17
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-17
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-16
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-10
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-17
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-15
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-10
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-09
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-06
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-16
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-14
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-13
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-14
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-12
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-15
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 1e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-15
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-14
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 3e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-12
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-12
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-13
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-12
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-12
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-12
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-10
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-10
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-06
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-06
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-04
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-11
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-10
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 8e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-10
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 8e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-09
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-07
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 6e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-08
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-04
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 5e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 8e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-06
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-06
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 1e-05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 3e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  145 bits (369), Expect = 3e-39
 Identities = 64/279 (22%), Positives = 117/279 (41%), Gaps = 28/279 (10%)

Query: 26  GCLEQERYALLQLRHFFNDDQCLQNCWVDDENYSDCCQWERVECNDTTGRVIKLDLRDTR 85
             L +E + L+  +    D   L + W  +    + C ++ V C     +V  +DL   +
Sbjct: 8   QSLYREIHQLISFKDVLPDKNLLPD-WSSN---KNPCTFDGVTCR--DDKVTSIDLSS-K 60

Query: 86  NWESAEWYMNASLFTPFQQLESLYLIGNNIAGCVENEGLDTLSRLNNLKFLYLDYNHFNN 145
                   +++SL      LESL+L  ++I G      +       +L  L L  N  + 
Sbjct: 61  PLNVGFSAVSSSLL-SLTGLESLFLSNSHING-----SVSGFKCSASLTSLDLSRNSLSG 114

Query: 146 SI--FSSLGGLSSLRNLSLIGNRLIGSIDIKGLDSLGNLEELDMSDNAINNLVIPKDYR- 202
            +   +SLG  S L+ L++  N L     + G   L +LE LD+S N+I+       +  
Sbjct: 115 PVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISG-ANVVGWVL 173

Query: 203 --GLRKLNTLYLGGTEIAMIDGSKVLQSIGSLPSLKTLYLSSTNFKGTVVNQELHNFTNL 260
             G  +L  L + G +I+   G      +    +L+ L +SS NF   +    L + + L
Sbjct: 174 SDGCGELKHLAISGNKIS---GDV---DVSRCVNLEFLDVSSNNFSTGI--PFLGDCSAL 225

Query: 261 EELILDDSDLHISQLLQSIASFTSLKYLSMGFCTLTGAL 299
           + L +  + L      ++I++ T LK L++      G +
Sbjct: 226 QHLDISGNKLS-GDFSRAISTCTELKLLNISSNQFVGPI 263


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query316
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.96
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.96
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.95
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.95
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.95
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.95
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.94
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.94
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.94
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.94
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.93
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.93
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.93
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.93
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.93
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.93
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.93
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.93
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.93
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.92
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.92
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.92
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.92
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.92
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.92
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.91
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.91
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.91
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.91
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.91
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.91
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.9
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.9
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.9
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.9
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.9
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.9
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.9
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.9
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.9
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.89
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.89
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.89
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.89
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.88
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.87
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.85
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.85
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.85
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.85
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.85
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.85
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.84
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.84
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.84
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.83
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.83
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.83
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.83
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.83
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.83
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.83
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.83
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.82
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.82
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.82
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.82
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.82
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.82
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.81
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.81
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.79
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.76
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.75
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.75
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.75
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.74
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.74
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.73
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.72
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.69
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.68
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.68
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.67
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.67
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.67
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.67
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.66
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.65
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.64
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.61
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.61
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.57
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.56
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.56
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.56
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.52
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.51
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.49
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.48
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.47
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.32
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.31
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.28
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.25
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.16
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.14
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.96
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.92
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.87
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.67
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.56
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.48
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.35
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.31
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.15
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.08
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.0
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.95
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.93
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.74
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.93
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.87
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=100.00  E-value=2.8e-43  Score=310.90  Aligned_cols=271  Identities=23%  Similarity=0.343  Sum_probs=200.7

Q ss_pred             CCcHHHHHHHHHHhhhCCCCCCCCCCCCCCCCCCCCCc--ccceEEcCCC--CcEEEEEcCCCCcccccccccccccccC
Q 021196           26 GCLEQERYALLQLRHFFNDDQCLQNCWVDDENYSDCCQ--WERVECNDTT--GRVIKLDLRDTRNWESAEWYMNASLFTP  101 (316)
Q Consensus        26 ~~~~~~~~aL~~~~~~~~~~~~~~~~W~~~~~~~~~c~--w~gv~c~~~~--~~v~~l~L~~~~~~~~~~~~~~~~~~~~  101 (316)
                      .|.++|++||++||+++.+|. .+++|   ..+.+||.  |.||+|+...  ++|+.|+|+++.+.+....   +..+.+
T Consensus         2 ~c~~~~~~aL~~~k~~~~~~~-~l~~W---~~~~~~C~~~w~gv~C~~~~~~~~l~~L~L~~~~l~~~~~~---~~~l~~   74 (313)
T 1ogq_A            2 LCNPQDKQALLQIKKDLGNPT-TLSSW---LPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPI---PSSLAN   74 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG-GGTTC---CTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEEC---CGGGGG
T ss_pred             CCCHHHHHHHHHHHHhcCCcc-cccCC---CCCCCCCcCCCcceEeCCCCCCceEEEEECCCCCccCCccc---ChhHhC
Confidence            699999999999999998876 78899   45678998  9999998644  8999999999988431021   345677


Q ss_pred             CCCCcEEEccC-CccCCccccccccccCCCCCCcEEECCCCCCCcccccccCCCCCCCEEEeeCcccccccCcccccCCC
Q 021196          102 FQQLESLYLIG-NNIAGCVENEGLDTLSRLNNLKFLYLDYNHFNNSIFSSLGGLSSLRNLSLIGNRLIGSIDIKGLDSLG  180 (316)
Q Consensus       102 l~~L~~L~L~~-n~~~~~~~~~~~~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~g~ip~~~l~~l~  180 (316)
                      +++|++|++++ |.+.+.+|..    ++++++|++|++++|.+++.+|..+..+++|++|++++|.+++.+|. .+..++
T Consensus        75 l~~L~~L~L~~~n~l~~~~p~~----l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~-~~~~l~  149 (313)
T 1ogq_A           75 LPYLNFLYIGGINNLVGPIPPA----IAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPP-SISSLP  149 (313)
T ss_dssp             CTTCSEEEEEEETTEESCCCGG----GGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCG-GGGGCT
T ss_pred             CCCCCeeeCCCCCcccccCChh----HhcCCCCCEEECcCCeeCCcCCHHHhCCCCCCEEeCCCCccCCcCCh-HHhcCC
Confidence            77788888874 7777776653    66666777777777766666666666666666666666666666665 566666


Q ss_pred             CCCEEEcCCCcCCCccccccccCCC-CCCEEEcCCcccccccc--------------------chhhhhcCCCCCCCEEE
Q 021196          181 NLEELDMSDNAINNLVIPKDYRGLR-KLNTLYLGGTEIAMIDG--------------------SKVLQSIGSLPSLKTLY  239 (316)
Q Consensus       181 ~L~~L~L~~n~~~~~~p~~~~~~l~-~L~~L~l~~n~l~~~~~--------------------~~~p~~~~~l~~L~~L~  239 (316)
                      +|++|++++|++++.+|. .+..++ +|++|++++|.++ +..                    ..+|..+..+++|++|+
T Consensus       150 ~L~~L~L~~N~l~~~~p~-~l~~l~~~L~~L~L~~N~l~-~~~~~~~~~l~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~  227 (313)
T 1ogq_A          150 NLVGITFDGNRISGAIPD-SYGSFSKLFTSMTISRNRLT-GKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIH  227 (313)
T ss_dssp             TCCEEECCSSCCEEECCG-GGGCCCTTCCEEECCSSEEE-EECCGGGGGCCCSEEECCSSEEEECCGGGCCTTSCCSEEE
T ss_pred             CCCeEECcCCcccCcCCH-HHhhhhhcCcEEECcCCeee-ccCChHHhCCcccEEECcCCcccCcCCHHHhcCCCCCEEE
Confidence            666666666666665555 555555 5566655555554 200                    04556677777888888


Q ss_pred             CCCCCCCCccchhhhcCCCCCCEEECCCCCCCcchhhhhhcCCCCCcEEEccCcccccccCCCccccchhhhhh
Q 021196          240 LSSTNFKGTVVNQELHNFTNLEELILDDSDLHISQLLQSIASFTSLKYLSMGFCTLTGALHGQGKLRVSEAFMI  313 (316)
Q Consensus       240 l~~n~l~g~~p~~~~~~l~~L~~L~L~~n~l~g~~ip~~l~~~~~L~~L~l~~N~l~g~ip~~~~l~~L~~l~i  313 (316)
                      +++|.+++.+|  .+..+++|++|++++|.+++ .+|..+..+++|++|++++|+++|.+|..+.++.|+.+++
T Consensus       228 L~~N~l~~~~~--~~~~l~~L~~L~Ls~N~l~~-~~p~~l~~l~~L~~L~Ls~N~l~~~ip~~~~l~~L~~l~l  298 (313)
T 1ogq_A          228 LAKNSLAFDLG--KVGLSKNLNGLDLRNNRIYG-TLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAY  298 (313)
T ss_dssp             CCSSEECCBGG--GCCCCTTCCEEECCSSCCEE-CCCGGGGGCTTCCEEECCSSEEEEECCCSTTGGGSCGGGT
T ss_pred             CCCCceeeecC--cccccCCCCEEECcCCcccC-cCChHHhcCcCCCEEECcCCcccccCCCCccccccChHHh
Confidence            88888876555  36778889999999999988 8898999999999999999999999998888888888765



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 316
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-09
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.004
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 60.8 bits (146), Expect = 4e-11
 Identities = 46/247 (18%), Positives = 83/247 (33%), Gaps = 46/247 (18%)

Query: 40  HFFNDDQCLQNCWVDDENYSDCCQWERVECNDTTGRVIKLDLRDTRNWESAEWYMNASLF 99
           +   D + L N    +       +   +        +  L   + +  +     +     
Sbjct: 163 NQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPLGI----- 217

Query: 100 TPFQQLESLYLIGNNIAGCVENEGLDTLSRLNNLKFLYLDYNHFNNSIFSSLGGLSSLRN 159
                L+ L L GN +      + + TL+ L NL  L L  N  +N     L GL+ L  
Sbjct: 218 --LTNLDELSLNGNQL------KDIGTLASLTNLTDLDLANNQISNLA--PLSGLTKLTE 267

Query: 160 LSLIGNRLIGSIDIKGLDS-------------------LGNLEELDMSDNAINNLVIPKD 200
           L L  N++     + GL +                   L NL  L +  N I+++     
Sbjct: 268 LKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDIS---P 324

Query: 201 YRGLRKLNTLYLGGTEIAMIDGSKVLQSIGSLPSLKTLYLSSTNFKGTVVNQELHNFTNL 260
              L KL  L+    +++ +       S+ +L ++  L               L N T +
Sbjct: 325 VSSLTKLQRLFFANNKVSDVS------SLANLTNINWLSAGHNQISDLT---PLANLTRI 375

Query: 261 EELILDD 267
            +L L+D
Sbjct: 376 TQLGLND 382


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query316
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.93
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.88
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.83
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.81
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.81
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.8
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.8
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.8
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.8
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.78
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.77
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.77
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.77
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.76
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.73
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.7
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.66
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.65
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.63
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.62
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.62
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.59
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.53
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.5
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.49
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.47
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.44
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.38
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.38
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.32
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.23
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.46
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.44
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.39
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.12
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.97
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.83
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=4e-44  Score=314.15  Aligned_cols=271  Identities=23%  Similarity=0.361  Sum_probs=234.9

Q ss_pred             CCcHHHHHHHHHHhhhCCCCCCCCCCCCCCCCCCCCC--cccceEEcCCC--CcEEEEEcCCCCcccccccccccccccC
Q 021196           26 GCLEQERYALLQLRHFFNDDQCLQNCWVDDENYSDCC--QWERVECNDTT--GRVIKLDLRDTRNWESAEWYMNASLFTP  101 (316)
Q Consensus        26 ~~~~~~~~aL~~~~~~~~~~~~~~~~W~~~~~~~~~c--~w~gv~c~~~~--~~v~~l~L~~~~~~~~~~~~~~~~~~~~  101 (316)
                      -|.++|++||++||+++.+|. .+++|   ..++|||  .|.||+|+..+  +||++|+|+++.+.+..+  + ++.+++
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~-~l~sW---~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~--l-p~~l~~   74 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPT-TLSSW---LPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYP--I-PSSLAN   74 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG-GGTTC---CTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEE--C-CGGGGG
T ss_pred             CCCHHHHHHHHHHHHHCCCCC-cCCCC---CCCCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCC--C-ChHHhc
Confidence            489999999999999999885 68899   4678999  49999998643  489999999998843322  2 456899


Q ss_pred             CCCCcEEEccC-CccCCccccccccccCCCCCCcEEECCCCCCCcccccccCCCCCCCEEEeeCcccccccCcccccCCC
Q 021196          102 FQQLESLYLIG-NNIAGCVENEGLDTLSRLNNLKFLYLDYNHFNNSIFSSLGGLSSLRNLSLIGNRLIGSIDIKGLDSLG  180 (316)
Q Consensus       102 l~~L~~L~L~~-n~~~~~~~~~~~~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~g~ip~~~l~~l~  180 (316)
                      +++|++|+|++ |.++|.+|..    ++++++|++|++++|.+.+..+..+..+..|+++++++|.+.+.+|. .+.+++
T Consensus        75 L~~L~~L~Ls~~N~l~g~iP~~----i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~-~l~~l~  149 (313)
T d1ogqa_          75 LPYLNFLYIGGINNLVGPIPPA----IAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPP-SISSLP  149 (313)
T ss_dssp             CTTCSEEEEEEETTEESCCCGG----GGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCG-GGGGCT
T ss_pred             Cccccccccccccccccccccc----cccccccchhhhccccccccccccccchhhhcccccccccccccCch-hhccCc
Confidence            99999999987 8999999864    89999999999999999998888899999999999999999988887 899999


Q ss_pred             CCCEEEcCCCcCCCccccccccCCCCC-CEEEcCCccccccc--------------------cchhhhhcCCCCCCCEEE
Q 021196          181 NLEELDMSDNAINNLVIPKDYRGLRKL-NTLYLGGTEIAMID--------------------GSKVLQSIGSLPSLKTLY  239 (316)
Q Consensus       181 ~L~~L~L~~n~~~~~~p~~~~~~l~~L-~~L~l~~n~l~~~~--------------------~~~~p~~~~~l~~L~~L~  239 (316)
                      +++++++++|.+++.+|. .+..+.++ +.+++++|+++ +.                    ...+|..+..+++++.++
T Consensus       150 ~L~~l~l~~n~l~~~ip~-~~~~l~~l~~~l~~~~n~l~-~~~~~~~~~l~~~~l~l~~~~~~~~~~~~~~~~~~l~~l~  227 (313)
T d1ogqa_         150 NLVGITFDGNRISGAIPD-SYGSFSKLFTSMTISRNRLT-GKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIH  227 (313)
T ss_dssp             TCCEEECCSSCCEEECCG-GGGCCCTTCCEEECCSSEEE-EECCGGGGGCCCSEEECCSSEEEECCGGGCCTTSCCSEEE
T ss_pred             ccceeecccccccccccc-cccccccccccccccccccc-cccccccccccccccccccccccccccccccccccccccc
Confidence            999999999999998887 77777665 77887777665 31                    014566777888999999


Q ss_pred             CCCCCCCCccchhhhcCCCCCCEEECCCCCCCcchhhhhhcCCCCCcEEEccCcccccccCCCccccchhhhhh
Q 021196          240 LSSTNFKGTVVNQELHNFTNLEELILDDSDLHISQLLQSIASFTSLKYLSMGFCTLTGALHGQGKLRVSEAFMI  313 (316)
Q Consensus       240 l~~n~l~g~~p~~~~~~l~~L~~L~L~~n~l~g~~ip~~l~~~~~L~~L~l~~N~l~g~ip~~~~l~~L~~l~i  313 (316)
                      +++|.+++.+|  .++.+++|+.|++++|+++| .+|+.++++++|++|+|++|+|+|.+|+++++++|+.+++
T Consensus       228 ~~~~~l~~~~~--~~~~~~~L~~L~Ls~N~l~g-~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~~~L~~L~~l~l  298 (313)
T d1ogqa_         228 LAKNSLAFDLG--KVGLSKNLNGLDLRNNRIYG-TLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAY  298 (313)
T ss_dssp             CCSSEECCBGG--GCCCCTTCCEEECCSSCCEE-CCCGGGGGCTTCCEEECCSSEEEEECCCSTTGGGSCGGGT
T ss_pred             ccccccccccc--ccccccccccccCccCeecc-cCChHHhCCCCCCEEECcCCcccccCCCcccCCCCCHHHh
Confidence            99999987665  68889999999999999999 9999999999999999999999999999989999988765



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure