Citrus Sinensis ID: 021218

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310------
MAAATLPFSRPIPKFSPSPSSETLKEALKHLNLASFSSTAKSLRALKTTTGRGSALSAWMASETALKTPFLLDFETSVFKKDMISLADRDEYIVRGGRDLFNLLPDAFNGINQIGVIGWGSQGPAQAQNLRDSLAEAKSDIVVKVGLRKGSRSFAEARAAGFTEENGTLGDIYETISGSDLVLLLISDAAQADNYEKIFSCMKPNSILGLSHGFLLGHLQSMGLDFPKNIGVIAVCPKGMGPSVRRLYVQGKEINGAGINSSFAVHQDVDGRATNVALGWSVALGSPFTFATTLEQEYRSDIFGERGECFPASIIL
ccccccccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHcccccccHHHHHHHHHccccccccccccccccccEEEEcccccEEEEEcccccccccHHHHccccEEEEEccccccHHHHccccccccccccccEEEEEEccccccHHHHHHccccccccccccHHHHHHHccEEEEEcccHHHHHHHHHHHcccccccEEEEcccccccccccccccccccccEEEEccccccHHHHHHHHccccccccccccEEEEEEcccccHHHHHHHHHHHHcccEEEEcccccccccccHHHHHHcccccccc
ccEEEcccccccccccccccHHHHHHHHHcccHcHHHHHHHHHHHHHHcccccHHHHHHHHcHHHccccccccccccccccEEEEEccEEEEEEEccHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHcccccccccEEEHHHHHHHccEEEEcccHHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHcccccccccEEEEEEEcccHHHHHHHHHHccccccccccEEEEEEEcccccHHHHHHHHHHHHcccEEEEccHHHHHHHHHHHHHcEEEcccEcc
maaatlpfsrpipkfspspssETLKEALKHLNLASFSSTAKSLRALKTTTGRGSALSAWMASETALKTPFLLDFETSVFKKDmisladrdeYIVRGGRdlfnllpdafnginqigvigwgsqgpaqAQNLRDSLAEAKSDIVVKVGLRKGSRSFAEARAAgfteengtlgdiyetisgSDLVLLLISDAAQADNYEKIFscmkpnsilglsHGFLLGHLqsmgldfpknigviavcpkgmgpsvrRLYVQGkeingaginssfavhqdvdgratNVALGWsvalgspftfATTLEQEYrsdifgergecfpasiil
maaatlpfsrpipkfspsPSSETLKEALKHLNLASFSSTAKSLRALKTTTGRGSALSAWMASETALKTPFLLDFETSVFKKDMISLADRDEYIVRGGRDLFNLLPDAFNGINQIGVIGWGSQGPAQAQNLRDSLAEAKSDIVVKvglrkgsrsfaearaagfteengtlgdIYETISGSDLVLLLISDAAQADNYEKIFSCMKPNSILGLSHGFLLGHLQSMGLDFPKNIGVIAVCPKGMGPSVRRLYVQGKEINGAGINSSFAVHQDVDGRATNVALGWSVALGSPFTFATTLEQEYRSDIFGERgecfpasiil
MAAATLPFSRPIPKFSPSPSSETLKEALKHLNLASFSSTAKSLRALKTTTGRGSALSAWMASETALKTPFLLDFETSVFKKDMISLADRDEYIVRGGRDLFNLLPDAFNGINQIGVIGWGSQGPAQAQNLRDSLAEAKSDIVVKVGLRKGSRSFAEARAAGFTEENGTLGDIYETISGSDLVLLLISDAAQADNYEKIFSCMKPNSIlglshgfllghlQSMGLDFPKNIGVIAVCPKGMGPSVRRLYVQGKEINGAGINSSFAVHQDVDGRATNVALGWSVALGSPFTFATTLEQEYRSDIFGERGECFPASIIL
******************************************************ALSAWMASETALKTPFLLDFETSVFKKDMISLADRDEYIVRGGRDLFNLLPDAFNGINQIGVIGWGS******************DIVVKVGLRKG**SFAEARAAGFTEENGTLGDIYETISGSDLVLLLISDAAQADNYEKIFSCMKPNSILGLSHGFLLGHLQSMGLDFPKNIGVIAVCPKGMGPSVRRLYVQGKEINGAGINSSFAVHQDVDGRATNVALGWSVALGSPFTFATTLEQEYRSDIFGERGECFPA****
************************************************************************DFETSVFKKDMISLADRDEYIVRGGRDLFNLLPDAFNGINQIGVIGWGSQGPAQAQNLRDSLAEAKSDIVVKVGLRKGSRSFAEARAAGFTEENGTLGDIYETISGSDLVLLLISDAAQADNYEKIFSCMKPNSILGLSHGFLLGHLQSMGLDFPKNIGVIAVCPKGMGPSVRRLYVQGKEINGAGINSSFAVHQDVDGRATNVALGWSVALGSPFTFATTLEQEYRSDIFGERGECFPASIIL
********SRPIPKFSPSPSSETLKEALKHLNLASFSSTAKSLRALKT*********AWMASETALKTPFLLDFETSVFKKDMISLADRDEYIVRGGRDLFNLLPDAFNGINQIGVIGWGSQGPAQAQNLRDSLAEAKSDIVVKVGLRKGSRSFAEARAAGFTEENGTLGDIYETISGSDLVLLLISDAAQADNYEKIFSCMKPNSILGLSHGFLLGHLQSMGLDFPKNIGVIAVCPKGMGPSVRRLYVQGKEINGAGINSSFAVHQDVDGRATNVALGWSVALGSPFTFATTLEQEYRSDIFGERGECFPASIIL
*********************************************************************FLLDFETSVFKKDMISLADRDEYIVRGGRDLFNLLPDAFNGINQIGVIGWGSQGPAQAQNLRDSLAEAKSDIVVKVGLRKGSRSFAEARAAGFTEENGTLGDIYETISGSDLVLLLISDAAQADNYEKIFSCMKPNSILGLSHGFLLGHLQSMGLDFPKNIGVIAVCPKGMGPSVRRLYVQGKEINGAGINSSFAVHQDVDGRATNVALGWSVALGSPFTFATTLEQEYRSDIFGERGECFPASIIL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAATLPFSRPIPKFSPSPSSETLKEALKHLNLASFSSTAKSLRALKTTTGRGSALSAWMASETALKTPFLLDFETSVFKKDMISLADRDEYIVRGGRDLFNLLPDAFNGINQIGVIGWGSQGPAQAQNLRDSLAEAKSDIVVKVGLRKGSRSFAEARAAGFTEENGTLGDIYETISGSDLVLLLISDAAQADNYEKIFSCMKPNSILGLSHGFLLGHLQSMGLDFPKNIGVIAVCPKGMGPSVRRLYVQGKEINGAGINSSFAVHQDVDGRATNVALGWSVALGSPFTFATTLEQEYRSDIFGERGECFPASIIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query316 2.2.26 [Sep-21-2011]
Q05758 591 Ketol-acid reductoisomera yes no 0.806 0.431 0.870 1e-128
O82043 581 Ketol-acid reductoisomera N/A no 0.952 0.518 0.755 1e-126
Q01292 595 Ketol-acid reductoisomera N/A no 0.901 0.478 0.750 1e-126
Q65XK0 578 Ketol-acid reductoisomera yes no 0.746 0.408 0.898 1e-123
P78827 404 Probable ketol-acid reduc yes no 0.623 0.487 0.388 1e-28
P38674 402 Ketol-acid reductoisomera N/A no 0.601 0.472 0.389 2e-28
B3QSP0 338 Ketol-acid reductoisomera yes no 0.553 0.517 0.365 5e-24
A9BGP6 330 Ketol-acid reductoisomera yes no 0.541 0.518 0.366 1e-23
Q8DW43 340 Ketol-acid reductoisomera yes no 0.544 0.505 0.368 1e-22
C1DA41 338 Ketol-acid reductoisomera yes no 0.553 0.517 0.355 2e-22
>sp|Q05758|ILV5_ARATH Ketol-acid reductoisomerase, chloroplastic OS=Arabidopsis thaliana GN=At3g58610 PE=2 SV=2 Back     alignment and function desciption
 Score =  458 bits (1179), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 222/255 (87%), Positives = 236/255 (92%)

Query: 53  GSALSAWMASETALKTPFLLDFETSVFKKDMISLADRDEYIVRGGRDLFNLLPDAFNGIN 112
           GS+L+A M S +A+K P  LDFETSVFKK+ +SLA  +EYIVRGGRDLF  LPDAF GI 
Sbjct: 61  GSSLAARMVSSSAVKAPVSLDFETSVFKKEKVSLAGYEEYIVRGGRDLFKHLPDAFKGIK 120

Query: 113 QIGVIGWGSQGPAQAQNLRDSLAEAKSDIVVKVGLRKGSRSFAEARAAGFTEENGTLGDI 172
           QIGVIGWGSQGPAQAQNLRDSL EAKSDIVVK+GLRKGSRSF EARAAGFTEE+GTLGDI
Sbjct: 121 QIGVIGWGSQGPAQAQNLRDSLVEAKSDIVVKIGLRKGSRSFEEARAAGFTEESGTLGDI 180

Query: 173 YETISGSDLVLLLISDAAQADNYEKIFSCMKPNSILGLSHGFLLGHLQSMGLDFPKNIGV 232
           +ETI+GSDLVLLLISDAAQADNYEKIFS MKPNSILGLSHGFLLGHLQS GLDFPKNI V
Sbjct: 181 WETIAGSDLVLLLISDAAQADNYEKIFSHMKPNSILGLSHGFLLGHLQSSGLDFPKNISV 240

Query: 233 IAVCPKGMGPSVRRLYVQGKEINGAGINSSFAVHQDVDGRATNVALGWSVALGSPFTFAT 292
           +AVCPKGMGPSVRRLYVQGKEINGAGIN+SFAVHQDVDGRA +VALGWSVALGSPFTFAT
Sbjct: 241 VAVCPKGMGPSVRRLYVQGKEINGAGINASFAVHQDVDGRAADVALGWSVALGSPFTFAT 300

Query: 293 TLEQEYRSDIFGERG 307
           TLEQEYRSDIFGERG
Sbjct: 301 TLEQEYRSDIFGERG 315

Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 8EC: 6
>sp|O82043|ILV5_PEA Ketol-acid reductoisomerase, chloroplastic OS=Pisum sativum GN=PGAAIR PE=2 SV=1 Back     alignment and function description
>sp|Q01292|ILV5_SPIOL Ketol-acid reductoisomerase, chloroplastic OS=Spinacia oleracea GN=AHRI PE=1 SV=1 Back     alignment and function description
>sp|Q65XK0|ILV5_ORYSJ Ketol-acid reductoisomerase, chloroplastic OS=Oryza sativa subsp. japonica GN=Os05g0573700 PE=1 SV=1 Back     alignment and function description
>sp|P78827|ILV5_SCHPO Probable ketol-acid reductoisomerase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ilv5 PE=1 SV=2 Back     alignment and function description
>sp|P38674|ILV5_NEUCR Ketol-acid reductoisomerase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ilv-2 PE=3 SV=2 Back     alignment and function description
>sp|B3QSP0|ILVC_CHLT3 Ketol-acid reductoisomerase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=ilvC PE=3 SV=1 Back     alignment and function description
>sp|A9BGP6|ILVC_PETMO Ketol-acid reductoisomerase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=ilvC PE=3 SV=1 Back     alignment and function description
>sp|Q8DW43|ILVC_STRMU Ketol-acid reductoisomerase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=ilvC PE=3 SV=1 Back     alignment and function description
>sp|C1DA41|ILVC_LARHH Ketol-acid reductoisomerase OS=Laribacter hongkongensis (strain HLHK9) GN=ilvC PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query316
295291644 587 ketol-acid reductoisomerase [Catharanthu 0.911 0.490 0.814 1e-131
225446579 588 PREDICTED: ketol-acid reductoisomerase, 0.908 0.488 0.819 1e-130
255568281 584 ketol-acid reductoisomerase, chloroplast 0.958 0.518 0.779 1e-129
224079219 589 predicted protein [Populus trichocarpa] 0.863 0.463 0.833 1e-128
297817174 594 ketol-acid reductoisomerase [Arabidopsis 0.806 0.429 0.878 1e-127
341958461 587 chloroplast acetohydroxy acid isomerored 0.873 0.470 0.832 1e-127
356549858 586 PREDICTED: ketol-acid reductoisomerase, 0.873 0.470 0.832 1e-127
356543900 586 PREDICTED: ketol-acid reductoisomerase, 0.873 0.470 0.828 1e-127
449438145 588 PREDICTED: ketol-acid reductoisomerase, 0.958 0.515 0.766 1e-126
15231092 591 ketol-acid reductoisomerase [Arabidopsis 0.806 0.431 0.870 1e-126
>gi|295291644|gb|ADF87507.1| ketol-acid reductoisomerase [Catharanthus roseus] Back     alignment and taxonomy information
 Score =  474 bits (1220), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 241/296 (81%), Positives = 259/296 (87%), Gaps = 8/296 (2%)

Query: 20  SSETLKEALKH--LNLASFSSTAKSL-----RALKTTTGRGSALSAWMASE-TALKTPFL 71
           +++TLK   K    NL+  SS+  SL     RA   TT  GSA++A M S   A+K P  
Sbjct: 17  ATKTLKHPTKTSVHNLSFLSSSTPSLKHLAARAASFTTSCGSAVAARMVSTPAAVKPPTN 76

Query: 72  LDFETSVFKKDMISLADRDEYIVRGGRDLFNLLPDAFNGINQIGVIGWGSQGPAQAQNLR 131
           LDFETSVFKK+ I+LA  +EYIVRGGRDLFNLLPDAF GI QIGVIGWGSQGPAQAQNLR
Sbjct: 77  LDFETSVFKKEKINLAGHEEYIVRGGRDLFNLLPDAFKGIKQIGVIGWGSQGPAQAQNLR 136

Query: 132 DSLAEAKSDIVVKVGLRKGSRSFAEARAAGFTEENGTLGDIYETISGSDLVLLLISDAAQ 191
           DSLAE KSDI+VK+GLRKGSRSFAEARAAGF+EENGTLGDIYETISGSDLVLLLISDAAQ
Sbjct: 137 DSLAETKSDILVKIGLRKGSRSFAEARAAGFSEENGTLGDIYETISGSDLVLLLISDAAQ 196

Query: 192 ADNYEKIFSCMKPNSILGLSHGFLLGHLQSMGLDFPKNIGVIAVCPKGMGPSVRRLYVQG 251
           ADNYE++FS MKPNSILGLSHGFLLGHLQSMGLDFPKNI VIAVCPKGMGPSVRRLYVQG
Sbjct: 197 ADNYEQVFSHMKPNSILGLSHGFLLGHLQSMGLDFPKNISVIAVCPKGMGPSVRRLYVQG 256

Query: 252 KEINGAGINSSFAVHQDVDGRATNVALGWSVALGSPFTFATTLEQEYRSDIFGERG 307
           KEINGAGINSSFAVHQDVDGRAT+VALGWSVALGSPFTFATTLEQEY+SDIFGERG
Sbjct: 257 KEINGAGINSSFAVHQDVDGRATDVALGWSVALGSPFTFATTLEQEYKSDIFGERG 312

Source: Catharanthus roseus

Species: Catharanthus roseus

Genus: Catharanthus

Family: Apocynaceae

Order: Gentianales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225446579|ref|XP_002280094.1| PREDICTED: ketol-acid reductoisomerase, chloroplastic [Vitis vinifera] gi|147767264|emb|CAN69003.1| hypothetical protein VITISV_005408 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255568281|ref|XP_002525115.1| ketol-acid reductoisomerase, chloroplast precursor, putative [Ricinus communis] gi|223535574|gb|EEF37242.1| ketol-acid reductoisomerase, chloroplast precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224079219|ref|XP_002305797.1| predicted protein [Populus trichocarpa] gi|222848761|gb|EEE86308.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297817174|ref|XP_002876470.1| ketol-acid reductoisomerase [Arabidopsis lyrata subsp. lyrata] gi|297322308|gb|EFH52729.1| ketol-acid reductoisomerase [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|341958461|gb|AEL13846.1| chloroplast acetohydroxy acid isomeroreductase [Glycine max] Back     alignment and taxonomy information
>gi|356549858|ref|XP_003543307.1| PREDICTED: ketol-acid reductoisomerase, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|356543900|ref|XP_003540396.1| PREDICTED: ketol-acid reductoisomerase, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|449438145|ref|XP_004136850.1| PREDICTED: ketol-acid reductoisomerase, chloroplastic-like [Cucumis sativus] gi|449526744|ref|XP_004170373.1| PREDICTED: ketol-acid reductoisomerase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15231092|ref|NP_191420.1| ketol-acid reductoisomerase [Arabidopsis thaliana] gi|145332887|ref|NP_001078309.1| ketol-acid reductoisomerase [Arabidopsis thaliana] gi|334186086|ref|NP_001190127.1| ketol-acid reductoisomerase [Arabidopsis thaliana] gi|12644387|sp|Q05758.2|ILV5_ARATH RecName: Full=Ketol-acid reductoisomerase, chloroplastic; AltName: Full=Acetohydroxy-acid reductoisomerase; AltName: Full=Alpha-keto-beta-hydroxylacil reductoisomerase; Flags: Precursor gi|11692838|gb|AAG40022.1|AF324671_1 AT3g58610 [Arabidopsis thaliana] gi|11993867|gb|AAG42917.1|AF329500_1 putative ketol-acid reductoisomerase [Arabidopsis thaliana] gi|402552|emb|CAA49506.1| ketol-acid reductoisomerase [Arabidopsis thaliana] gi|6735378|emb|CAB68199.1| ketol-acid reductoisomerase [Arabidopsis thaliana] gi|17063195|gb|AAL32973.1| AT3g58610/F14P22_200 [Arabidopsis thaliana] gi|17529224|gb|AAL38839.1| putative ketol-acid reductoisomerase [Arabidopsis thaliana] gi|20465493|gb|AAM20206.1| putative ketol-acid reductoisomerase [Arabidopsis thaliana] gi|23397061|gb|AAN31816.1| putative ketol-acid reductoisomerase [Arabidopsis thaliana] gi|23463055|gb|AAN33197.1| At3g58610/F14P22_200 [Arabidopsis thaliana] gi|332646283|gb|AEE79804.1| ketol-acid reductoisomerase [Arabidopsis thaliana] gi|332646284|gb|AEE79805.1| ketol-acid reductoisomerase [Arabidopsis thaliana] gi|332646285|gb|AEE79806.1| ketol-acid reductoisomerase [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query316
TAIR|locus:2076371 591 AT3G58610 [Arabidopsis thalian 0.971 0.519 0.736 2.2e-112
UNIPROTKB|Q01292 595 AHRI "Ketol-acid reductoisomer 0.968 0.514 0.689 7.2e-107
UNIPROTKB|Q65XK0 578 LOC_Os05g49800 "Ketol-acid red 0.810 0.442 0.797 4.7e-103
POMBASE|SPBC56F2.12 404 ilv5 "acetohydroxyacid reducto 0.623 0.487 0.364 8.4e-26
ASPGD|ASPL0000041782 400 AN2526 [Emericella nidulans (t 0.686 0.542 0.337 7.6e-25
UNIPROTKB|G4MW52 400 MGG_15774 "Ketol-acid reductoi 0.594 0.47 0.343 1.1e-23
CGD|CAL0000685 400 ILV5 [Candida albicans (taxid: 0.617 0.487 0.358 1.4e-23
SGD|S000004347 395 ILV5 "Acetohydroxyacid reducto 0.623 0.498 0.341 4.6e-22
TIGR_CMR|CHY_0519 330 CHY_0519 "ketol-acid reductois 0.560 0.536 0.328 3.7e-14
UNIPROTKB|P65149 333 ilvC "Ketol-acid reductoisomer 0.556 0.528 0.306 2.8e-10
TAIR|locus:2076371 AT3G58610 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1109 (395.4 bits), Expect = 2.2e-112, P = 2.2e-112
 Identities = 232/315 (73%), Positives = 253/315 (80%)

Query:     1 MAAATLPFSRPIPKFSPSPSSETL----KEALKHLNLASFSSTAKSLRALKTTTG----R 52
             MAAAT   +  +   SPS SS+TL       L   N+   SS++KSLR+L  T       
Sbjct:     1 MAAATSSIAPSLSCPSPSSSSKTLWSSKARTLALPNIGFLSSSSKSLRSLTATVAGNGAT 60

Query:    53 GSALSAWMASETALKTPFLLDFETSVFKKDMISLADRDEYIVRGGRDLFNLLPDAFNGIN 112
             GS+L+A M S +A+K P  LDFETSVFKK+ +SLA  +EYIVRGGRDLF  LPDAF GI 
Sbjct:    61 GSSLAARMVSSSAVKAPVSLDFETSVFKKEKVSLAGYEEYIVRGGRDLFKHLPDAFKGIK 120

Query:   113 QIGVIGWGSQGPAQAQNLRDSLAEAKSDIVVKVGLRKGSRSFAEARAAGFTEENGTLGDI 172
             QIGVIGWGSQGPAQAQNLRDSL EAKSDIVVK+GLRKGSRSF EARAAGFTEE+GTLGDI
Sbjct:   121 QIGVIGWGSQGPAQAQNLRDSLVEAKSDIVVKIGLRKGSRSFEEARAAGFTEESGTLGDI 180

Query:   173 YETISGSDLVLLLISDAAQADNYEKIFSCMKPNSIXXXXXXXXXXXXQSMGLDFPKNIGV 232
             +ETI+GSDLVLLLISDAAQADNYEKIFS MKPNSI            QS GLDFPKNI V
Sbjct:   181 WETIAGSDLVLLLISDAAQADNYEKIFSHMKPNSILGLSHGFLLGHLQSSGLDFPKNISV 240

Query:   233 IAVCPKGMGPSVRRLYVQGKEINGAGINSSFAVHQDVDGRATNVALGWSVALGSPFTFAT 292
             +AVCPKGMGPSVRRLYVQGKEINGAGIN+SFAVHQDVDGRA +VALGWSVALGSPFTFAT
Sbjct:   241 VAVCPKGMGPSVRRLYVQGKEINGAGINASFAVHQDVDGRAADVALGWSVALGSPFTFAT 300

Query:   293 TLEQEYRSDIFGERG 307
             TLEQEYRSDIFGERG
Sbjct:   301 TLEQEYRSDIFGERG 315
GO:0000166 "nucleotide binding" evidence=IEA
GO:0004455 "ketol-acid reductoisomerase activity" evidence=IEA;ISS
GO:0008652 "cellular amino acid biosynthetic process" evidence=IEA
GO:0009082 "branched-chain amino acid biosynthetic process" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0016616 "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0050662 "coenzyme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0005739 "mitochondrion" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0005618 "cell wall" evidence=IDA
GO:0046686 "response to cadmium ion" evidence=IEP;RCA
GO:0048046 "apoplast" evidence=IDA
GO:0005507 "copper ion binding" evidence=IDA
GO:0005829 "cytosol" evidence=RCA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0006096 "glycolysis" evidence=RCA
GO:0006164 "purine nucleotide biosynthetic process" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0009536 "plastid" evidence=IDA
UNIPROTKB|Q01292 AHRI "Ketol-acid reductoisomerase, chloroplastic" [Spinacia oleracea (taxid:3562)] Back     alignment and assigned GO terms
UNIPROTKB|Q65XK0 LOC_Os05g49800 "Ketol-acid reductoisomerase, chloroplastic" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
POMBASE|SPBC56F2.12 ilv5 "acetohydroxyacid reductoisomerase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ASPGD|ASPL0000041782 AN2526 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|G4MW52 MGG_15774 "Ketol-acid reductoisomerase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
CGD|CAL0000685 ILV5 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
SGD|S000004347 ILV5 "Acetohydroxyacid reductoisomerase and mtDNA binding protein" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0519 CHY_0519 "ketol-acid reductoisomerase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
UNIPROTKB|P65149 ilvC "Ketol-acid reductoisomerase" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q05758ILV5_ARATH1, ., 1, ., 1, ., 8, 60.87050.80690.4314yesno
Q65XK0ILV5_ORYSJ1, ., 1, ., 1, ., 8, 60.89830.74680.4083yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.10.921
4th Layer1.1.1.860.914

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00018719001
SubName- Full=Putative uncharacterized protein (Chromosome chr12 scaffold_18, whole genome shotgun sequence); (588 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00037861001
RecName- Full=Acetolactate synthase; EC=2.2.1.6; (657 aa)
• •• •• 0.982
GSVIVG00029877001
RecName- Full=Acetolactate synthase; EC=2.2.1.6; (616 aa)
• •• •• 0.979
GSVIVG00020486001
SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (564 aa)
• •• •• 0.963
GSVIVG00034729001
SubName- Full=Chromosome chr5 scaffold_72, whole genome shotgun sequence; (393 aa)
•    •• 0.960
GSVIVG00012144001
SubName- Full=Chromosome undetermined scaffold_351, whole genome shotgun sequence; (421 aa)
•    •• 0.958
GSVIVG00020487001
SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (72 aa)
  •  •  0.917
GSVIVG00005682001
SubName- Full=Chromosome chr5 scaffold_156, whole genome shotgun sequence; (447 aa)
• •   • 0.857
GSVIVG00026591001
RecName- Full=3-isopropylmalate dehydrogenase; EC=1.1.1.85;; Catalyzes the oxidation of 3-carbo [...] (405 aa)
• •   • 0.705
GSVIVG00004313001
SubName- Full=Chromosome undetermined scaffold_656, whole genome shotgun sequence; (463 aa)
• •  •• 0.697
GSVIVG00010385001
SubName- Full=Chromosome chr16 scaffold_258, whole genome shotgun sequence; (866 aa)
• •  •• 0.634

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query316
COG0059 338 COG0059, IlvC, Ketol-acid reductoisomerase [Amino 2e-45
TIGR00465 314 TIGR00465, ilvC, ketol-acid reductoisomerase 2e-43
pfam07991165 pfam07991, IlvN, Acetohydroxy acid isomeroreductas 9e-42
PRK05479 330 PRK05479, PRK05479, ketol-acid reductoisomerase; P 5e-40
PRK13403 335 PRK13403, PRK13403, ketol-acid reductoisomerase; P 2e-22
PRK05225 487 PRK05225, PRK05225, ketol-acid reductoisomerase; V 2e-16
>gnl|CDD|223137 COG0059, IlvC, Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information 
 Score =  156 bits (398), Expect = 2e-45
 Identities = 76/202 (37%), Positives = 112/202 (55%), Gaps = 30/202 (14%)

Query: 113 QIGVIGWGSQGPAQAQNLRDSLAEAKSDIVVKVGLRKGSRSFAEARAAGFTEENGTLGDI 172
           ++ +IG+GSQG AQA NLRDS         V +GLRKGS S+ +A+  GF      +  +
Sbjct: 20  KVAIIGYGSQGHAQALNLRDSGLN------VIIGLRKGSSSWKKAKEDGF-----KVYTV 68

Query: 173 YETISGSDLVLLLISDAAQADNYEK-IFSCMKPNSILGLSHGF--LLGHLQSMGLDFPKN 229
            E    +D+V++L+ D  Q + YEK I   +K  + LG +HGF    G +       PK+
Sbjct: 69  EEAAKRADVVMILLPDEQQKEVYEKEIAPNLKEGAALGFAHGFNIHFGLIVP-----PKD 123

Query: 230 IGVIAVCPKGMGPSVRRLYVQGKEINGAGINSSFAVHQDVDGRATNVALGWSVALGSPFT 289
           + VI V PKG G  VRR Y +G      G+ +  AVHQD  G+A ++AL ++  +G   T
Sbjct: 124 VDVIMVAPKGPGHLVRREYKEGF-----GVPALIAVHQDASGKALDIALAYAKGIGG--T 176

Query: 290 FA----TTLEQEYRSDIFGERG 307
            A    TT ++E  +D+FGE+ 
Sbjct: 177 RAGVIETTFKEETETDLFGEQA 198

Length = 338
>gnl|CDD|129557 TIGR00465, ilvC, ketol-acid reductoisomerase Back     alignment and domain information
>gnl|CDD|116601 pfam07991, IlvN, Acetohydroxy acid isomeroreductase, catalytic domain Back     alignment and domain information
>gnl|CDD|235491 PRK05479, PRK05479, ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>gnl|CDD|106361 PRK13403, PRK13403, ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>gnl|CDD|235368 PRK05225, PRK05225, ketol-acid reductoisomerase; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 316
PRK05225 487 ketol-acid reductoisomerase; Validated 100.0
COG0059 338 IlvC Ketol-acid reductoisomerase [Amino acid trans 100.0
PRK13403 335 ketol-acid reductoisomerase; Provisional 100.0
PRK05479 330 ketol-acid reductoisomerase; Provisional 100.0
TIGR00465 314 ilvC ketol-acid reductoisomerase. This is the seco 100.0
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 100.0
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 99.86
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 99.85
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 99.85
PRK07417279 arogenate dehydrogenase; Reviewed 99.82
PRK06545 359 prephenate dehydrogenase; Validated 99.81
PLN02256304 arogenate dehydrogenase 99.8
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 99.79
PLN02688266 pyrroline-5-carboxylate reductase 99.78
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 99.77
PRK08507275 prephenate dehydrogenase; Validated 99.77
PRK08818 370 prephenate dehydrogenase; Provisional 99.77
PF02153258 PDH: Prephenate dehydrogenase; InterPro: IPR003099 99.76
PRK07502 307 cyclohexadienyl dehydrogenase; Validated 99.75
PRK08655 437 prephenate dehydrogenase; Provisional 99.74
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 99.73
PTZ00431260 pyrroline carboxylate reductase; Provisional 99.73
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 99.69
PLN02712 667 arogenate dehydrogenase 99.68
PLN02712 667 arogenate dehydrogenase 99.67
PRK07680273 late competence protein ComER; Validated 99.66
PRK11199 374 tyrA bifunctional chorismate mutase/prephenate deh 99.63
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 99.62
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 99.62
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 99.61
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 99.58
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.55
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 99.55
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 99.54
PRK06130 311 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.54
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 99.54
PRK06932314 glycerate dehydrogenase; Provisional 99.51
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 99.51
PRK13243333 glyoxylate reductase; Reviewed 99.51
PRK07574385 formate dehydrogenase; Provisional 99.5
PRK06436303 glycerate dehydrogenase; Provisional 99.5
PLN03139386 formate dehydrogenase; Provisional 99.5
PRK06487317 glycerate dehydrogenase; Provisional 99.47
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 99.45
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 99.44
PRK12480330 D-lactate dehydrogenase; Provisional 99.44
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 99.44
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 99.44
PLN02928347 oxidoreductase family protein 99.43
KOG3124267 consensus Pyrroline-5-carboxylate reductase [Amino 99.43
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.42
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 99.41
TIGR00112245 proC pyrroline-5-carboxylate reductase. This enzym 99.41
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 99.41
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 99.4
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 99.39
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 99.39
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 99.38
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.38
PRK06444197 prephenate dehydrogenase; Provisional 99.38
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 99.37
COG2085211 Predicted dinucleotide-binding enzymes [General fu 99.32
PRK08605332 D-lactate dehydrogenase; Validated 99.3
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.3
KOG0068406 consensus D-3-phosphoglycerate dehydrogenase, D-is 99.3
PRK00094 325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 99.28
PLN02306386 hydroxypyruvate reductase 99.28
PRK15059 292 tartronate semialdehyde reductase; Provisional 99.28
PRK06129 308 3-hydroxyacyl-CoA dehydrogenase; Validated 99.28
TIGR00872 298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 99.27
PRK12490 299 6-phosphogluconate dehydrogenase-like protein; Rev 99.25
TIGR01505 291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 99.25
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 99.25
PRK15461 296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 99.22
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.22
PRK11559 296 garR tartronate semialdehyde reductase; Provisiona 99.19
PRK11861 673 bifunctional prephenate dehydrogenase/3-phosphoshi 99.14
TIGR01692 288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 99.14
PRK09599 301 6-phosphogluconate dehydrogenase-like protein; Rev 99.13
PRK12557 342 H(2)-dependent methylenetetrahydromethanopterin de 99.13
TIGR01724 341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 99.13
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 99.13
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 99.12
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 99.12
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 99.1
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.08
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 99.06
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 99.06
KOG2380 480 consensus Prephenate dehydrogenase (NADP+) [Amino 99.06
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.05
PRK12439 341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.04
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 99.04
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 99.0
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 98.97
PLN02858 1378 fructose-bisphosphate aldolase 98.93
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 98.91
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 98.88
PRK12921 305 2-dehydropantoate 2-reductase; Provisional 98.88
PRK14619 308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 98.88
KOG0409 327 consensus Predicted dehydrogenase [General functio 98.86
PTZ00075476 Adenosylhomocysteinase; Provisional 98.83
PLN02858 1378 fructose-bisphosphate aldolase 98.81
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 98.81
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 98.8
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 98.79
PRK08229 341 2-dehydropantoate 2-reductase; Provisional 98.79
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 98.71
PRK14620 326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 98.7
PRK11730 715 fadB multifunctional fatty acid oxidation complex 98.68
COG1250 307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 98.67
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 98.65
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 98.64
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 98.64
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 98.6
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 98.57
PRK06249 313 2-dehydropantoate 2-reductase; Provisional 98.57
PRK15182 425 Vi polysaccharide biosynthesis protein TviB; Provi 98.55
PRK08306296 dipicolinate synthase subunit A; Reviewed 98.52
COG1023 300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 98.5
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 98.46
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 98.42
PLN02494477 adenosylhomocysteinase 98.4
COG0240 329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 98.39
PTZ00345 365 glycerol-3-phosphate dehydrogenase; Provisional 98.39
TIGR03376 342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 98.37
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.36
PRK13304265 L-aspartate dehydrogenase; Reviewed 98.34
PRK13302271 putative L-aspartate dehydrogenase; Provisional 98.29
PRK09287 459 6-phosphogluconate dehydrogenase; Validated 98.26
PLN02353 473 probable UDP-glucose 6-dehydrogenase 98.24
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 98.2
PRK15057 388 UDP-glucose 6-dehydrogenase; Provisional 98.17
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.16
COG4007 340 Predicted dehydrogenase related to H2-forming N5,N 98.14
COG1893 307 ApbA Ketopantoate reductase [Coenzyme metabolism] 98.11
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 98.09
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 98.08
PRK08269 314 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.07
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 98.06
PRK05708305 2-dehydropantoate 2-reductase; Provisional 98.05
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 98.05
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 98.04
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 98.0
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.98
COG0362 473 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate 97.96
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 97.89
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 97.83
PRK06141314 ornithine cyclodeaminase; Validated 97.81
COG0677 436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 97.79
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 97.76
PRK00048257 dihydrodipicolinate reductase; Provisional 97.76
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 97.75
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.74
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 97.71
PRK13303265 L-aspartate dehydrogenase; Provisional 97.69
KOG2304298 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 97.65
PLN00203519 glutamyl-tRNA reductase 97.65
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.63
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 97.6
COG0499420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 97.56
PRK07340304 ornithine cyclodeaminase; Validated 97.56
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 97.55
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 97.53
TIGR00036266 dapB dihydrodipicolinate reductase. 97.52
KOG1370434 consensus S-adenosylhomocysteine hydrolase [Coenzy 97.52
PRK04207 341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 97.49
PRK06223307 malate dehydrogenase; Reviewed 97.46
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 97.42
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 97.38
PRK08618325 ornithine cyclodeaminase; Validated 97.37
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 97.34
PRK13940414 glutamyl-tRNA reductase; Provisional 97.33
TIGR01921 324 DAP-DH diaminopimelate dehydrogenase. This model r 97.33
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.3
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.3
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 97.29
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 97.29
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 97.29
PRK07589346 ornithine cyclodeaminase; Validated 97.29
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 97.28
PRK06718202 precorrin-2 dehydrogenase; Reviewed 97.28
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 97.28
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 97.27
PRK00961342 H(2)-dependent methylenetetrahydromethanopterin de 97.27
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 97.25
PRK00436 343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 97.23
PRK08300302 acetaldehyde dehydrogenase; Validated 97.22
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 97.21
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 97.2
PRK06046326 alanine dehydrogenase; Validated 97.2
KOG2711 372 consensus Glycerol-3-phosphate dehydrogenase/dihyd 97.19
PRK06407301 ornithine cyclodeaminase; Provisional 97.18
TIGR01723340 hmd_TIGR 5,10-methenyltetrahydromethanopterin hydr 97.17
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 97.14
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 97.13
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 97.11
COG0673 342 MviM Predicted dehydrogenases and related proteins 97.1
TIGR00745 293 apbA_panE 2-dehydropantoate 2-reductase. This mode 97.1
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 97.06
PRK06823315 ornithine cyclodeaminase; Validated 97.04
KOG2305 313 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 97.02
PRK08291330 ectoine utilization protein EutC; Validated 97.0
PRK13301267 putative L-aspartate dehydrogenase; Provisional 96.99
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 96.99
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 96.99
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.98
COG5495289 Uncharacterized conserved protein [Function unknow 96.96
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 96.94
TIGR01850 346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 96.94
cd05292 308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 96.93
PRK06719157 precorrin-2 dehydrogenase; Validated 96.92
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 96.92
PRK09496 453 trkA potassium transporter peripheral membrane com 96.89
PTZ00117 319 malate dehydrogenase; Provisional 96.89
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.85
PRK12549284 shikimate 5-dehydrogenase; Reviewed 96.84
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 96.83
KOG2653 487 consensus 6-phosphogluconate dehydrogenase [Carboh 96.83
COG0569225 TrkA K+ transport systems, NAD-binding component [ 96.82
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 96.82
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.8
PRK14982340 acyl-ACP reductase; Provisional 96.74
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 96.72
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.71
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.7
PRK06199379 ornithine cyclodeaminase; Validated 96.69
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.68
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.66
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.63
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.61
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 96.6
PRK11579 346 putative oxidoreductase; Provisional 96.59
PRK10206 344 putative oxidoreductase; Provisional 96.59
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 96.59
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 96.58
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 96.58
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 96.55
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.54
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 96.54
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.54
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 96.52
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.5
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.48
PTZ00082 321 L-lactate dehydrogenase; Provisional 96.48
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 96.46
COG1004 414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 96.46
TIGR01546 333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 96.45
PRK00066 315 ldh L-lactate dehydrogenase; Reviewed 96.41
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.41
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 96.39
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.38
PRK03659601 glutathione-regulated potassium-efflux system prot 96.37
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 96.36
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.35
PRK00683 418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.32
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.32
COG0136 334 Asd Aspartate-semialdehyde dehydrogenase [Amino ac 96.31
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 96.31
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 96.3
PRK04148134 hypothetical protein; Provisional 96.29
PRK10669558 putative cation:proton antiport protein; Provision 96.28
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 96.22
PRK09496453 trkA potassium transporter peripheral membrane com 96.22
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 96.21
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 96.19
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.16
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.16
PF0262996 CoA_binding: CoA binding domain; InterPro: IPR0037 96.13
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 96.13
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 96.08
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 96.04
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.02
PRK03562621 glutathione-regulated potassium-efflux system prot 96.0
cd01338 322 MDH_choloroplast_like Chloroplast-like malate dehy 95.81
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.75
PRK00676338 hemA glutamyl-tRNA reductase; Validated 95.75
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 95.74
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 95.7
cd05297 423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 95.69
PRK00421 461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 95.68
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 95.59
PRK05442 326 malate dehydrogenase; Provisional 95.57
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.57
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.47
PRK11863 313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 95.46
cd05293 312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 95.44
TIGR02717 447 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP 95.4
PF03720106 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogen 95.4
COG4074343 Mth H2-forming N5,N10-methylenetetrahydromethanopt 95.36
TIGR01759 323 MalateDH-SF1 malate dehydrogenase. This model repr 95.34
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.29
TIGR01851 310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 95.27
PRK12548289 shikimate 5-dehydrogenase; Provisional 95.25
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 95.22
PLN02968 381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 95.19
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 95.17
PRK14874 334 aspartate-semialdehyde dehydrogenase; Provisional 95.15
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.15
cd01336 325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 95.05
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 94.97
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.96
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.94
PRK05671 336 aspartate-semialdehyde dehydrogenase; Reviewed 94.94
PTZ00325 321 malate dehydrogenase; Provisional 94.93
PLN02383 344 aspartate semialdehyde dehydrogenase 94.93
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 94.93
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.91
PRK06270 341 homoserine dehydrogenase; Provisional 94.85
TIGR01758 324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 94.8
KOG0067435 consensus Transcription factor CtBP [Transcription 94.79
COG0002 349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 94.72
PRK01390 460 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.71
COG2344211 AT-rich DNA-binding protein [General function pred 94.68
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 94.66
KOG0022375 consensus Alcohol dehydrogenase, class III [Second 94.6
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 94.59
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 94.59
PLN03075296 nicotianamine synthase; Provisional 94.57
PRK06349 426 homoserine dehydrogenase; Provisional 94.54
cd05290 307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 94.48
PF10100 429 DUF2338: Uncharacterized protein conserved in bact 94.47
COG0026 375 PurK Phosphoribosylaminoimidazole carboxylase (NCA 94.45
PLN02602 350 lactate dehydrogenase 94.44
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 94.42
PF04016147 DUF364: Domain of unknown function (DUF364); Inter 94.41
TIGR01745 366 asd_gamma aspartate-semialdehyde dehydrogenase, ga 94.38
PF00185158 OTCace: Aspartate/ornithine carbamoyltransferase, 94.35
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 94.32
PRK02006 498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.32
KOG2741 351 consensus Dimeric dihydrodiol dehydrogenase [Carbo 94.32
PRK09880343 L-idonate 5-dehydrogenase; Provisional 94.32
TIGR00670301 asp_carb_tr aspartate carbamoyltransferase. Ornith 94.3
PRK05086 312 malate dehydrogenase; Provisional 94.3
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 94.28
PLN02353473 probable UDP-glucose 6-dehydrogenase 94.26
TIGR01761 343 thiaz-red thiazolinyl imide reductase. This reduct 94.25
PRK08306296 dipicolinate synthase subunit A; Reviewed 94.24
cd00704 323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 94.23
TIGR01772 312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 94.19
PRK06019 372 phosphoribosylaminoimidazole carboxylase ATPase su 94.18
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 94.16
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 94.16
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.11
PRK08040 336 putative semialdehyde dehydrogenase; Provisional 94.1
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 94.09
PRK15076 431 alpha-galactosidase; Provisional 94.07
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 94.05
COG2910211 Putative NADH-flavin reductase [General function p 94.04
PRK06598 369 aspartate-semialdehyde dehydrogenase; Reviewed 93.99
PRK05678291 succinyl-CoA synthetase subunit alpha; Validated 93.96
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 93.92
cd01337 310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 93.92
PRK08664 349 aspartate-semialdehyde dehydrogenase; Reviewed 93.76
cd01483143 E1_enzyme_family Superfamily of activating enzymes 93.68
PRK08328231 hypothetical protein; Provisional 93.68
PLN00106323 malate dehydrogenase 93.67
TIGR00978 341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 93.61
COG0031 300 CysK Cysteine synthase [Amino acid transport and m 93.6
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 93.57
PRK04690 468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.55
PRK10537393 voltage-gated potassium channel; Provisional 93.55
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 93.53
PLN02586360 probable cinnamyl alcohol dehydrogenase 93.45
PRK04284332 ornithine carbamoyltransferase; Provisional 93.43
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 93.4
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 93.4
PRK05562223 precorrin-2 dehydrogenase; Provisional 93.38
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 93.38
PRK14027283 quinate/shikimate dehydrogenase; Provisional 93.35
PRK14804311 ornithine carbamoyltransferase; Provisional 93.28
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.28
TIGR01019286 sucCoAalpha succinyl-CoA synthetase, alpha subunit 93.28
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 93.27
PRK12562334 ornithine carbamoyltransferase subunit F; Provisio 93.25
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 93.21
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 93.17
PRK02318 381 mannitol-1-phosphate 5-dehydrogenase; Provisional 93.08
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 93.07
PRK06728 347 aspartate-semialdehyde dehydrogenase; Provisional 93.04
PRK09414445 glutamate dehydrogenase; Provisional 93.04
PTZ00187317 succinyl-CoA synthetase alpha subunit; Provisional 93.02
TIGR01771299 L-LDH-NAD L-lactate dehydrogenase. This model repr 92.93
PRK01713334 ornithine carbamoyltransferase; Provisional 92.76
PRK10637 457 cysG siroheme synthase; Provisional 92.71
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 92.54
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 92.52
PRK03806 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.42
PRK05597 355 molybdopterin biosynthesis protein MoeB; Validated 92.41
PRK02102331 ornithine carbamoyltransferase; Validated 92.41
PRK03515336 ornithine carbamoyltransferase subunit I; Provisio 92.26
CHL00194 317 ycf39 Ycf39; Provisional 92.22
PRK12550272 shikimate 5-dehydrogenase; Reviewed 92.19
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 92.17
PRK05600 370 thiamine biosynthesis protein ThiF; Validated 92.16
TIGR01757 387 Malate-DH_plant malate dehydrogenase, NADP-depende 92.14
TIGR01296 339 asd_B aspartate-semialdehyde dehydrogenase (peptid 92.12
COG0078310 ArgF Ornithine carbamoyltransferase [Amino acid tr 92.12
PRK14573 809 bifunctional D-alanyl-alanine synthetase A/UDP-N-a 92.1
PRK08223287 hypothetical protein; Validated 92.06
TIGR01318 467 gltD_gamma_fam glutamate synthase small subunit fa 91.98
TIGR02819393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 91.84
PRK00856305 pyrB aspartate carbamoyltransferase catalytic subu 91.83
PLN02477410 glutamate dehydrogenase 91.77
cd01486 307 Apg7 Apg7 is an E1-like protein, that activates tw 91.75
PLN00112 444 malate dehydrogenase (NADP); Provisional 91.72
PRK03803 448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.7
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 91.59
PLN02342348 ornithine carbamoyltransferase 91.59
PRK07200395 aspartate/ornithine carbamoyltransferase family pr 91.49
PRK07878 392 molybdopterin biosynthesis-like protein MoeZ; Vali 91.46
TIGR01087 433 murD UDP-N-acetylmuramoylalanine--D-glutamate liga 91.39
PRK00779304 ornithine carbamoyltransferase; Provisional 91.38
cd08255277 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ 91.22
PRK07877 722 hypothetical protein; Provisional 91.2
PRK06392 326 homoserine dehydrogenase; Provisional 91.15
PRK08374 336 homoserine dehydrogenase; Provisional 91.12
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 90.87
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 90.82
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 90.8
TIGR03316357 ygeW probable carbamoyltransferase YgeW. Members o 90.76
PLN02514357 cinnamyl-alcohol dehydrogenase 90.74
PRK14031444 glutamate dehydrogenase; Provisional 90.73
COG0039 313 Mdh Malate/lactate dehydrogenases [Energy producti 90.72
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 90.71
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 90.67
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 90.63
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 90.59
PRK01581374 speE spermidine synthase; Validated 90.52
PLN02178375 cinnamyl-alcohol dehydrogenase 90.42
PRK07411 390 hypothetical protein; Validated 90.39
KOG0023360 consensus Alcohol dehydrogenase, class V [Secondar 90.31
PRK08265261 short chain dehydrogenase; Provisional 90.28
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid tra 90.28
TIGR00658304 orni_carb_tr ornithine carbamoyltransferase. Most 90.26
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 90.14
TIGR03693 637 ocin_ThiF_like putative thiazole-containing bacter 90.13
PLN02527306 aspartate carbamoyltransferase 90.09
TIGR01082 448 murC UDP-N-acetylmuramate--alanine ligase. UDP-N-a 90.04
TIGR01161 352 purK phosphoribosylaminoimidazole carboxylase, Pur 90.02
TIGR01532 325 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas 90.0
COG0334411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 90.0
PRK02255338 putrescine carbamoyltransferase; Provisional 89.78
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 89.69
PRK06153393 hypothetical protein; Provisional 89.46
KOG3007333 consensus Mu-crystallin [Amino acid transport and 89.39
PRK15182425 Vi polysaccharide biosynthesis protein TviB; Provi 89.38
PRK12409 410 D-amino acid dehydrogenase small subunit; Provisio 89.38
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 89.27
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 89.23
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 89.13
PRK06057255 short chain dehydrogenase; Provisional 89.06
PRK08192338 aspartate carbamoyltransferase; Provisional 88.88
PRK10083339 putative oxidoreductase; Provisional 88.86
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 88.85
cd08285351 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. 88.74
PRK07774250 short chain dehydrogenase; Provisional 88.7
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 88.67
PRK05717255 oxidoreductase; Validated 88.65
PRK06114254 short chain dehydrogenase; Provisional 88.62
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 88.6
PLN02827378 Alcohol dehydrogenase-like 88.59
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-a 88.46
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 88.43
PRK04523335 N-acetylornithine carbamoyltransferase; Reviewed 88.41
PRK07825273 short chain dehydrogenase; Provisional 88.39
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 88.38
cd08283386 FDH_like_1 Glutathione-dependent formaldehyde dehy 88.31
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 88.31
PLN02948 577 phosphoribosylaminoimidazole carboxylase 88.3
cd08234334 threonine_DH_like L-threonine dehydrogenase. L-thr 88.28
PLN02740381 Alcohol dehydrogenase-like 88.27
PRK07060245 short chain dehydrogenase; Provisional 88.26
PRK12828239 short chain dehydrogenase; Provisional 88.25
PRK09242257 tropinone reductase; Provisional 88.11
PRK07523255 gluconate 5-dehydrogenase; Provisional 88.11
PRK11891429 aspartate carbamoyltransferase; Provisional 88.1
PRK12937245 short chain dehydrogenase; Provisional 88.09
PRK07478254 short chain dehydrogenase; Provisional 88.08
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 87.99
PRK14805302 ornithine carbamoyltransferase; Provisional 87.95
cd05283337 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam 87.9
PRK05867253 short chain dehydrogenase; Provisional 87.9
cd08277365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 87.9
PRK12810 471 gltD glutamate synthase subunit beta; Reviewed 87.74
PRK06138252 short chain dehydrogenase; Provisional 87.73
PLN00125300 Succinyl-CoA ligase [GDP-forming] subunit alpha 87.67
PRK13984604 putative oxidoreductase; Provisional 87.61
cd08284344 FDH_like_2 Glutathione-dependent formaldehyde dehy 87.59
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 87.55
PRK12814 652 putative NADPH-dependent glutamate synthase small 87.54
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 87.52
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 87.4
PLN02214 342 cinnamoyl-CoA reductase 87.33
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 87.28
PRK08936261 glucose-1-dehydrogenase; Provisional 87.16
PRK06197306 short chain dehydrogenase; Provisional 87.08
PRK13814310 pyrB aspartate carbamoyltransferase catalytic subu 87.0
cd08298329 CAD2 Cinnamyl alcohol dehydrogenases (CAD). These 86.9
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 86.9
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 86.83
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information 
Probab=100.00  E-value=1.9e-43  Score=350.08  Aligned_cols=219  Identities=31%  Similarity=0.476  Sum_probs=198.0

Q ss_pred             ccccccchhhhhhccccchhhHHhhcCCccccccccccCCCCEEEEEcccchHHHHHHHHHhhhhhhcCCcEEEEEecCC
Q 021218           71 LLDFETSVFKKDMISLADRDEYIVRGGRDLFNLLPDAFNGINQIGVIGWGSQGPAQAQNLRDSLAEAKSDIVVKVGLRKG  150 (316)
Q Consensus        71 ~~~~~~~~~~~~~~~l~~~~e~vv~~G~w~F~~~~~~l~G~kkIGIIG~G~mG~AlA~~Lr~~~~~~g~G~~Vivg~r~~  150 (316)
                      ++|||+..|+.+..+|..-. .. .  |-.|++....|+| |+|+|||+|+||.++|.+|+++      |++|+++.|++
T Consensus         1 ~~~~~~~~~~~~~~~~~~~r-~~-~--r~ef~~~~~~Lkg-KtIaIIGyGSqG~AqAlNLrdS------GvnVvvglr~~   69 (487)
T PRK05225          1 ANYFNTLNLRQQLAQLGKCR-FM-D--RDEFADGASYLKG-KKIVIVGCGAQGLNQGLNMRDS------GLDISYALRKE   69 (487)
T ss_pred             CCccccccHHHHHHHhccce-ec-c--hhhccchhHHhCC-CEEEEEccCHHHHHHhCCCccc------cceeEEecccc
Confidence            48999999998877665433 21 1  2256666799999 9999999999999999999999      99999999987


Q ss_pred             -----cccHHHHHHCCceecCCCcCCHHhhhccCCEEEEcccCchHHHHHHHHHhcCCCCcEEEEeCCchhhhhhccccC
Q 021218          151 -----SRSFAEARAAGFTEENGTLGDIYETISGSDLVLLLISDAAQADNYEKIFSCMKPNSILGLSHGFLLGHLQSMGLD  225 (316)
Q Consensus       151 -----~~s~~~A~~~G~~~~~~t~~~~~e~i~~ADIViLavp~~~~~~vi~ei~~~mk~gaiLid~aGv~l~~l~~~~~~  225 (316)
                           +++++.|.+.|+.     ..+.+|++++||+|++++|+..+..++++++++||+|++|..+|||++.+..   ..
T Consensus        70 ~id~~~~s~~kA~~dGF~-----v~~~~Ea~~~ADvVviLlPDt~q~~v~~~i~p~LK~Ga~L~fsHGFni~~~~---i~  141 (487)
T PRK05225         70 AIAEKRASWRKATENGFK-----VGTYEELIPQADLVINLTPDKQHSDVVRAVQPLMKQGAALGYSHGFNIVEVG---EQ  141 (487)
T ss_pred             ccccccchHHHHHhcCCc-----cCCHHHHHHhCCEEEEcCChHHHHHHHHHHHhhCCCCCEEEecCCceeeeCc---ee
Confidence                 5788899999997     4589999999999999999998777889999999999999999999976654   48


Q ss_pred             CCCCccEEEeccCCCchhhHHHHhcCccccCCCceEEEeec--cCCCHHHHHHHHHHHHHcCCCC--eeecChhHHHhhc
Q 021218          226 FPKNIGVIAVCPKGMGPSVRRLYVQGKEINGAGINSSFAVH--QDVDGRATNVALGWSVALGSPF--TFATTLEQEYRSD  301 (316)
Q Consensus       226 ~~~~i~vI~vhPn~pg~~~r~lf~~G~e~~G~G~~~iiap~--~d~~~~a~e~a~~l~~alG~~~--~~~tT~~~e~~~d  301 (316)
                      +|+|++||+++|++||+.+|++|++|     +|+|++|+++  ||+++++.|++++|+.++|+.|  +++|||++|++||
T Consensus       142 ~~~dvdVimvAPKgpG~~vR~~y~~G-----~Gvp~l~AV~~~qD~~g~a~~~ala~a~~iG~~ragv~~ttf~~E~~sD  216 (487)
T PRK05225        142 IRKDITVVMVAPKCPGTEVREEYKRG-----FGVPTLIAVHPENDPKGEGMAIAKAWAAATGGHRAGVLESSFVAEVKSD  216 (487)
T ss_pred             CCCCCcEEEECCCCCCchHHHHHhcC-----CCceEEEEEeecCCCCchHHHHHHHHHHHhCCCccceeecchHHHHhhc
Confidence            89999999999999999999999998     8999999999  8999999999999999999996  8999999999999


Q ss_pred             chhhhhhccCcc
Q 021218          302 IFGERGECFPAS  313 (316)
Q Consensus       302 l~~e~~~l~g~~  313 (316)
                      |||||+||||++
T Consensus       217 L~GEq~vLcG~~  228 (487)
T PRK05225        217 LMGEQTILCGML  228 (487)
T ss_pred             chhhHHHHHhHH
Confidence            999999999998

>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PF02153 PDH: Prephenate dehydrogenase; InterPro: IPR003099 Members of this family are prephenate dehydrogenases 1 Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>KOG3124 consensus Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00112 proC pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG0068 consensus D-3-phosphoglycerate dehydrogenase, D-isomer-specific 2-hydroxy acid dehydrogenase superfamily [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK11861 bifunctional prephenate dehydrogenase/3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>KOG2380 consensus Prephenate dehydrogenase (NADP+) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG4007 Predicted dehydrogenase related to H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [General function prediction only] Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK08269 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>KOG1370 consensus S-adenosylhomocysteine hydrolase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00961 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase; Provisional Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>KOG2711 consensus Glycerol-3-phosphate dehydrogenase/dihydroxyacetone 3-phosphate reductase [Energy production and conversion] Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>TIGR01723 hmd_TIGR 5,10-methenyltetrahydromethanopterin hydrogenase Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>TIGR00745 apbA_panE 2-dehydropantoate 2-reductase Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>KOG2305 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG5495 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>KOG2653 consensus 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain Back     alignment and domain information
>PF03720 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain; InterPro: IPR014027 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>COG4074 Mth H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>KOG0067 consensus Transcription factor CtBP [Transcription] Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PF10100 DUF2338: Uncharacterized protein conserved in bacteria (DUF2338); InterPro: IPR016935 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PF04016 DUF364: Domain of unknown function (DUF364); InterPro: IPR007161 This is a entry represents of bacterial and archaeal proteins of unknown function Back     alignment and domain information
>TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial Back     alignment and domain information
>PF00185 OTCace: Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain; InterPro: IPR006131 This family contains two related enzymes: Aspartate carbamoyltransferase (2 Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG2741 consensus Dimeric dihydrodiol dehydrogenase [Carbohydrate transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR00670 asp_carb_tr aspartate carbamoyltransferase Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK15076 alpha-galactosidase; Provisional Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK05678 succinyl-CoA synthetase subunit alpha; Validated Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>COG0031 CysK Cysteine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>PRK04284 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK14804 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01019 sucCoAalpha succinyl-CoA synthetase, alpha subunit Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK12562 ornithine carbamoyltransferase subunit F; Provisional Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>PRK02318 mannitol-1-phosphate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00187 succinyl-CoA synthetase alpha subunit; Provisional Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase Back     alignment and domain information
>PRK01713 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK02102 ornithine carbamoyltransferase; Validated Back     alignment and domain information
>PRK03515 ornithine carbamoyltransferase subunit I; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>COG0078 ArgF Ornithine carbamoyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>PRK00856 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PLN02342 ornithine carbamoyltransferase Back     alignment and domain information
>PRK07200 aspartate/ornithine carbamoyltransferase family protein; Validated Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase Back     alignment and domain information
>PRK00779 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>TIGR03316 ygeW probable carbamoyltransferase YgeW Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00658 orni_carb_tr ornithine carbamoyltransferase Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein Back     alignment and domain information
>PLN02527 aspartate carbamoyltransferase Back     alignment and domain information
>TIGR01082 murC UDP-N-acetylmuramate--alanine ligase Back     alignment and domain information
>TIGR01161 purK phosphoribosylaminoimidazole carboxylase, PurK protein Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK02255 putrescine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>KOG3007 consensus Mu-crystallin [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08192 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>PRK10083 putative oxidoreductase; Provisional Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>PRK04523 N-acetylornithine carbamoyltransferase; Reviewed Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>cd08234 threonine_DH_like L-threonine dehydrogenase Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK11891 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>PRK14805 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00125 Succinyl-CoA ligase [GDP-forming] subunit alpha Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13814 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query316
3fr7_A 525 Ketol-Acid Reductoisomerase (Kari) In Complex With 1e-114
1yve_I 524 Acetohydroxy Acid Isomeroreductase Complexed With N 1e-113
1np3_A 338 Crystal Structure Of Class I Acetohydroxy Acid Isom 9e-18
3ulk_A 491 E. Coli Ketol-Acid Reductoisomerase In Complex With 5e-07
1yrl_A 491 Escherichia Coli Ketol-Acid Reductoisomerase Length 6e-07
>pdb|3FR7|A Chain A, Ketol-Acid Reductoisomerase (Kari) In Complex With Mg2+ Length = 525 Back     alignment and structure 
Iteration: 1

 Score =  408 bits (1049), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 200/236 (84%), Positives = 213/236 (90%)
Query: 72  LDFETSVFKKDMISLADRDEYIVRGGRDLFNLLPDAFNGINQIGVIGWGSQGPAQAQNLR 131
           LDF+TSVF K+ +SLA  +EYIVRGGR+LF LLP+AF GI QIGVIGWGSQGPAQAQNLR
Sbjct: 15  LDFDTSVFNKEKVSLAGHEEYIVRGGRNLFPLLPEAFKGIKQIGVIGWGSQGPAQAQNLR 74
Query: 132 DSLAEAKSDIVVKVGLRKGSRSFAEARAAGFTEENGTLGDIYETISGSDLVLLLISDAAQ 191
           DSLAEAKSDIVVK+GLRKGS+SF EARAAGFTEE+GTLGDI+ET+SGSDLVLLLISDAAQ
Sbjct: 75  DSLAEAKSDIVVKIGLRKGSKSFDEARAAGFTEESGTLGDIWETVSGSDLVLLLISDAAQ 134
Query: 192 ADNYEKIFSCMKPNSIXXXXXXXXXXXXQSMGLDFPKNIGVIAVCPKGMGPSVRRLYVQG 251
           ADNYEKIFS MKPNSI            QS GLDFPKNI VIAVCPKGMGPSVRRLYVQG
Sbjct: 135 ADNYEKIFSHMKPNSILGLSHGFLLGHLQSAGLDFPKNISVIAVCPKGMGPSVRRLYVQG 194
Query: 252 KEINGAGINSSFAVHQDVDGRATNVALGWSVALGSPFTFATTLEQEYRSDIFGERG 307
           KEINGAGINSSFAVHQDVDGRAT+VALGWSVALGSPFTFATTLEQEY+SDIFGERG
Sbjct: 195 KEINGAGINSSFAVHQDVDGRATDVALGWSVALGSPFTFATTLEQEYKSDIFGERG 250
>pdb|1YVE|I Chain I, Acetohydroxy Acid Isomeroreductase Complexed With Nadph, Magnesium And Inhibitor Ipoha (N-Hydroxy-N- Isopropyloxamate) Length = 524 Back     alignment and structure
>pdb|1NP3|A Chain A, Crystal Structure Of Class I Acetohydroxy Acid Isomeroreductase From Pseudomonas Aeruginosa Length = 338 Back     alignment and structure
>pdb|3ULK|A Chain A, E. Coli Ketol-Acid Reductoisomerase In Complex With Nadph And Mg2+ Length = 491 Back     alignment and structure
>pdb|1YRL|A Chain A, Escherichia Coli Ketol-Acid Reductoisomerase Length = 491 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query316
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 1e-118
1np3_A 338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 1e-42
1yrl_A 491 Ketol-acid reductoisomerase; branched-chain amino 6e-39
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 6e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
3c7a_A 404 Octopine dehydrogenase; L) stereospecific opine de 6e-05
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Length = 525 Back     alignment and structure
 Score =  350 bits (900), Expect = e-118
 Identities = 212/236 (89%), Positives = 225/236 (95%)

Query: 72  LDFETSVFKKDMISLADRDEYIVRGGRDLFNLLPDAFNGINQIGVIGWGSQGPAQAQNLR 131
           LDF+TSVF K+ +SLA  +EYIVRGGR+LF LLP+AF GI QIGVIGWGSQGPAQAQNLR
Sbjct: 15  LDFDTSVFNKEKVSLAGHEEYIVRGGRNLFPLLPEAFKGIKQIGVIGWGSQGPAQAQNLR 74

Query: 132 DSLAEAKSDIVVKVGLRKGSRSFAEARAAGFTEENGTLGDIYETISGSDLVLLLISDAAQ 191
           DSLAEAKSDIVVK+GLRKGS+SF EARAAGFTEE+GTLGDI+ET+SGSDLVLLLISDAAQ
Sbjct: 75  DSLAEAKSDIVVKIGLRKGSKSFDEARAAGFTEESGTLGDIWETVSGSDLVLLLISDAAQ 134

Query: 192 ADNYEKIFSCMKPNSILGLSHGFLLGHLQSMGLDFPKNIGVIAVCPKGMGPSVRRLYVQG 251
           ADNYEKIFS MKPNSILGLSHGFLLGHLQS GLDFPKNI VIAVCPKGMGPSVRRLYVQG
Sbjct: 135 ADNYEKIFSHMKPNSILGLSHGFLLGHLQSAGLDFPKNISVIAVCPKGMGPSVRRLYVQG 194

Query: 252 KEINGAGINSSFAVHQDVDGRATNVALGWSVALGSPFTFATTLEQEYRSDIFGERG 307
           KEINGAGINSSFAVHQDVDGRAT+VALGWSVALGSPFTFATTLEQEY+SDIFGERG
Sbjct: 195 KEINGAGINSSFAVHQDVDGRATDVALGWSVALGSPFTFATTLEQEYKSDIFGERG 250
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Length = 338 Back     alignment and structure
>1yrl_A Ketol-acid reductoisomerase; branched-chain amino acid biosynthesis, knotted protein, oxidoreductase; 2.60A {Escherichia coli} Length = 491 Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Length = 286 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Length = 404 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query316
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 100.0
3ulk_A 491 Ketol-acid reductoisomerase; branched-chain amino 100.0
1np3_A 338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 99.95
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 99.83
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 99.82
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 99.8
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 99.8
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 99.72
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 99.72
2izz_A 322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 99.69
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 99.67
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 99.67
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 99.67
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 99.66
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 99.66
2pv7_A 298 T-protein [includes: chorismate mutase (EC 5.4.99 99.65
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 99.63
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 99.63
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 99.63
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 99.61
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 99.61
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 99.61
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 99.59
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 99.59
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 99.59
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 99.59
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 99.58
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 99.58
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 99.58
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 99.57
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 99.56
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 99.56
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 99.56
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 99.56
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 99.55
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 99.54
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 99.54
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 99.53
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 99.53
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 99.52
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 99.52
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 99.52
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 99.52
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 99.52
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 99.51
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 99.51
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 99.5
3qsg_A 312 NAD-binding phosphogluconate dehydrogenase-like P; 99.5
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 99.5
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 99.48
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 99.47
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 99.47
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 99.47
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 99.46
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 99.46
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 99.46
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 99.45
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 99.44
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 99.44
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 99.43
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 99.43
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 99.43
3obb_A 300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 99.4
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 99.4
3pdu_A 287 3-hydroxyisobutyrate dehydrogenase family protein; 99.4
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 99.4
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 99.4
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 99.38
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 99.07
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 99.34
4ezb_A 317 Uncharacterized conserved protein; structural geno 99.34
3qha_A296 Putative oxidoreductase; seattle structural genomi 99.33
1txg_A 335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 99.33
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 99.32
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 99.32
2gf2_A 296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 99.31
1evy_A 366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 99.3
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 99.3
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 99.29
1yj8_A 375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 99.28
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 99.27
1x0v_A 354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 99.27
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 99.26
1yb4_A 295 Tartronic semialdehyde reductase; structural genom 99.25
4gbj_A 297 6-phosphogluconate dehydrogenase NAD-binding; stru 99.24
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 99.24
3cky_A 301 2-hydroxymethyl glutarate dehydrogenase; rossmann 99.24
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 99.24
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 99.23
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 99.23
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 99.23
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 99.23
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 99.23
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 99.22
2cvz_A 289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 99.21
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 99.19
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 99.18
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 99.18
2qyt_A 317 2-dehydropantoate 2-reductase; APC81190, porphyrom 99.16
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 99.16
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 99.16
1z82_A 335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 99.15
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 99.13
3hn2_A 312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 99.11
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 99.09
3ado_A 319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 99.0
3i83_A 320 2-dehydropantoate 2-reductase; structural genomics 98.99
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 98.98
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 98.97
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 98.93
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 98.93
2rir_A300 Dipicolinate synthase, A chain; structural genomic 98.92
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 98.91
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 98.88
3ghy_A 335 Ketopantoate reductase protein; oxidoreductase, NA 98.88
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 98.87
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 98.86
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 98.84
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 98.79
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 98.78
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 98.75
3c7a_A 404 Octopine dehydrogenase; L) stereospecific opine de 98.73
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 98.7
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 98.7
1dlj_A 402 UDP-glucose dehydrogenase; rossmann fold, ternary 98.69
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 98.68
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 98.67
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 98.65
3ego_A 307 Probable 2-dehydropantoate 2-reductase; structural 98.63
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 98.63
1lss_A140 TRK system potassium uptake protein TRKA homolog; 98.63
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 98.62
3ojo_A 431 CAP5O; rossmann fold, complex with cofactor NAD an 98.6
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 98.59
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 98.58
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 98.55
2duw_A145 Putative COA-binding protein; ligand binding prote 98.49
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 98.48
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 98.46
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 98.45
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 98.43
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 98.34
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 98.33
1hyh_A 309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 98.28
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 98.26
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 98.25
3euw_A 344 MYO-inositol dehydrogenase; protein structure init 98.22
3uuw_A 308 Putative oxidoreductase with NAD(P)-binding rossm 98.21
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 98.2
4hkt_A 331 Inositol 2-dehydrogenase; structural genomics, nys 98.19
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 98.19
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 98.19
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 98.17
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 98.16
3e9m_A 330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 98.15
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 98.15
3q2i_A 354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 98.14
3c85_A183 Putative glutathione-regulated potassium-efflux S 98.11
3ezy_A 344 Dehydrogenase; structural genomics, unknown functi 98.1
2ho3_A 325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 98.1
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 98.09
4fgw_A 391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 98.09
3mz0_A 344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 98.09
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 98.08
2d59_A144 Hypothetical protein PH1109; COA binding, structur 98.06
2glx_A 332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 98.04
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.04
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 98.03
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 98.01
3db2_A 354 Putative NADPH-dependent oxidoreductase; two domai 98.0
3e18_A 359 Oxidoreductase; dehydrogenase, NAD-binding, struct 97.99
1tlt_A 319 Putative oxidoreductase (virulence factor MVIM HO; 97.99
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 97.98
3evn_A 329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.98
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 97.98
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 97.96
1xea_A 323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.96
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 97.95
3ec7_A 357 Putative dehydrogenase; alpha-beta, structural gen 97.94
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 97.94
3cea_A 346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 97.91
3rc1_A 350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 97.91
1iuk_A140 Hypothetical protein TT1466; structural genomics, 97.9
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 97.9
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 97.89
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 97.86
3c1a_A 315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 97.85
3bio_A 304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.83
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 97.82
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 97.81
3ohs_X 334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 97.81
1ydw_A 362 AX110P-like protein; structural genomics, protein 97.77
4had_A 350 Probable oxidoreductase protein; structural genomi 97.76
1f06_A 320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 97.75
2fp4_A305 Succinyl-COA ligase [GDP-forming] alpha-chain, mit 97.75
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, 97.74
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 97.74
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 97.72
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.72
2p2s_A 336 Putative oxidoreductase; YP_050235.1, structural g 97.72
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 97.71
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 97.71
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 97.65
3o9z_A 312 Lipopolysaccaride biosynthesis protein WBPB; oxido 97.63
3moi_A 387 Probable dehydrogenase; structural genomics, PSI2, 97.62
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 97.62
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 97.6
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 97.6
3oa2_A 318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 97.59
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 97.58
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 97.57
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 97.56
1guz_A 310 Malate dehydrogenase; oxidoreductase, tricarboxyli 97.55
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 97.54
4fb5_A 393 Probable oxidoreductase protein; PSI-biology, nysg 97.54
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 97.53
1h6d_A 433 Precursor form of glucose-fructose oxidoreductase; 97.53
3dty_A 398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 97.53
3l07_A285 Bifunctional protein fold; structural genomics, ID 97.53
3p2o_A285 Bifunctional protein fold; structural genomics, ce 97.52
4h3v_A 390 Oxidoreductase domain protein; structural genomics 97.52
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 97.49
2czc_A 334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 97.49
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 97.49
1ldn_A 316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 97.48
3i23_A 349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.47
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 97.44
3m2t_A 359 Probable dehydrogenase; PSI, SGXNY, structural gen 97.43
1nvm_B 312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 97.43
1t2d_A 322 LDH-P, L-lactate dehydrogenase; ternary complex, o 97.42
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 97.41
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 97.4
3v5n_A 417 Oxidoreductase; structural genomics, PSI-biology, 97.38
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 97.37
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.37
4gqa_A 412 NAD binding oxidoreductase; structural genomics, P 97.36
3f4l_A 345 Putative oxidoreductase YHHX; structural genomics, 97.35
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 97.34
3gdo_A 358 Uncharacterized oxidoreductase YVAA; structural ge 97.3
1zh8_A 340 Oxidoreductase; TM0312, structural genomics, JO ce 97.29
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 97.29
3u3x_A 361 Oxidoreductase; structural genomics, PSI-biology, 97.29
3e82_A 364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 97.28
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 97.28
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 97.26
3kux_A 352 Putative oxidoreductase; oxidoreductase family, cs 97.26
3fhl_A 362 Putative oxidoreductase; NAD-binding domain, PSI-2 97.22
1ur5_A 309 Malate dehydrogenase; oxidoreductase, tricarboxyli 97.21
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 97.2
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 97.19
2b0j_A358 5,10-methenyltetrahydromethanopterin hydrogenase; 97.19
1cf2_P 337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 97.18
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrro 97.14
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 97.13
2nvw_A 479 Galactose/lactose metabolism regulatory protein GA 97.13
3oqb_A 383 Oxidoreductase; structural genomics, protein struc 97.12
3ip3_A 337 Oxidoreductase, putative; structural genomics, PSI 97.12
1b7g_O 340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 97.11
3btv_A 438 Galactose/lactose metabolism regulatory protein GA 97.09
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 97.09
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 97.06
3nep_X 314 Malate dehydrogenase; halophIle, molecular adpatat 97.06
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 97.02
2yv1_A294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 96.98
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 96.97
3p7m_A 321 Malate dehydrogenase; putative dehydrogenase, enzy 96.97
3do5_A 327 HOM, homoserine dehydrogenase; NP_069768.1, putati 96.97
4ew6_A 330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 96.96
3pqe_A 326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 96.95
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 96.95
2yv2_A297 Succinyl-COA synthetase alpha chain; COA-binding d 96.95
3gvi_A 324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 96.94
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 96.92
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 96.92
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 96.9
4gmf_A 372 Yersiniabactin biosynthetic protein YBTU; rossmann 96.89
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 96.85
1ez4_A 318 Lactate dehydrogenase; rossmann fold, oxidoreducta 96.83
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 96.83
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 96.82
2zqz_A 326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 96.81
2yyy_A 343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 96.79
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 96.79
3fef_A 450 Putative glucosidase LPLD; gulosidase, structural 96.68
3tl2_A315 Malate dehydrogenase; center for structural genomi 96.68
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 96.68
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 96.62
2ozp_A 345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 96.61
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 96.6
2xxj_A 310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 96.58
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 96.55
1ys4_A 354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 96.54
3dr3_A 337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 96.51
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 96.47
1mld_A 314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 96.46
3upl_A 446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 96.44
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 96.41
1xyg_A 359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 96.38
4b4u_A303 Bifunctional protein fold; oxidoreductase; HET: NA 96.37
4aj2_A 331 L-lactate dehydrogenase A chain; oxidoreductase-in 96.37
3vku_A 326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 96.36
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 96.33
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 96.32
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 96.27
1lnq_A336 MTHK channels, potassium channel related protein; 96.27
4g65_A 461 TRK system potassium uptake protein TRKA; structur 96.21
2dvm_A439 Malic enzyme, 439AA long hypothetical malate oxido 96.17
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 96.16
1j5p_A253 Aspartate dehydrogenase; TM1643, structural genomi 96.08
1obb_A 480 Maltase, alpha-glucosidase; glycosidase, sulfinic 96.07
3eag_A 326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 96.06
2ep5_A 350 350AA long hypothetical aspartate-semialdehyde deh 95.98
2nqt_A 352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 95.97
3ius_A286 Uncharacterized conserved protein; APC63810, silic 95.92
3ing_A 325 Homoserine dehydrogenase; NP_394635.1, structural 95.86
3mtj_A 444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 95.85
1smk_A 326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 95.76
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 95.74
1vkn_A 351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 95.66
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 95.64
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 95.63
1u8f_O 335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 95.57
1duv_G333 Octase-1, ornithine transcarbamoylase; enzyme-inhi 95.55
1pvv_A315 Otcase, ornithine carbamoyltransferase; dodecamer; 95.53
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 95.52
1dxh_A335 Ornithine carbamoyltransferase; transcarbamylase; 95.5
1p3d_A 475 UDP-N-acetylmuramate--alanine ligase; alpha/beta p 95.45
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 95.3
3e5r_O 337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 95.23
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 95.22
1u8x_X 472 Maltose-6'-phosphate glucosidase; structural genom 95.19
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 95.17
1s6y_A 450 6-phospho-beta-glucosidase; hydrolase, structural 95.16
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 95.16
4dpk_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 95.14
4dpl_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 95.14
4hv4_A 494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 95.11
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 95.1
1gtm_A419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 95.09
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 95.07
3c8m_A 331 Homoserine dehydrogenase; structural genomics, APC 95.04
1ebf_A 358 Homoserine dehydrogenase; dinucleotide, NAD, dimer 94.97
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 94.97
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 94.96
3fi9_A 343 Malate dehydrogenase; structural genomics, oxidore 94.91
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 94.9
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 94.89
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 94.89
1b8p_A 329 Protein (malate dehydrogenase); oxidoreductase; 1. 94.87
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 94.85
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 94.85
1t4b_A 367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 94.83
2ejw_A 332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 94.81
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 94.79
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 94.76
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 94.76
4f2g_A309 Otcase 1, ornithine carbamoyltransferase 1; struct 94.75
3hhp_A 312 Malate dehydrogenase; MDH, citric acid cycle, TCA 94.72
3tpf_A307 Otcase, ornithine carbamoyltransferase; structural 94.72
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 94.71
2f00_A 491 UDP-N-acetylmuramate--L-alanine ligase; amide bond 94.71
3q2o_A 389 Phosphoribosylaminoimidazole carboxylase, ATPase; 94.66
2i6u_A307 Otcase, ornithine carbamoyltransferase; X-RAY crys 94.58
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 94.57
1vlv_A325 Otcase, ornithine carbamoyltransferase; TM1097, st 94.55
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 94.54
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 94.48
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 94.46
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 94.44
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 94.4
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 94.37
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 94.3
4gx0_A565 TRKA domain protein; membrane protein, ION channel 94.28
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 94.27
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 94.26
3r7f_A304 Aspartate carbamoyltransferase; aspartate transcar 94.16
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 94.07
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 94.07
2r00_A 336 Aspartate-semialdehyde dehydrogenase; conformation 94.06
3hsk_A 381 Aspartate-semialdehyde dehydrogenase; candida albi 94.05
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 94.05
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 94.04
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 94.0
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 93.99
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 93.97
4ep1_A340 Otcase, ornithine carbamoyltransferase; structural 93.96
2w37_A359 Ornithine carbamoyltransferase, catabolic; transca 93.93
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 93.89
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 93.86
1ml4_A308 Aspartate transcarbamoylase; beta pleated sheet, p 93.84
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 93.83
1oth_A321 Protein (ornithine transcarbamoylase); transferase 93.76
3grf_A328 Ornithine carbamoyltransferase; ornithine transcar 93.71
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 93.71
3orq_A 377 N5-carboxyaminoimidazole ribonucleotide synthetas; 93.68
4amu_A365 Ornithine carbamoyltransferase, catabolic; ornithi 93.64
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 93.62
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 93.53
3cps_A 354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 93.52
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 93.49
2ef0_A301 Ornithine carbamoyltransferase; TTHA1199, thermus 93.45
3gd5_A323 Otcase, ornithine carbamoyltransferase; structural 93.44
3tz6_A 344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 93.43
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 93.41
3d6n_B291 Aspartate carbamoyltransferase; reactor, chamber, 93.41
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 93.4
2ph5_A 480 Homospermidine synthase; alpha-beta protein, struc 93.39
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 93.35
3hn7_A 524 UDP-N-acetylmuramate-L-alanine ligase; ATP-binding 93.31
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 93.31
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 93.23
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 93.22
4ffl_A 363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 93.22
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 93.21
3fbg_A346 Putative arginate lyase; structural genomics, unkn 93.18
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 93.18
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 93.17
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 93.17
2wm3_A299 NMRA-like family domain containing protein 1; unkn 93.17
4h7p_A 345 Malate dehydrogenase; ssgcid, structural G seattle 93.15
2csu_A 457 457AA long hypothetical protein; structural genomi 93.15
2x5j_O 339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 93.1
2hjs_A 340 USG-1 protein homolog; aspartate-semialdehyde dehy 93.05
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 93.05
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 93.02
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 93.01
3sds_A353 Ornithine carbamoyltransferase, mitochondrial; str 92.97
3pwk_A 366 Aspartate-semialdehyde dehydrogenase; NADP binding 92.96
3aog_A440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 92.93
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 92.87
4e4t_A 419 Phosphoribosylaminoimidazole carboxylase, ATPase; 92.86
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 92.76
2yfk_A418 Aspartate/ornithine carbamoyltransferase; transcar 92.74
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 92.74
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 92.71
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 92.68
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 92.62
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 92.59
4g65_A461 TRK system potassium uptake protein TRKA; structur 92.57
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 92.55
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 92.51
4eye_A342 Probable oxidoreductase; structural genomics, niai 92.5
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 92.49
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 92.46
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 92.39
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 92.35
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 92.34
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 92.27
3b1j_A 339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 92.26
3cmc_O 334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 92.25
2x5o_A 439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 92.23
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 92.21
1gad_O 330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 92.14
2h1q_A270 Hypothetical protein; ZP_00559375.1, structural ge 92.11
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 92.1
7mdh_A 375 Protein (malate dehydrogenase); chloroplastic mala 92.08
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 92.08
3aoe_E419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 92.07
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 92.01
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 91.93
4a8t_A339 Putrescine carbamoyltransferase; trabnsferase PALO 91.86
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 91.74
3csu_A310 Protein (aspartate carbamoyltransferase); transfer 91.68
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 91.68
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 91.66
3q98_A399 Transcarbamylase; rossmann fold, transferase; 2.00 91.6
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 91.56
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 91.5
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 91.45
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 91.42
2tmg_A415 Protein (glutamate dehydrogenase); metabolic role, 91.38
3gms_A340 Putative NADPH:quinone reductase; structural genom 91.34
4a8p_A355 Putrescine carbamoyltransferase; ornithine agmatin 91.33
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 91.26
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 91.22
1hdg_O 332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 91.21
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 91.16
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 91.08
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 90.95
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 90.92
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 90.89
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 90.83
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 90.77
2yfq_A421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 90.74
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 90.73
3rui_A 340 Ubiquitin-like modifier-activating enzyme ATG7; au 90.7
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 90.68
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 90.68
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 90.53
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 90.51
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 90.5
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 90.5
1y7t_A 327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 90.4
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 90.3
3edm_A259 Short chain dehydrogenase; structural genomics, ox 90.27
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 90.22
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 90.21
3l5o_A270 Uncharacterized protein from DUF364 family; RARE m 90.1
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 90.05
2d2i_A 380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 90.0
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
Probab=100.00  E-value=1.7e-51  Score=411.83  Aligned_cols=247  Identities=86%  Similarity=1.289  Sum_probs=229.2

Q ss_pred             cccccccccchhhhhhccccchhhHHhhcCCccccccccccCCCCEEEEEcccchHHHHHHHHHhhhhhhcCCcEEEEEe
Q 021218           68 TPFLLDFETSVFKKDMISLADRDEYIVRGGRDLFNLLPDAFNGINQIGVIGWGSQGPAQAQNLRDSLAEAKSDIVVKVGL  147 (316)
Q Consensus        68 ~~~~~~~~~~~~~~~~~~l~~~~e~vv~~G~w~F~~~~~~l~G~kkIGIIG~G~mG~AlA~~Lr~~~~~~g~G~~Vivg~  147 (316)
                      ....++|+|++|.+++++|++..|+||++|+|+|+++++.|+|||||||||+|+||.++|++|+++++++|+|++|++++
T Consensus        11 ~~~~~~~~~~~~~~~~~~~~g~~E~v~~~~~w~~~~~~~~L~GiKkIgIIGlGsMG~AmA~nLr~s~~~~g~G~~ViVg~   90 (525)
T 3fr7_A           11 AMPSLDFDTSVFNKEKVSLAGHEEYIVRGGRNLFPLLPEAFKGIKQIGVIGWGSQGPAQAQNLRDSLAEAKSDIVVKIGL   90 (525)
T ss_dssp             ----CCCCCSSSCEEEEEETTEEEEEEECCGGGGGGHHHHTTTCSEEEEECCTTHHHHHHHHHHHHHHHTTCCCEEEEEE
T ss_pred             cccccccccccceeeEeecCCcceEEEeccccccccChHHhcCCCEEEEEeEhHHHHHHHHHHHhcccccCCCCEEEEEe
Confidence            34679999999999999999999999999999999889999999999999999999999999999988999999999999


Q ss_pred             cCCcccHHHHHHCCceecCCCcCCHHhhhccCCEEEEcccCchHHHHHHHHHhcCCCCcEEEEeCCchhhhhhccccCCC
Q 021218          148 RKGSRSFAEARAAGFTEENGTLGDIYETISGSDLVLLLISDAAQADNYEKIFSCMKPNSILGLSHGFLLGHLQSMGLDFP  227 (316)
Q Consensus       148 r~~~~s~~~A~~~G~~~~~~t~~~~~e~i~~ADIViLavp~~~~~~vi~ei~~~mk~gaiLid~aGv~l~~l~~~~~~~~  227 (316)
                      ++++++.+.+++.|+...+++..++.|++++||+|||++||+.+.+++++++++||+|++|+++||+++.++++.+..+|
T Consensus        91 r~~sks~e~A~e~G~~v~d~ta~s~aEAa~~ADVVILaVP~~~~~eVl~eI~p~LK~GaILs~AaGf~I~~le~~~i~~p  170 (525)
T 3fr7_A           91 RKGSKSFDEARAAGFTEESGTLGDIWETVSGSDLVLLLISDAAQADNYEKIFSHMKPNSILGLSHGFLLGHLQSAGLDFP  170 (525)
T ss_dssp             CTTCSCHHHHHHTTCCTTTTCEEEHHHHHHHCSEEEECSCHHHHHHHHHHHHHHSCTTCEEEESSSHHHHHHHHTTCCCC
T ss_pred             CCchhhHHHHHHCCCEEecCCCCCHHHHHhcCCEEEECCChHHHHHHHHHHHHhcCCCCeEEEeCCCCHHHHhhhcccCC
Confidence            98888899999999974223335889999999999999999999999999999999999999999999998876566788


Q ss_pred             CCccEEEeccCCCchhhHHHHhcCccccCCCceEEEeeccCCCHHHHHHHHHHHHHcCCCCeeecChhHHHhhcchhhhh
Q 021218          228 KNIGVIAVCPKGMGPSVRRLYVQGKEINGAGINSSFAVHQDVDGRATNVALGWSVALGSPFTFATTLEQEYRSDIFGERG  307 (316)
Q Consensus       228 ~~i~vI~vhPn~pg~~~r~lf~~G~e~~G~G~~~iiap~~d~~~~a~e~a~~l~~alG~~~~~~tT~~~e~~~dl~~e~~  307 (316)
                      ++++||++|||+|++.+|++|.+|+++||+|++++|++++|+++++++.+++|+.++|..++++||+++|+++||||||+
T Consensus       171 ~dv~VVrVmPNtPg~~VR~~y~~G~~~~g~Gv~~liAv~qd~tgea~e~alala~aiG~~~vieTtf~eE~e~DLfgeqt  250 (525)
T 3fr7_A          171 KNISVIAVCPKGMGPSVRRLYVQGKEINGAGINSSFAVHQDVDGRATDVALGWSVALGSPFTFATTLEQEYKSDIFGERG  250 (525)
T ss_dssp             TTSEEEEEEESSCHHHHHHHHHHHTTSTTCSCCEEEEEEECSSSCHHHHHHHHHHHTTCSEEEECCHHHHHHHHHHHHHT
T ss_pred             CCCcEEEEecCCCchhHHHHHhcccccccCCccEEEEcCCCCCHHHHHHHHHHHHHCCCCeeeeeeeeeehhHhhhhhHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hccCccc
Q 021218          308 ECFPASI  314 (316)
Q Consensus       308 ~l~g~~~  314 (316)
                      +|||+++
T Consensus       251 vLsG~~p  257 (525)
T 3fr7_A          251 ILLGAVH  257 (525)
T ss_dssp             TTTHHHH
T ss_pred             hhcCcHH
Confidence            9999875
>3ulk_A Ketol-acid reductoisomerase; branched-chain amino acid biosynthesis, rossmann fold, acetolactate, oxidoreductase; HET: CSX NDP; 2.30A {Escherichia coli} PDB: 1yrl_A* Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>2b0j_A 5,10-methenyltetrahydromethanopterin hydrogenase; rossmann fold, helix bundle, oxidoreductase; 1.75A {Methanocaldococcus jannaschii} SCOP: a.100.1.11 c.2.1.6 PDB: 3f47_A* 3daf_A* 3dag_A* 3f46_A* 3h65_A* Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>1duv_G Octase-1, ornithine transcarbamoylase; enzyme-inhibitor complex, transferase; HET: PSQ; 1.70A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1akm_A* 2otc_A* Back     alignment and structure
>1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} SCOP: c.78.1.1 c.78.1.1 PDB: 1a1s_A Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>1dxh_A Ornithine carbamoyltransferase; transcarbamylase; 2.50A {Pseudomonas aeruginosa} SCOP: c.78.1.1 c.78.1.1 PDB: 1ort_A Back     alignment and structure
>1p3d_A UDP-N-acetylmuramate--alanine ligase; alpha/beta protein; HET: UMA ANP; 1.70A {Haemophilus influenzae} SCOP: c.5.1.1 c.59.1.1 c.72.2.1 PDB: 1gqq_A* 1p31_A* 1gqy_A* Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>4f2g_A Otcase 1, ornithine carbamoyltransferase 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>3tpf_A Otcase, ornithine carbamoyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, rossman fold; 2.70A {Campylobacter jejuni subsp} Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>2f00_A UDP-N-acetylmuramate--L-alanine ligase; amide bond ligase, ATPase, bacterial cell WALL; 2.50A {Escherichia coli} Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>2i6u_A Otcase, ornithine carbamoyltransferase; X-RAY crystallography, ornithine carbamyoltransferase, carbamoyl phosphate, L- norvaline; 2.20A {Mycobacterium tuberculosis} PDB: 2p2g_A Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>1vlv_A Otcase, ornithine carbamoyltransferase; TM1097, structural genomics, protein structure initiative, PSI, joint center for structu genomics; 2.25A {Thermotoga maritima} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3r7f_A Aspartate carbamoyltransferase; aspartate transcarbamoylase, carbamoyl phosphate, transferas catalytic cycle; 2.10A {Bacillus subtilis} PDB: 3r7d_A 3r7l_A* 2at2_A Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>4ep1_A Otcase, ornithine carbamoyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 3.25A {Bacillus anthracis} Back     alignment and structure
>2w37_A Ornithine carbamoyltransferase, catabolic; transcarbamylase, metal binding-site, hexamer, cytoplasm, arginine metabolism; 2.10A {Lactobacillus hilgardii} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>1ml4_A Aspartate transcarbamoylase; beta pleated sheet, protein inhibitor complex, transferase; HET: PAL; 1.80A {Pyrococcus abyssi} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>1oth_A Protein (ornithine transcarbamoylase); transferase; HET: PAO; 1.85A {Homo sapiens} SCOP: c.78.1.1 c.78.1.1 PDB: 1ep9_A 1fvo_A 1c9y_A* 1fb5_A Back     alignment and structure
>3grf_A Ornithine carbamoyltransferase; ornithine transcarbamoylase, arginine degradation pathway, giardia lamblia, drug target; 2.00A {Giardia intestinalis} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>4amu_A Ornithine carbamoyltransferase, catabolic; ornithine transcarbamoylase, hydrolase; 2.50A {Mycoplasma penetrans} PDB: 4anf_A Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>2ef0_A Ornithine carbamoyltransferase; TTHA1199, thermus thermophil structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>3gd5_A Otcase, ornithine carbamoyltransferase; structural genomics, NYSGXRC, target 9454P, operon, amino-acid biosynthesis, ARGI biosynthesis; 2.10A {Gloeobacter violaceus} Back     alignment and structure
>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3d6n_B Aspartate carbamoyltransferase; reactor, chamber, pores, internal cavity, hydrolase, metal-B pyrimidine biosynthesis, hydrolase-transferase; HET: FLC; 2.30A {Aquifex aeolicus} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; ATP-binding, nucleotide-binding, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>2csu_A 457AA long hypothetical protein; structural genomics, PH0766, riken ST genomics/proteomics initiative, RSGI, NPPSFA; 2.20A {Pyrococcus horikoshii} SCOP: c.2.1.8 c.23.4.1 c.23.4.1 Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>3sds_A Ornithine carbamoyltransferase, mitochondrial; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.80A {Coccidioides immitis} Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>2yfk_A Aspartate/ornithine carbamoyltransferase; transcarbamylase; 2.55A {Enterococcus faecalis} Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Back     alignment and structure
>2h1q_A Hypothetical protein; ZP_00559375.1, structural genomics, PSI-2, protein structure initiative; 2.01A {Desulfitobacterium hafniense dcb-2} PDB: 3l5o_A Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>4a8t_A Putrescine carbamoyltransferase; trabnsferase PALO, delta-N-(phosphonoacetyl)-L- ornithine, agmatine deiminase route, agmatine catabolism; HET: PAO PGE; 1.59A {Enterococcus faecalis} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3csu_A Protein (aspartate carbamoyltransferase); transferase (carbamoyl-P; 1.88A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1r0b_A* 1q95_A* 1raa_A* 1rab_A* 1rac_A* 1rad_A* 1rae_A* 1raf_A* 1rag_A* 1rah_A* 1rai_A* 1r0c_A* 1za2_A* 1za1_A* 2fzc_A* 2fzg_A* 2fzk_A* 2h3e_A* 2ipo_A* 2qg9_A ... Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>3q98_A Transcarbamylase; rossmann fold, transferase; 2.00A {Escherichia coli} Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>4a8p_A Putrescine carbamoyltransferase; ornithine agmatine deiminase route; HET: PAO; 2.00A {Enterococcus faecalis} PDB: 4a8h_A* 3txx_A Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3l5o_A Uncharacterized protein from DUF364 family; RARE metals, siderophores, adenosyl binding site; 2.01A {Desulfitobacterium hafniense} Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 316
d1qmga2226 c.2.1.6 (A:82-307) Class II ketol-acid reductoisom 3e-96
d1np3a2182 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomer 5e-43
d1bg6a2184 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvalin 0.002
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 226 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: 6-phosphogluconate dehydrogenase-like, N-terminal domain
domain: Class II ketol-acid reductoisomerase (KARI)
species: Spinach (Spinacia oleracea) [TaxId: 3562]

 Score =  281 bits (721), Expect = 3e-96
 Identities = 190/226 (84%), Positives = 210/226 (92%)

Query: 68  TPFLLDFETSVFKKDMISLADRDEYIVRGGRDLFNLLPDAFNGINQIGVIGWGSQGPAQA 127
           +    DF++SVFKK+ ++L+  DEYIVRGGR+LF LLPDAF GI QIGVIGWGSQ PAQA
Sbjct: 1   SATTFDFDSSVFKKEKVTLSGHDEYIVRGGRNLFPLLPDAFKGIKQIGVIGWGSQAPAQA 60

Query: 128 QNLRDSLAEAKSDIVVKVGLRKGSRSFAEARAAGFTEENGTLGDIYETISGSDLVLLLIS 187
           QNL+DSL EAKSD+VVK+GLRKGS SFAEARAAGF+EENGTLGD++ETISGSDLVLLLIS
Sbjct: 61  QNLKDSLTEAKSDVVVKIGLRKGSNSFAEARAAGFSEENGTLGDMWETISGSDLVLLLIS 120

Query: 188 DAAQADNYEKIFSCMKPNSILGLSHGFLLGHLQSMGLDFPKNIGVIAVCPKGMGPSVRRL 247
           D+AQADNYEK+FS MKPNSILGLSHGFLLGHLQS+G DFPKNI VIAVCPKGMGPSVRRL
Sbjct: 121 DSAQADNYEKVFSHMKPNSILGLSHGFLLGHLQSLGQDFPKNISVIAVCPKGMGPSVRRL 180

Query: 248 YVQGKEINGAGINSSFAVHQDVDGRATNVALGWSVALGSPFTFATT 293
           YVQGKE+NGAGINSSFAVHQDVDGRAT+VALGWS+ALGSPFTFATT
Sbjct: 181 YVQGKEVNGAGINSSFAVHQDVDGRATDVALGWSIALGSPFTFATT 226
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Length = 182 Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Length = 184 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query316
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 100.0
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 100.0
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 99.89
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 99.86
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 99.86
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 99.83
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 99.7
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 99.59
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 99.53
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 99.53
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 99.49
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 99.49
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 99.48
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 99.48
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 99.47
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 99.42
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 99.41
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 99.38
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 99.36
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 99.27
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 99.26
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 99.25
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 99.18
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 99.09
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 99.06
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 99.03
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 98.89
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 98.83
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 98.76
d2b0ja2242 5,10-methenyltetrahydromethanopterin hydrogenase, 98.73
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 98.69
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 98.57
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 98.39
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 98.09
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 98.03
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 97.92
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 97.9
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.78
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 97.77
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 97.77
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.66
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.63
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 97.61
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 97.57
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 97.53
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 97.48
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 97.44
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 97.4
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 97.39
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 97.37
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 97.36
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 97.28
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 97.26
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 97.25
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 97.25
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 97.25
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 97.18
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 97.17
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 97.15
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 97.14
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 97.08
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 97.05
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 97.04
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 97.03
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 97.02
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 96.98
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.92
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 96.89
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 96.89
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 96.89
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 96.88
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 96.87
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 96.84
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.74
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 96.72
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 96.71
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 96.68
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 96.67
d1id1a_153 Rck domain from putative potassium channel Kch {Es 96.65
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 96.62
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 96.57
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 96.54
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.53
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 96.51
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 96.51
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 96.5
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 96.49
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 96.47
d1mv8a3136 GDP-mannose 6-dehydrogenase, GDP-binding domain {P 96.45
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 96.28
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.27
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 96.23
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 96.2
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.16
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 96.15
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 96.13
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 96.09
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 96.05
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 96.04
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 96.03
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 96.01
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 95.99
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 95.99
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 95.98
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 95.96
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 95.92
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 95.86
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 95.82
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 95.8
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 95.77
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 95.75
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 95.68
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 95.49
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 95.36
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 95.31
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 95.22
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 95.19
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 95.19
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 95.11
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 95.06
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 94.99
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 94.9
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 94.84
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 94.74
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 94.72
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 94.67
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 94.67
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 94.52
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 94.44
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 94.23
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 94.21
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 94.06
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 94.03
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 93.92
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 93.91
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 93.69
d1pg5a2153 Aspartate carbamoyltransferase catalytic subunit { 93.45
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 93.44
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 93.43
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 93.41
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 93.35
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 93.34
d1vlva2161 Ornithine transcarbamoylase {Thermotoga maritima [ 93.26
d1ml4a2157 Aspartate carbamoyltransferase catalytic subunit { 93.17
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 93.16
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 93.14
d1yovb1 426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 93.08
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 93.05
d1pvva2163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 93.0
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 92.94
d1dxha2185 Ornithine transcarbamoylase {Pseudomonas aeruginos 92.91
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 92.9
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 92.87
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 92.84
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 92.84
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 92.76
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 92.7
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 92.65
d2at2a2151 Aspartate carbamoyltransferase catalytic subunit { 92.47
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 92.45
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 92.39
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 92.22
d1duvg2183 Ornithine transcarbamoylase {Escherichia coli [Tax 92.08
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 92.04
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 92.03
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 91.96
d1otha2170 Ornithine transcarbamoylase {Human (Homo sapiens) 91.88
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 91.87
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 91.79
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 91.78
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 91.78
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 91.78
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 91.73
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 91.66
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 91.64
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 91.61
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 91.61
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 91.6
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 91.58
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 91.49
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 91.47
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 91.45
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 91.25
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 91.24
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 91.14
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 91.12
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 91.05
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 90.97
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 90.86
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 90.84
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 90.79
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 90.41
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 90.21
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 90.13
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 90.06
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 90.05
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 89.98
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 89.97
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 89.87
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 89.6
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 89.52
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 89.49
d2h1qa1251 Hypothetical protein Dhaf_3308 {Desulfitobacterium 89.47
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 89.36
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 89.35
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 89.1
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 88.95
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 88.92
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 88.83
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 88.78
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 88.74
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 88.54
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 88.47
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 88.33
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 88.29
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 88.03
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 88.02
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 87.98
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 87.94
d1ekxa2160 Aspartate carbamoyltransferase catalytic subunit { 87.9
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 87.58
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 87.54
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 87.28
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 87.21
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 86.94
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 86.79
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 86.62
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 86.49
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 86.35
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 86.27
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 86.0
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 85.93
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 85.71
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 85.57
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 85.42
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 85.3
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 85.14
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 84.87
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 84.78
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 84.78
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 84.58
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 84.48
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 84.13
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 84.04
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 83.83
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 83.57
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 83.19
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 82.66
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 82.53
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 82.53
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 82.5
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 82.02
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 82.01
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 81.72
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 81.71
d2nu7a1119 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 81.48
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 81.42
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 81.07
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 80.43
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 80.35
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 80.26
d1euca1130 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 80.2
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: 6-phosphogluconate dehydrogenase-like, N-terminal domain
domain: Class II ketol-acid reductoisomerase (KARI)
species: Spinach (Spinacia oleracea) [TaxId: 3562]

Probab=100.00  E-value=1.8e-48  Score=351.38  Aligned_cols=225  Identities=84%  Similarity=1.314  Sum_probs=209.0

Q ss_pred             ccccccccchhhhhhccccchhhHHhhcCCccccccccccCCCCEEEEEcccchHHHHHHHHHhhhhhhcCCcEEEEEec
Q 021218           69 PFLLDFETSVFKKDMISLADRDEYIVRGGRDLFNLLPDAFNGINQIGVIGWGSQGPAQAQNLRDSLAEAKSDIVVKVGLR  148 (316)
Q Consensus        69 ~~~~~~~~~~~~~~~~~l~~~~e~vv~~G~w~F~~~~~~l~G~kkIGIIG~G~mG~AlA~~Lr~~~~~~g~G~~Vivg~r  148 (316)
                      +.+++||+++|++++++|.+.+|+|+++|||.|++++.+|+|||+|+|||||+||.++|+|||++-.+.++|.+|+++.|
T Consensus         2 ~~~~~f~~~~~~~~~~~~~~~~e~i~~~~r~~f~~~~~~~kg~KkIaViGYGsQG~AhAlNLrDSG~~~~sgv~V~VGLr   81 (226)
T d1qmga2           2 ATTFDFDSSVFKKEKVTLSGHDEYIVRGGRNLFPLLPDAFKGIKQIGVIGWGSQAPAQAQNLKDSLTEAKSDVVVKIGLR   81 (226)
T ss_dssp             CSCCCCCCSSSCCEEEEETTEEEEEEECCGGGGGGHHHHTTTCSEEEEECCSSHHHHHHHHHHHHHHHTTCCCEEEEEEC
T ss_pred             CccccchheeeEEEEEeeCCceeEEEecccchhhhhHHHhcCCCEEEEEEeccHHHHHHHhChhhcccccCCceEEEEeC
Confidence            56799999999999999999999999999999999999999999999999999999999999997333334678999999


Q ss_pred             CCcccHHHHHHCCceecCCCcCCHHhhhccCCEEEEcccCchHHHHHHHHHhcCCCCcEEEEeCCchhhhhhccccCCCC
Q 021218          149 KGSRSFAEARAAGFTEENGTLGDIYETISGSDLVLLLISDAAQADNYEKIFSCMKPNSILGLSHGFLLGHLQSMGLDFPK  228 (316)
Q Consensus       149 ~~~~s~~~A~~~G~~~~~~t~~~~~e~i~~ADIViLavp~~~~~~vi~ei~~~mk~gaiLid~aGv~l~~l~~~~~~~~~  228 (316)
                      ++++++++|++.|+...+.++.+.+|++++||+|++++||..+.++++++.++||+|++|..+|||++.+.+..+..+|+
T Consensus        82 ~gs~S~~kA~~dGf~v~~~~v~~v~EAv~~ADiVmiLlPDe~Q~~vy~~I~p~Lk~G~~L~FaHGFnI~~~~~~~~~~p~  161 (226)
T d1qmga2          82 KGSNSFAEARAAGFSEENGTLGDMWETISGSDLVLLLISDSAQADNYEKVFSHMKPNSILGLSHGFLLGHLQSLGQDFPK  161 (226)
T ss_dssp             TTCSCHHHHHHTTCCGGGTCEEEHHHHHHTCSEEEECSCHHHHHHHHHHHHHHSCTTCEEEESSSHHHHHHHHHTCCCCT
T ss_pred             CCChhHHHHHHcCCccCCCcccCHHHHHhhCCEEEEecchHHHHHHHHHHHHhcCCCceeeecchhhhhhceeeecccCC
Confidence            99999999999999754445567899999999999999999999999999999999999999999999877654456789


Q ss_pred             CccEEEeccCCCchhhHHHHhcCccccCCCceEEEeeccCCCHHHHHHHHHHHHHcCCCCeeecC
Q 021218          229 NIGVIAVCPKGMGPSVRRLYVQGKEINGAGINSSFAVHQDVDGRATNVALGWSVALGSPFTFATT  293 (316)
Q Consensus       229 ~i~vI~vhPn~pg~~~r~lf~~G~e~~G~G~~~iiap~~d~~~~a~e~a~~l~~alG~~~~~~tT  293 (316)
                      +++|+++.|++||+.+|++|++|+.++|.|+||+|+++||.++++++++++|+.++|+.++++||
T Consensus       162 dvdVimVAPKgPGh~VR~~Y~~Gk~~~G~GVP~LiAV~QD~sG~A~~~alayA~aIG~g~~~eTt  226 (226)
T d1qmga2         162 NISVIAVCPKGMGPSVRRLYVQGKEVNGAGINSSFAVHQDVDGRATDVALGWSIALGSPFTFATT  226 (226)
T ss_dssp             TSEEEEEEESSCHHHHHHHHHHHTTTTCCCCCEEEEEEECSSSCHHHHHHHHHHHHTCSEEEECC
T ss_pred             CceEEEECCCCCCchHHHHHHcccccCCCCceeEEEEEECCCCcHHHHHHHHHHhCCCCceeecC
Confidence            99999999999999999999999999999999999999999999999999999999999999998
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mv8a3 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1pg5a2 c.78.1.1 (A:147-299) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ml4a2 c.78.1.1 (A:152-308) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1dxha2 c.78.1.1 (A:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2at2a2 c.78.1.1 (A:145-295) Aspartate carbamoyltransferase catalytic subunit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1duvg2 c.78.1.1 (G:151-333) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1otha2 c.78.1.1 (A:185-354) Ornithine transcarbamoylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2h1qa1 c.67.3.1 (A:1-251) Hypothetical protein Dhaf_3308 {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ekxa2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nu7a1 c.2.1.8 (A:2-120) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1euca1 c.2.1.8 (A:1-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure