Citrus Sinensis ID: 021263

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-----

MKFGETFTEYLHGDQERFLDKCSHVEYKRLKKVLKSCRTCKGLHDSACKTEQQWDEGKDISESQLCQCQSSCQLCDHMFFSELMKEASDIAGCFSSRARHLLHLHVASGMQRYVLRIRQCFKNDQTAMIEEGRVLIEYIIMNAIAIRKILKKYDKVHKSVNGKNFKSKMRAEHIELLQSPWLIELGGFYLNFNGLNCGASSEFSGHFSFDFNASRPVMTLALPSSIKLEYDLTCAVCLDLVFNPYALSCGHLFCKLCACSAASVMVFEGLKSASPDSKCPICREIIHISSIGAGWQLGCKETWQEYMRKQSTCLN

ccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHccHHHHHHHHHHHccccc

ccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccccccHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccccccccccccccccccccccEEEcccccccccccccHHHHHHccccEEcccccHccHHHHHHHHcccHHHcccccccccccccHHHHccHHcHHHHHHHHcHHHHHHHHHHHHHHcc

MKFGETFTEYLHGdqerfldkcSHVEYKRLKKVLKSCrtckglhdsackteqqwdegkdisesqlcqcqsscqlcdHMFFSELMKEASDIAGCFSSRARHLLHLHVASGMQRYVLRIRQCFKNDQTAMIEEGRVLIEYIIMNAIAIRKILKKYDKVhksvngknfkSKMRAEHIELlqspwlielggfylnfnglncgassefsghfsfdfnasrpvmtlalpssikleydlTCAVCLdlvfnpyalscghlfCKLCACSAASVMVFEglksaspdskcpicreiihissigagwqlGCKETWQEYMRKQSTCLN

MKFGETFteylhgdqerfldkCSHVEYKRLKKVLKSCRTCKGLHDSACKTEQQWDEGKDISESQLCQCQSSCQLCDHMFFSELMKEASDIAGCFSSRARHLLHLHVASGMQRYVLRIRQCFKNDQTAMIEEGRVLIEYIIMNAIAIRKILKKYDKVHKSVNGKNFKSKMRAEHIELLQSPWLIELGGFYLNFNGLNCGASSEFSGHFSFDFNASRPVMTLALPSSIKLEYDLTCAVCLDLVFNPYALSCGHLFCKLCACSAASVMVFEGLKSASPDSKCPICREIIHISSIGAGWQLGCKETWQEYMrkqstcln

MKFGETFTEYLHGDQERFLDKCSHVEYKRLKKVLKSCRTCKGLHDSACKTEQQWDEGKDIsesqlcqcqsscqlcDHMFFSELMKEASDIAGCFSSRARHLLHLHVASGMQRYVLRIRQCFKNDQTAMIEEGRVLIEYIIMNAIAIRKILKKYDKVHKSVNGKNFKSKMRAEHIELLQSPWLIELGGFYLNFNGLNCGASSEFSGHFSFDFNASRPVMTLALPSSIKLEYDLTCAVCLDLVFNPYALSCGHLFCKLCACSAASVMVFEGLKSASPDSKCPICREIIHISSIGAGWQLGCKETWQEYMRKQSTCLN

******FTEYLHGDQERFLDKCSHVEYKRLKKVLKSCRTCKGLHD**********************CQSSCQLCDHMFFSELMKEASDIAGCFSSRARHLLHLHVASGMQRYVLRIRQCFKNDQTAMIEEGRVLIEYIIMNAIAIRKILKKYDKVHKSVNGKNFKSKMRAEHIELLQSPWLIELGGFYLNFNGLNCGASSEFSGHFSFDFNASRPVMTLALPSSIKLEYDLTCAVCLDLVFNPYALSCGHLFCKLCACSAASVMVFEGLKSASPDSKCPICREIIHISSIGAGWQLGCKETWQEYM********

***GETFTEYLHGDQERFLDKCSHVEYKRLKKVLKSCR***************************CQCQSSCQLCDHMFFSELMKEASDIAGCFSSRARHLLHLHVASGMQRYVLRIRQCFKNDQTAMIEEGRVLIEYIIMNAIAIRKILKKY***********F*SKMRAEHIELLQSPWLIELGGFYLN************************************LEYDLTCAVCLDLVFNPYALSCGHLFCKLCACSAASV***********DSKCPICREIIHISSIGAGWQLGCKETWQ****K******

*KFGETFTEYLHGDQERFLDKCSHVEYKRLKKVLKSCRT*************************LCQCQSSCQLCDHMFFSELMKEASDIAGCFSSRARHLLHLHVASGMQRYVLRIRQCFKNDQTAMIEEGRVLIEYIIMNAIAIRKILKKYDKVHKSVNGKNFKSKMRAEHIELLQSPWLIELGGFYLNFNGL********SGHFSFDFNASRPVMTLALPSSIKLEYDLTCAVCLDLVFNPYALSCGHLFCKLCACSAASVMVFEGLKSASPDSKCPICREIIHISSIGAGWQLGCKETWQEYMRKQS*C**

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		315	2.2.26 [Sep-21-2011]
Q7XZZ3		339	Probable E3 ubiquitin-pro	yes	no	0.971	0.902	0.545	8e-99
A2XK56		339	Probable E3 ubiquitin-pro	N/A	no	0.971	0.902	0.545	8e-99
Q8GW10		335	Probable E3 ubiquitin-pro	yes	no	0.958	0.901	0.566	3e-94
Q9SRX9		335	E3 ubiquitin-protein liga	no	no	0.939	0.883	0.379	4e-59
B8B5U8		321	Probable E3 ubiquitin-pro	N/A	no	0.822	0.806	0.409	1e-56
Q7XI73		321	Probable E3 ubiquitin-pro	no	no	0.822	0.806	0.409	2e-56
Q58DK8		460	Tripartite motif-containi	no	no	0.222	0.152	0.358	6e-06
Q7YR34		539	Tripartite motif-containi	yes	no	0.2	0.116	0.295	1e-05
Q12899		539	Tripartite motif-containi	yes	no	0.2	0.116	0.295	1e-05
O77666		545	Tripartite motif-containi	yes	no	0.2	0.115	0.309	2e-05

>sp\|Q7XZZ3\|BAHL1_ORYSJ Probable E3 ubiquitin-protein ligase BAH1-like 1 OS=Oryza sativa subsp. japonica GN=Os03g0650900 PE=2 SV=1	Back alignment and function desciption

 Score =  360 bits (924), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 175/321 (54%), Positives = 234/321 (72%), Gaps = 15/321 (4%)

Query: 1   MKFGETFTEYLHGDQERFLDKCSHVEYKRLKKVLKSCRTCKGLHDSACKTEQQWDEGKDI 60
           MKFG  + EYL   Q+++L KCSHVEYKRLKKVLK CR  + L +     +QQ  EG + 
Sbjct: 1   MKFGAIYEEYLREQQDKYLTKCSHVEYKRLKKVLKKCRVGRSLQEDCPNGDQQ--EGNNE 58

Query: 61  SESQLCQCQSSCQLCDHMFFSELMKEASDIAGCFSSRARHLLHLHVASGMQRYVLRIRQC 120
           S   +C+C +SC LCD MFF+EL KEAS+IAGCFSSR + LL+LHV SG  RY+ R+RQC
Sbjct: 59  S-PDICKC-NSCTLCDQMFFTELTKEASEIAGCFSSRVQRLLNLHVPSGFLRYIWRVRQC 116

Query: 121 FKNDQTAMIEEGRVLIEYIIMNAIAIRKILKKYDKVHKSVNGKNFKSKMRAEHIELLQSP 180
           F +DQ  M++EGR+L+ Y+ MNAIAIRKILKKYDK+H SV+G++FKSKM+ +HIELLQSP
Sbjct: 117 FIDDQQIMVQEGRMLLNYVTMNAIAIRKILKKYDKIHGSVSGRDFKSKMQTDHIELLQSP 176

Query: 181 WLIELGGFYLNFNGLNCGAS-----SEFSGHFSFDFNASRPVMTLALPSSIKLEYDLTCA 235
           WLIELG F+LN N  +   +     +EF  +FS D   +RP+MT+A+  ++K EY LTC 
Sbjct: 177 WLIELGAFHLNCNSSDIDETVGFLKNEFFKNFSCDLTEARPLMTMAISETMKYEYSLTCP 236

Query: 236 VCLDLVFNPYALSCGHLFCKLCACSAASVMVFEGLKSASPDSKCPICRE------IIHIS 289
           +CLD +FNPYALSCGHLFCK CAC AASV +F+G+KSA P++KCP+CR        +H++
Sbjct: 237 ICLDTLFNPYALSCGHLFCKGCACGAASVYIFQGVKSAPPEAKCPVCRSDGVFAHAVHMT 296

Query: 290 SIGAGWQLGCKETWQEYMRKQ 310
            +    +   K+ W++ +R++
Sbjct: 297 ELDLLIKTRSKDYWRQRLREE 317

Oryza sativa subsp. japonica (taxid: 39947)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -

>sp\|A2XK56\|BAHL1_ORYSI Probable E3 ubiquitin-protein ligase BAH1-like 1 OS=Oryza sativa subsp. indica GN=OsI_12825 PE=3 SV=1	Back alignment and function description

>sp\|Q8GW10\|BAH1L_ARATH Probable E3 ubiquitin-protein ligase BAH1-like OS=Arabidopsis thaliana GN=RF178 PE=2 SV=1	Back alignment and function description

>sp\|Q9SRX9\|BAH1_ARATH E3 ubiquitin-protein ligase BAH1 OS=Arabidopsis thaliana GN=BAH1 PE=1 SV=1	Back alignment and function description

>sp\|B8B5U8\|BAHL2_ORYSI Probable E3 ubiquitin-protein ligase BAH1-like 1 OS=Oryza sativa subsp. indica GN=OsI_27296 PE=3 SV=1	Back alignment and function description

>sp\|Q7XI73\|BAHL2_ORYSJ Probable E3 ubiquitin-protein ligase BAH1-like 2 OS=Oryza sativa subsp. japonica GN=Os07g0673200 PE=2 SV=1	Back alignment and function description

>sp\|Q58DK8\|TRI38_BOVIN Tripartite motif-containing protein 38 OS=Bos taurus GN=TRIM38 PE=2 SV=1	Back alignment and function description

>sp\|Q7YR34\|TRI26_PANTR Tripartite motif-containing protein 26 OS=Pan troglodytes GN=TRIM26 PE=3 SV=1	Back alignment and function description

>sp\|Q12899\|TRI26_HUMAN Tripartite motif-containing protein 26 OS=Homo sapiens GN=TRIM26 PE=2 SV=1	Back alignment and function description

>sp\|O77666\|TRI26_PIG Tripartite motif-containing protein 26 OS=Sus scrofa GN=TRIM26 PE=3 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		315
224138198		338	predicted protein [Populus trichocarpa]	0.968	0.902	0.685	1e-119
224091495		339	predicted protein [Populus trichocarpa]	0.968	0.899	0.664	1e-116
296089321		332	unnamed protein product [Vitis vinifera]	0.955	0.906	0.648	1e-111
225439313		330	PREDICTED: probable E3 ubiquitin-protein	0.955	0.912	0.655	1e-110
449516155		321	PREDICTED: probable E3 ubiquitin-protein	0.926	0.909	0.634	1e-108
449437524		321	PREDICTED: probable E3 ubiquitin-protein	0.917	0.900	0.633	1e-107
255566249		272	ubiquitin-protein ligase, putative [Rici	0.8	0.926	0.665	1e-106
356572680		324	PREDICTED: probable E3 ubiquitin-protein	0.923	0.898	0.608	1e-104
147772057		317	hypothetical protein VITISV_041194 [Viti	0.888	0.883	0.612	1e-103
357119993		340	PREDICTED: probable E3 ubiquitin-protein	0.980	0.908	0.547	6e-98

>gi\|224138198\|ref\|XP_002322754.1\| predicted protein [Populus trichocarpa] gi\|222867384\|gb\|EEF04515.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  432 bits (1112), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 216/315 (68%), Positives = 251/315 (79%), Gaps = 10/315 (3%)

Query: 1   MKFGETFTEYLHGDQERFLDKCSHVEYKRLKKVLKSCRTCKGLHDSACKTEQ--QWDEGK 58
           MKFGETF EYLHG+QE  LDKC+HVEYKRLKKVLK CR+ +G   ++C  EQ  + D  +
Sbjct: 1   MKFGETFMEYLHGEQEGCLDKCAHVEYKRLKKVLKKCRS-QGPPSTSCNDEQLQERDSEQ 59

Query: 59  DISESQLCQCQSSCQLCDHMFFSELMKEASDIAGCFSSRARHLLHLHVASGMQRYVLRIR 118
           + S SQ C CQS C LCD MFFSELM+EASDIAGCFSSR RHLLHLHVA GMQRY LR+R
Sbjct: 60  NHSLSQFCHCQS-CPLCDQMFFSELMREASDIAGCFSSRVRHLLHLHVARGMQRYKLRLR 118

Query: 119 QCFKNDQTAMIEEGRVLIEYIIMNAIAIRKILKKYDKVHKSVNGKNFKSKMRAEHIELLQ 178
           QCF NDQ  M+EEGR+LIEY+ MNAIAIRKILKKYDKVH S+NGKNFKSKMR+EHIELLQ
Sbjct: 119 QCFINDQQIMVEEGRMLIEYVTMNAIAIRKILKKYDKVHCSINGKNFKSKMRSEHIELLQ 178

Query: 179 SPWLIELGGFYLNFNGLNCGASSEFSGHFSFDFNASRPVMTLALPSSIKLEYDLTCAVCL 238
           SPWLIELG FYLNF+G++ G  SEF   FS D +A+ PVMTL LP+  KLEY LTCA+CL
Sbjct: 179 SPWLIELGAFYLNFDGIDGGEFSEFCSRFSCDLSATEPVMTLMLPNYTKLEYGLTCAICL 238

Query: 239 DLVFNPYALSCGHLFCKLCACSAASVMVFEGLKSASPDSKCPICRE------IIHISSIG 292
           ++VFNPYALSCGHLFCKLCAC AASV++ EGLKSAS ++KCP+CRE       +H+  + 
Sbjct: 239 EMVFNPYALSCGHLFCKLCACLAASVLMVEGLKSASSNAKCPVCREAGVYTNAVHMLELD 298

Query: 293 AGWQLGCKETWQEYM 307
              +  CKE W+E M
Sbjct: 299 LLVKRRCKEHWKERM 313

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224091495\|ref\|XP_002309274.1\| predicted protein [Populus trichocarpa] gi\|222855250\|gb\|EEE92797.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|296089321\|emb\|CBI39093.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225439313\|ref\|XP_002268495.1\| PREDICTED: probable E3 ubiquitin-protein ligase BAH1-like 1-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|449516155\|ref\|XP_004165113.1\| PREDICTED: probable E3 ubiquitin-protein ligase BAH1-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449437524\|ref\|XP_004136542.1\| PREDICTED: probable E3 ubiquitin-protein ligase BAH1-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|255566249\|ref\|XP_002524112.1\| ubiquitin-protein ligase, putative [Ricinus communis] gi\|223536680\|gb\|EEF38322.1\| ubiquitin-protein ligase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|356572680\|ref\|XP_003554494.1\| PREDICTED: probable E3 ubiquitin-protein ligase BAH1-like [Glycine max]	Back alignment and taxonomy information

>gi\|147772057\|emb\|CAN73420.1\| hypothetical protein VITISV_041194 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|357119993\|ref\|XP_003561716.1\| PREDICTED: probable E3 ubiquitin-protein ligase BAH1-like 1-like [Brachypodium distachyon]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		315
TAIR\|locus:2064935		335	AT2G38920 [Arabidopsis thalian	0.952	0.895	0.566	3.5e-91
TAIR\|locus:2024675		335	NLA "nitrogen limitation adapt	0.730	0.686	0.412	6.9e-57
UNIPROTKB\|A2AE50		122	TRIM26 "Tripartite motif-conta	0.196	0.508	0.328	7.5e-07
UNIPROTKB\|A2AE51		159	TRIM26 "Tripartite motif-conta	0.196	0.389	0.328	7.5e-07
UNIPROTKB\|Q5SPU2		157	TRIM26 "Tripartite motif-conta	0.196	0.394	0.328	7.5e-07
UNIPROTKB\|C9JWN8		72	TRIM5 "Tripartite motif-contai	0.165	0.722	0.338	3.4e-06
UNIPROTKB\|A2AAZ5		144	TRIM39 "E3 ubiquitin-protein l	0.2	0.437	0.338	9.5e-06
TAIR\|locus:2128746		249	RMA1 "RING membrane-anchor 1"	0.285	0.361	0.296	9.9e-06
UNIPROTKB\|E1BM69		497	LOC516599 "Uncharacterized pro	0.234	0.148	0.307	1.1e-05
UNIPROTKB\|E1BSU9		274	LOC416147 "Uncharacterized pro	0.174	0.200	0.416	1.3e-05

TAIR\|locus:2064935 AT2G38920 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 909 (325.0 bits), Expect = 3.5e-91, P = 3.5e-91
 Identities = 183/323 (56%), Positives = 229/323 (70%)

Query:     1 MKFGETFTEYLHGDQERFLDKCSHVEYKRLKKVLKSCRTCKGLHDSACKTEQQWDEGKDI 60
             MKFGETFTEYLHG++E FL+KC  VEYK+LKKVLK C+TC     ++ K+    D+G+ I
Sbjct:     1 MKFGETFTEYLHGEEEWFLEKCRFVEYKKLKKVLKKCKTC-----NSTKS----DDGQII 51

Query:    61 XXXXXXXXXXXXXXX-----DHMFFSELMKEASDIAGCFSSRARHLLHLHVASGMQRYVL 115
                                 D MFF ELMKEA+DIAG F SR RHLLHLHVA+GMQRY++
Sbjct:    52 PSATSSSLSDSCECKACPWCDQMFFEELMKEATDIAGFFRSRVRHLLHLHVATGMQRYMI 111

Query:   116 RIRQCFKNDQTAMIEEGRVLIEYIIMNAIAIRKILKKYDKVHKSVNGKNFKSKMRAEHIE 175
             R+R+CF +++ A+++EG++LI+YI MNAIAIRKILKKYDKVH S NGKNFK KMRAE IE
Sbjct:   112 RLRRCFTDEKQALVQEGQILIQYITMNAIAIRKILKKYDKVHSSENGKNFKLKMRAERIE 171

Query:   176 LLQSPWLIELGGFYLNFNGL-NCGASSEFSGHFSFD-FNASRPVMTLALPSSIKLEYDLT 233
             LL SPWLIELG FYLN +GL N G      G  + +  N  +PV+ L LP+SI+LEYDLT
Sbjct:   172 LLHSPWLIELGAFYLN-SGLDNVGNFKNSFGRVACENLNEDQPVLKLMLPNSIELEYDLT 230

Query:   234 CAVCLDLVFNPYALSCGHLFCKLCACSAASVMVFEGLKSASPDSKCPICREI------IH 287
             CA+CL+ VFNPYAL CGH+FC  CACSAASV++F+G+K+A   SKCPICRE       +H
Sbjct:   231 CAICLETVFNPYALKCGHIFCNSCACSAASVLIFQGIKAAPRHSKCPICREAGVYAEAVH 290

Query:   288 ISSIGAGWQLGCKETWQEYMRKQ 310
             +  +    +   KE W+E M  +
Sbjct:   291 MIELHLLLKTRSKEYWKERMMNE 313

GO:0005634 "nucleus" evidence=ISM

GO:0008270 "zinc ion binding" evidence=IEA

GO:0006817 "phosphate ion transport" evidence=RCA

GO:0009062 "fatty acid catabolic process" evidence=RCA

GO:0016036 "cellular response to phosphate starvation" evidence=RCA

TAIR\|locus:2024675 NLA "nitrogen limitation adaptation" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|A2AE50 TRIM26 "Tripartite motif-containing protein 26" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|A2AE51 TRIM26 "Tripartite motif-containing protein 26" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5SPU2 TRIM26 "Tripartite motif-containing protein 26" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|C9JWN8 TRIM5 "Tripartite motif-containing protein 5" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|A2AAZ5 TRIM39 "E3 ubiquitin-protein ligase TRIM39" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

TAIR\|locus:2128746 RMA1 "RING membrane-anchor 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BM69 LOC516599 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BSU9 LOC416147 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
A2XK56	BAHL1_ORYSI	6, ., 3, ., 2, ., -	0.5451	0.9714	0.9026	N/A	no
Q7XZZ3	BAHL1_ORYSJ	6, ., 3, ., 2, ., -	0.5451	0.9714	0.9026	yes	no
Q8GW10	BAH1L_ARATH	6, ., 3, ., 2, ., -	0.5661	0.9587	0.9014	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	6.3.2	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		315
pfam03105		176	pfam03105, SPX, SPX domain	2e-22
TIGR00599		397	TIGR00599, rad18, DNA repair protein rad18	1e-05
pfam13923		45	pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI	2e-04
COG5574		271	COG5574, PEX10, RING-finger-containing E3 ubiquiti	5e-04
cd00162		45	cd00162, RING, RING-finger (Really Interesting New	7e-04
PLN03208		193	PLN03208, PLN03208, E3 ubiquitin-protein ligase RM	0.001

>gnl\|CDD\|217372 pfam03105, SPX, SPX domain	Back alignment and domain information

 Score = 91.3 bits (227), Expect = 2e-22
 Identities = 43/191 (22%), Positives = 67/191 (35%), Gaps = 36/191 (18%)

Query: 1   MKFGETFTEYLHGD-QERFLDKCSHVEYKRLKKVLKSCRTCKGLHDSACKTEQQWDEGKD 59
           MKFG++    L  + +++++D      YK LKK++K     K                  
Sbjct: 1   MKFGKSLERNLVPEWRDKYID------YKALKKLIKELTRAK---------LSLTTNEDG 45

Query: 60  ISESQLCQCQSSCQLCDHMFFSELMKEASDIAGCFSSRARHLLHLHVASGMQRYVLRIRQ 119
             ES     +   +  +  FF  L KE   +   +  +   LL        Q   L  R+
Sbjct: 46  EDESSNLLNEEELEEDESEFFEALDKELEKVNSFYKEKEAELLERLEELEKQLEELEERR 105

Query: 120 --------------------CFKNDQTAMIEEGRVLIEYIIMNAIAIRKILKKYDKVHKS 159
                                 K     +  E ++L  YI +N    RKILKKYDK+  S
Sbjct: 106 DETSSAKSSPSDKNLLKAFEELKKALLELYRELQLLKSYIELNRTGFRKILKKYDKITGS 165

Query: 160 VNGKNFKSKMR 170
              K +  K+ 
Sbjct: 166 SLSKKYLEKVV 176

We have named this region the SPX domain after (SYG1, Pho81 and XPR1). This 180 residue length domain is found at the amino terminus of a variety of proteins. In the yeast protein SYG1, the N-terminus directly binds to the G- protein beta subunit and inhibits transduction of the mating pheromone signal. This finding suggests that all the members of this family are involved in G-protein associated signal transduction. The N-termini of several proteins involved in the regulation of phosphate transport, including the putative phosphate level sensors PHO81 from Saccharomyces cerevisiae and NUC-2 from Neurospora crassa, are also members of this family. The SPX domain of S. cerevisiae low-affinity phosphate transporters Pho87 and Pho90 auto-regulates uptake and prevents efflux. This SPX dependent inhibition is mediated by the physical interaction with Spl2 NUC-2 contains several ankyrin repeats pfam00023. Several members of this family are annotated as XPR1 proteins: the xenotropic and polytropic retrovirus receptor confers susceptibility to infection with murine leukaemia viruses (MLV). The similarity between SYG1, phosphate regulators and XPR1 sequences has been previously noted, as has the additional similarity to several predicted proteins, of unknown function, from Drosophila melanogaster, Arabidopsis thaliana, Caenorhabditis elegans, Schizosaccharomyces pombe, and Saccharomyces cerevisiae. In addition, given the similarities between XPR1 and SYG1 and phosphate regulatory proteins, it has been proposed that XPR1 might be involved in G-protein associated signal transduction and may itself function as a phosphate sensor. Length = 176

>gnl\|CDD\|233043 TIGR00599, rad18, DNA repair protein rad18	Back alignment and domain information

>gnl\|CDD\|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger)	Back alignment and domain information

>gnl\|CDD\|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

>gnl\|CDD\|178747 PLN03208, PLN03208, E3 ubiquitin-protein ligase RMA2; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		315
KOG1161		310	consensus Protein involved in vacuolar polyphospha	99.95
PF03105		275	SPX: SPX domain; InterPro: IPR004331 The SPX domai	99.92
KOG1162		617	consensus Predicted small molecule transporter [In	99.86
COG5036		509	SPX domain-containing protein involved in vacuolar	99.83
TIGR00599		397	rad18 DNA repair protein rad18. This family is bas	99.42
COG5408		296	SPX domain-containing protein [Signal transduction	99.38
PF15227		42	zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB:	99.37
smart00504		63	Ubox Modified RING finger domain. Modified RING fi	99.28
KOG0287		442	consensus Postreplication repair protein RAD18 [Re	99.26
PF04564		73	U-box: U-box domain; InterPro: IPR003613 Quality c	99.26
PLN03208		193	E3 ubiquitin-protein ligase RMA2; Provisional	99.17
PF14835		65	zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM	99.07
KOG0317		293	consensus Predicted E3 ubiquitin ligase, integral	99.04
KOG0823		230	consensus Predicted E3 ubiquitin ligase [Posttrans	99.02
COG5432		391	RAD18 RING-finger-containing E3 ubiquitin ligase [	99.01
PF13923		39	zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger);	99.0
PF13920		50	zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger);	98.94
PHA02929		238	N1R/p28-like protein; Provisional	98.87
PF13639		44	zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C	98.85
KOG0320		187	consensus Predicted E3 ubiquitin ligase [Posttrans	98.83
PF00097		41	zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I	98.82
PF13445		43	zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A.	98.78
KOG2164		513	consensus Predicted E3 ubiquitin ligase [Posttrans	98.69
cd00162		45	RING RING-finger (Really Interesting New Gene) dom	98.68
KOG2177		386	consensus Predicted E3 ubiquitin ligase [Posttrans	98.67
PHA02926		242	zinc finger-like protein; Provisional	98.67
COG5574		271	PEX10 RING-finger-containing E3 ubiquitin ligase [	98.63
PF14634		44	zf-RING_5: zinc-RING finger domain	98.56
smart00184		39	RING Ring finger. E3 ubiquitin-protein ligase acti	98.53
KOG0311		381	consensus Predicted E3 ubiquitin ligase [Posttrans	98.43
TIGR00570		309	cdk7 CDK-activating kinase assembly factor MAT1. A	98.28
KOG4159		398	consensus Predicted E3 ubiquitin ligase [Posttrans	98.27
KOG2660		331	consensus Locus-specific chromosome binding protei	98.23
PF12678		73	zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766	98.17
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	98.17
COG5243		491	HRD1 HRD ubiquitin ligase complex, ER membrane com	98.04
KOG0802		543	consensus E3 ubiquitin ligase [Posttranslational m	97.96
KOG4628		348	consensus Predicted E3 ubiquitin ligase [Posttrans	97.94
COG5540		374	RING-finger-containing ubiquitin ligase [Posttrans	97.92
COG5152		259	Uncharacterized conserved protein, contains RING a	97.86
KOG0824		324	consensus Predicted E3 ubiquitin ligase [Posttrans	97.81
KOG0297		391	consensus TNF receptor-associated factor [Signal t	97.78
KOG4172		62	consensus Predicted E3 ubiquitin ligase [Posttrans	97.77
COG5222		427	Uncharacterized conserved protein, contains RING Z	97.77
PF11789		57	zf-Nse: Zinc-finger of the MIZ type in Nse subunit	97.76
KOG2879		298	consensus Predicted E3 ubiquitin ligase [Posttrans	97.75
PF12861		85	zf-Apc11: Anaphase-promoting complex subunit 11 RI	97.65
KOG1813		313	consensus Predicted E3 ubiquitin ligase [Posttrans	97.46
KOG1002		791	consensus Nucleotide excision repair protein RAD16	97.33
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	97.3
KOG4265		349	consensus Predicted E3 ubiquitin ligase [Posttrans	97.12
PF11793		70	FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A.	96.98
KOG4367		699	consensus Predicted Zn-finger protein [Function un	96.88
KOG1039		344	consensus Predicted E3 ubiquitin ligase [Posttrans	96.79
KOG1785		563	consensus Tyrosine kinase negative regulator CBL [	96.67
KOG4275		350	consensus Predicted E3 ubiquitin ligase [Posttrans	96.63
PF14447		55	Prok-RING_4: Prokaryotic RING finger family 4	96.46
KOG0827		465	consensus Predicted E3 ubiquitin ligase [Posttrans	96.45
KOG0828		636	consensus Predicted E3 ubiquitin ligase [Posttrans	96.34
KOG1571		355	consensus Predicted E3 ubiquitin ligase [Posttrans	96.28
COG5219		1525	Uncharacterized conserved protein, contains RING Z	96.12
KOG0825		1134	consensus PHD Zn-finger protein [General function	96.1
KOG3002		299	consensus Zn finger protein [General function pred	96.09
KOG1645		463	consensus RING-finger-containing E3 ubiquitin liga	96.02
KOG3039		303	consensus Uncharacterized conserved protein [Funct	95.98
KOG4739		233	consensus Uncharacterized protein involved in syna	95.93
KOG1734		328	consensus Predicted RING-containing E3 ubiquitin l	95.9
KOG4692		489	consensus Predicted E3 ubiquitin ligase [Posttrans	95.85
smart00744		49	RINGv The RING-variant domain is a C4HC3 zinc-fing	95.81
PF14570		48	zf-RING_4: RING/Ubox like zinc-binding domain; PDB	95.77
KOG3800		300	consensus Predicted E3 ubiquitin ligase containing	95.67
KOG0826		357	consensus Predicted E3 ubiquitin ligase involved i	95.65
KOG4185		296	consensus Predicted E3 ubiquitin ligase [Posttrans	95.65
KOG1001		674	consensus Helicase-like transcription factor HLTF/	95.55
COG5194		88	APC11 Component of SCF ubiquitin ligase and anapha	94.9
PF04641		260	Rtf2: Rtf2 RING-finger	94.78
KOG1493		84	consensus Anaphase-promoting complex (APC), subuni	94.52
PF07800		162	DUF1644: Protein of unknown function (DUF1644); In	94.47
COG5236		493	Uncharacterized conserved protein, contains RING Z	94.36
KOG3161		861	consensus Predicted E3 ubiquitin ligase [Posttrans	94.19
KOG1814		445	consensus Predicted E3 ubiquitin ligase [Posttrans	94.1
KOG2817		394	consensus Predicted E3 ubiquitin ligase [Posttrans	94.04
KOG3970		299	consensus Predicted E3 ubiquitin ligase [Posttrans	93.85
PF05290		140	Baculo_IE-1: Baculovirus immediate-early protein (	93.66
KOG1812		384	consensus Predicted E3 ubiquitin ligase [Posttrans	92.19
KOG2114		933	consensus Vacuolar assembly/sorting protein PEP5/V	92.02
KOG4362		684	consensus Transcriptional regulator BRCA1 [Replica	91.72
COG5220		314	TFB3 Cdk activating kinase (CAK)/RNA polymerase II	91.63
PF10367		109	Vps39_2: Vacuolar sorting protein 39 domain 2; Int	91.59
KOG2932		389	consensus E3 ubiquitin ligase involved in ubiquiti	91.24
KOG1941		518	consensus Acetylcholine receptor-associated protei	91.11
PF02891		50	zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041	90.88
KOG1428		3738	consensus Inhibitor of type V adenylyl cyclases/Ne	89.73
COG5175		480	MOT2 Transcriptional repressor [Transcription]	89.67
KOG1952		950	consensus Transcription factor NF-X1, contains NFX	89.25
PHA03096		284	p28-like protein; Provisional	88.35
KOG1100		207	consensus Predicted E3 ubiquitin ligase [Posttrans	88.28
KOG2930		114	consensus SCF ubiquitin ligase, Rbx1 component [Po	87.98
KOG3039		303	consensus Uncharacterized conserved protein [Funct	87.97
KOG1940		276	consensus Zn-finger protein [General function pred	87.77
PF08746		43	zf-RING-like: RING-like domain; InterPro: IPR01485	87.37
COG5109		396	Uncharacterized conserved protein, contains RING Z	87.34
KOG0298		1394	consensus DEAD box-containing helicase-like transc	85.74
KOG3579		352	consensus Predicted E3 ubiquitin ligase [Posttrans	82.9
PHA02825		162	LAP/PHD finger-like protein; Provisional	82.18
PF05883		134	Baculo_RING: Baculovirus U-box/Ring-like domain; I	82.13
KOG1815		444	consensus Predicted E3 ubiquitin ligase [Posttrans	82.11
PF10272		358	Tmpp129: Putative transmembrane protein precursor;	81.72
KOG3268		234	consensus Predicted E3 ubiquitin ligase [Posttrans	80.7
KOG4445		368	consensus Uncharacterized conserved protein, conta	80.63

>KOG1161 consensus Protein involved in vacuolar polyphosphate accumulation, contains SPX domain [Inorganic ion transport and metabolism]	Back alignment and domain information

Probab=99.95  E-value=3.8e-28  Score=218.95  Aligned_cols=140  Identities=24%  Similarity=0.253  Sum_probs=109.4

Q ss_pred             CCchhhhhhhHhhhhhhhhccCCccchHHHHHHHhhcccCCCCCCCcCcccccccccccchhhhhhhhccchhhhhhHHH
Q 021263            1 MKFGETFTEYLHGDQERFLDKCSHVEYKRLKKVLKSCRTCKGLHDSACKTEQQWDEGKDISESQLCQCQSSCQLCDHMFF   80 (315)
Q Consensus         1 MKFGk~l~~~~~~~~~~~~~~~~yi~Yk~LKk~ik~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ff   80 (315)
                      |||||.|++.+.|||     +.+|||||.|||+||+...  +.....+       +.+                .+..|+
T Consensus         1 MkFGk~L~~~~l~ew-----~~~yinYk~LKK~lK~~~~--~~~~~~~-------~~~----------------~e~dFv   50 (310)
T KOG1161|consen    1 MKFGKYLKEELLPEW-----KDKYINYKELKKLLKQYSI--QTADSSP-------DSR----------------DESDFV   50 (310)
T ss_pred             CchhHHHHHhhhhhH-----hhhhcCHHHHHHHHHHhcc--ccccCCc-------ccc----------------hHHHHH
Confidence            999999999999988     9999999999999999875  2211111       000                147899


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHh-----------hhhHHHHHHHHhhhhhcHHHHHHHHHHHHHHHHHHHHHHHHH
Q 021263           81 SELMKEASDIAGCFSSRARHLLHLHVA-----------SGMQRYVLRIRQCFKNDQTAMIEEGRVLIEYIIMNAIAIRKI  149 (315)
Q Consensus        81 ~~L~~El~kv~~f~~~r~~~l~~~~~~-----------~~~~~~~~~l~~~~~~~~~~~~~e~~~L~~f~~lN~~~~rki  149 (315)
                      ++||+||+||++|+.++.+++......           +.....+..++.    .+.+++.|+++|.+|++||+|||+||
T Consensus        51 ~~Ld~ELEKv~~F~lek~~el~~Rl~~L~e~~~~~~~~~~~~~~~~~lr~----~l~~~~~em~~L~~fs~LN~tGf~KI  126 (310)
T KOG1161|consen   51 RLLDAELEKVNGFQLEKESELIIRLKELEEKIDALSLEPPSAEEMKELRE----ELVDFHGEMVLLENFSRLNYTGFAKI  126 (310)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccCCcchhHHHHHHH----HHHHHHHHHHHHHHHHHHhHHHHHHH
Confidence            999999999999999988776653211           111223344554    56889999999999999999999999


Q ss_pred             hhhhhhhhccccCcchhhhhHHHHH
Q 021263          150 LKKYDKVHKSVNGKNFKSKMRAEHI  174 (315)
Q Consensus       150 lKK~dk~~~~~~~~~~~~~~~~~~i  174 (315)
                      ||||||+++......|..++...|+
T Consensus       127 LKK~DKrtg~~l~~~f~~~l~~~Pf  151 (310)
T KOG1161|consen  127 LKKHDKRTGYRLRPYFQVRLLHQPF  151 (310)
T ss_pred             HHHHhcccccccccHHHHHHHhCCC
Confidence            9999999998888888887766655

>PF03105 SPX: SPX domain; InterPro: IPR004331 The SPX domain is named after SYG1/Pho81/XPR1 proteins	Back alignment and domain information

>KOG1162 consensus Predicted small molecule transporter [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG5036 SPX domain-containing protein involved in vacuolar polyphosphate accumulation [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR00599 rad18 DNA repair protein rad18	Back alignment and domain information

>COG5408 SPX domain-containing protein [Signal transduction mechanisms]	Back alignment and domain information

>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A	Back alignment and domain information

>smart00504 Ubox Modified RING finger domain	Back alignment and domain information

>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair]	Back alignment and domain information

>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis	Back alignment and domain information

>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional	Back alignment and domain information

>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B	Back alignment and domain information

>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms]	Back alignment and domain information

>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A	Back alignment and domain information

>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A	Back alignment and domain information

>PHA02929 N1R/p28-like protein; Provisional	Back alignment and domain information

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A	Back alignment and domain information

>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A	Back alignment and domain information

>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PHA02926 zinc finger-like protein; Provisional	Back alignment and domain information

>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14634 zf-RING_5: zinc-RING finger domain	Back alignment and domain information

>smart00184 RING Ring finger	Back alignment and domain information

>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1	Back alignment and domain information

>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown]	Back alignment and domain information

>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]	Back alignment and domain information

>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms]	Back alignment and domain information

>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C	Back alignment and domain information

>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger	Back alignment and domain information

>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair]	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A	Back alignment and domain information

>KOG4367 consensus Predicted Zn-finger protein [Function unknown]	Back alignment and domain information

>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms]	Back alignment and domain information

>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14447 Prok-RING_4: Prokaryotic RING finger family 4	Back alignment and domain information

>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>KOG0825 consensus PHD Zn-finger protein [General function prediction only]	Back alignment and domain information

>KOG3002 consensus Zn finger protein [General function prediction only]	Back alignment and domain information

>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3039 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins	Back alignment and domain information

>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B	Back alignment and domain information

>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning]	Back alignment and domain information

>PF04641 Rtf2: Rtf2 RING-finger	Back alignment and domain information

>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function	Back alignment and domain information

>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0	Back alignment and domain information

>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription]	Back alignment and domain information

>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1	Back alignment and domain information

>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures]	Back alignment and domain information

>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms]	Back alignment and domain information

>COG5175 MOT2 Transcriptional repressor [Transcription]	Back alignment and domain information

>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription]	Back alignment and domain information

>PHA03096 p28-like protein; Provisional	Back alignment and domain information

>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3039 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1940 consensus Zn-finger protein [General function prediction only]	Back alignment and domain information

>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO)	Back alignment and domain information

>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair]	Back alignment and domain information

>KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PHA02825 LAP/PHD finger-like protein; Provisional	Back alignment and domain information

>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length	Back alignment and domain information

>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans	Back alignment and domain information

>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		315
2ecv_A		85	Solution Structure Of The Zinc Finger, C3hc4 Type (		7e-05
2egp_A		79	Solution Structure Of The Ring-Finger Domain From H		8e-05
2ecw_A		85	Solution Structure Of The Zinc Finger, C3hc4 Type (		5e-04

>pdb|2ECV|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Tripartite Motif-Containing Protein 5 Length = 85

Back alignment and structure

Iteration: 1
 Score = 44.7 bits (104), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 35/59 (59%), Gaps = 7/59 (11%)
Query: 226 IKLEYDLTCAVCLDLVFNPYALSCGHLFCKLC-ACSAASVMVFEGLKSASPDSKCPICR 283
           + ++ ++TC +CL+L+  P +L CGH FC+ C   +    M+ +G      +S CP+CR
Sbjct: 14  VNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKKSMLDKG------ESSCPVCR 66

PyMOL of 2ecv

>pdb|2EGP|A Chain A, Solution Structure Of The Ring-Finger Domain From Human Tripartite Motif Protein 34 Length = 79

Back alignment and structure

>pdb|2ECW|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Tripartite Motif Protein 30 Length = 85

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		315
2ecw_A		85	Tripartite motif-containing protein 30; metal bind	2e-10
3l11_A		115	E3 ubiquitin-protein ligase RNF168; E3 ligase, rin	8e-09
2d8t_A		71	Dactylidin, ring finger protein 146; RNF146, ring	9e-09
1z6u_A		150	NP95-like ring finger protein isoform B; structura	9e-09
2ecv_A		85	Tripartite motif-containing protein 5; metal bindi	1e-08
3fl2_A		124	E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA	4e-08
2ecy_A		66	TNF receptor-associated factor 3; metal binding pr	4e-08
2egp_A		79	Tripartite motif-containing protein 34; ZF-C3HC4 d	5e-08
2ysl_A		73	Tripartite motif-containing protein 31; ring-type	9e-08
1jm7_A		112	BRCA1, breast cancer type 1 susceptibility protein	1e-07
2y43_A		99	E3 ubiquitin-protein ligase RAD18; DNA repair, met	2e-07
2csy_A		81	Zinc finger protein 183-like 1; ring finger protei	2e-07
1jm7_B		117	BARD1, BRCA1-associated ring domain protein 1; rin	4e-07
4epo_C		149	E3 ubiquitin-protein ligase RNF8; coiled-coil, E3	6e-07
3hct_A		118	TNF receptor-associated factor 6; cross-brace, bet	6e-07
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	6e-07
2y1n_A		389	E3 ubiquitin-protein ligase; ligase-transferase co	7e-07
2ct2_A		88	Tripartite motif protein 32; zinc-finger protein H	1e-06
1bor_A		56	Transcription factor PML; proto-oncogene, nuclear	1e-06
2ecj_A		58	Tripartite motif-containing protein 39; TRIM39, ri	2e-06
2ysj_A		63	Tripartite motif-containing protein 31; ring-type	3e-06
2ckl_B		165	Ubiquitin ligase protein RING2; BMI1, RING1B, poly	5e-06
3ztg_A		92	E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR	5e-06
1rmd_A		116	RAG1; V(D)J recombination, antibody, MAD, ring fin	9e-06
3knv_A		141	TNF receptor-associated factor 2; cross-brace, alt	1e-05
2yur_A		74	Retinoblastoma-binding protein 6; P53-associated c	1e-05
3ng2_A		71	RNF4, snurf, ring finger protein 4; ring domain, E	2e-05
2ckl_A		108	Polycomb group ring finger protein 4; BMI1, RING1B	2e-05
2ea6_A		69	Ring finger protein 4; RNF4, RES4-26, ring domain,	4e-05
3hcs_A		170	TNF receptor-associated factor 6; cross-brace, bet	6e-05
2xeu_A		64	Ring finger protein 4; transcription, zinc-finger,	6e-05
3lrq_A		100	E3 ubiquitin-protein ligase TRIM37; structural gen	8e-05
2ecn_A		70	Ring finger protein 141; RNF141, ring domain, zinc	5e-04

>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85	Back alignment and structure

 Score = 55.5 bits (134), Expect = 2e-10
 Identities = 18/86 (20%), Positives = 35/86 (40%), Gaps = 5/86 (5%)

Query: 213 ASRPVMTLALPSSIKLEYDLTCAVCLDLVFNPYALSCGHLFCKLCACSAASVMVFEGLKS 272
            S     +A      ++ ++TC +CL+L+  P +  C H FC+ C         +E  ++
Sbjct: 1   GSSGSSGMASSVLEMIKEEVTCPICLELLKEPVSADCNHSFCRACITL-----NYESNRN 55

Query: 273 ASPDSKCPICREIIHISSIGAGWQLG 298
                 CP+CR      ++     + 
Sbjct: 56  TDGKGNCPVCRVPYPFGNLKPNLHVA 81

PyMOL of 2ecw

>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115	Back alignment and structure

>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71	Back alignment and structure

>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150	Back alignment and structure

>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85	Back alignment and structure

>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124	Back alignment and structure

>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66	Back alignment and structure

>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79	Back alignment and structure

>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73	Back alignment and structure

>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112	Back alignment and structure

>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99	Back alignment and structure

>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81	Back alignment and structure

>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117	Back alignment and structure

>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149	Back alignment and structure

>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72	Back alignment and structure

>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389	Back alignment and structure

>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88	Back alignment and structure

>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56	Back alignment and structure

>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58	Back alignment and structure

>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63	Back alignment and structure

>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165	Back alignment and structure

>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92	Back alignment and structure

>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116	Back alignment and structure

>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141	Back alignment and structure

>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74	Back alignment and structure

>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71	Back alignment and structure

>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108	Back alignment and structure

>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69	Back alignment and structure

>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170	Back alignment and structure

>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64	Back alignment and structure

>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100	Back alignment and structure

>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		315
1t1h_A		78	Gspef-atpub14, armadillo repeat containing protein	99.6
2kre_A		100	Ubiquitin conjugation factor E4 B; U-box domain, E	99.6
2kr4_A		85	Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri	99.58
3ztg_A		92	E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR	99.58
1wgm_A		98	Ubiquitin conjugation factor E4A; ubiquitinating e	99.57
3fl2_A		124	E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA	99.51
2y43_A		99	E3 ubiquitin-protein ligase RAD18; DNA repair, met	99.5
3lrq_A		100	E3 ubiquitin-protein ligase TRIM37; structural gen	99.46
1z6u_A		150	NP95-like ring finger protein isoform B; structura	99.45
4ayc_A		138	E3 ubiquitin-protein ligase RNF8; DNA damage, K63	99.45
2yu4_A		94	E3 SUMO-protein ligase NSE2; SP-ring domain, struc	99.44
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	99.42
2egp_A		79	Tripartite motif-containing protein 34; ZF-C3HC4 d	99.42
2ckl_A		108	Polycomb group ring finger protein 4; BMI1, RING1B	99.42
2ecw_A		85	Tripartite motif-containing protein 30; metal bind	99.42
2f42_A		179	STIP1 homology and U-box containing protein 1; cha	99.41
1jm7_B		117	BARD1, BRCA1-associated ring domain protein 1; rin	99.4
3l11_A		115	E3 ubiquitin-protein ligase RNF168; E3 ligase, rin	99.39
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	99.39
2yur_A		74	Retinoblastoma-binding protein 6; P53-associated c	99.38
2ecv_A		85	Tripartite motif-containing protein 5; metal bindi	99.38
2ecy_A		66	TNF receptor-associated factor 3; metal binding pr	99.38
2csy_A		81	Zinc finger protein 183-like 1; ring finger protei	99.37
2ysl_A		73	Tripartite motif-containing protein 31; ring-type	99.37
1jm7_A		112	BRCA1, breast cancer type 1 susceptibility protein	99.34
2ckl_B		165	Ubiquitin ligase protein RING2; BMI1, RING1B, poly	99.33
3hct_A		118	TNF receptor-associated factor 6; cross-brace, bet	99.32
1rmd_A		116	RAG1; V(D)J recombination, antibody, MAD, ring fin	99.29
2d8t_A		71	Dactylidin, ring finger protein 146; RNF146, ring	99.28
2ct2_A		88	Tripartite motif protein 32; zinc-finger protein H	99.27
2ysj_A		63	Tripartite motif-containing protein 31; ring-type	99.27
3htk_C		267	E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-	99.25
1g25_A		65	CDK-activating kinase assembly factor MAT1; ring f	99.24
2ea6_A		69	Ring finger protein 4; RNF4, RES4-26, ring domain,	99.23
3ng2_A		71	RNF4, snurf, ring finger protein 4; ring domain, E	99.22
3knv_A		141	TNF receptor-associated factor 2; cross-brace, alt	99.22
2ecj_A		58	Tripartite motif-containing protein 39; TRIM39, ri	99.21
1e4u_A		78	Transcriptional repressor NOT4; gene regulation, t	99.2
3hcs_A		170	TNF receptor-associated factor 6; cross-brace, bet	99.17
2ect_A		78	Ring finger protein 126; metal binding protein, st	99.16
2xeu_A		64	Ring finger protein 4; transcription, zinc-finger,	99.15
2ecn_A		70	Ring finger protein 141; RNF141, ring domain, zinc	99.13
1bor_A		56	Transcription factor PML; proto-oncogene, nuclear	99.12
2kiz_A		69	E3 ubiquitin-protein ligase arkadia; ring-H2 finge	99.12
1iym_A		55	EL5; ring-H2 finger, ubiquitin ligase, DNA binding	99.11
1chc_A		68	Equine herpes virus-1 ring domain; viral protein;	99.09
2l0b_A		91	E3 ubiquitin-protein ligase praja-1; zinc finger,	99.09
1x4j_A		75	Ring finger protein 38; structural genomics, NPPSF	99.08
2ecm_A		55	Ring finger and CHY zinc finger domain- containing	99.08
2ep4_A		74	Ring finger protein 24; zinc binding, ubiquitin, E	99.07
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	98.98
1v87_A		114	Deltex protein 2; ring-H2 domain, zinc-binding dom	98.96
2ecg_A		75	Baculoviral IAP repeat-containing protein 4; BIRC4	98.94
4ic3_A		74	E3 ubiquitin-protein ligase XIAP; ring domain, zin	98.93
1wim_A		94	KIAA0161 protein; ring finger domain, UBCM4-intera	98.89
2vje_A		64	E3 ubiquitin-protein ligase MDM2; proto-oncogene,	98.88
2y1n_A		389	E3 ubiquitin-protein ligase; ligase-transferase co	98.85
2ecl_A		81	Ring-box protein 2; RNF7, ring domian, zinc-bindin	98.84
2vje_B		63	MDM4 protein; proto-oncogene, phosphorylation, alt	98.79
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	98.75
2yho_A		79	E3 ubiquitin-protein ligase mylip; ligase, E2 liga	98.74
2ea5_A		68	Cell growth regulator with ring finger domain prot	98.73
2bay_A		61	PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l	98.72
3dpl_R		106	Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST	98.68
3t6p_A		345	Baculoviral IAP repeat-containing protein 2; ring,	98.52
4a0k_B		117	E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi	98.37
2d8s_A		80	Cellular modulator of immune recognition; C-MIR, m	98.29
2ct0_A		74	Non-SMC element 1 homolog; ring domain, structural	97.89
3vk6_A		101	E3 ubiquitin-protein ligase hakai; HYB, phosphotyr	97.78
1vyx_A		60	ORF K3, K3RING; zinc-binding protein, ring domain,	97.5
3k1l_B		381	Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A	97.4
3m62_A		968	Ubiquitin conjugation factor E4; armadillo-like re	97.34
2jun_A		101	Midline-1; B-BOX, TRIM, ring finger, alternative s	96.24
3nw0_A		238	Non-structural maintenance of chromosomes element	95.33
2cs3_A		93	Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s	92.57
3i2d_A		371	E3 SUMO-protein ligase SIZ1; signal transduction,	90.38
4fo9_A		360	E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom	89.2
2ko5_A		99	Ring finger protein Z; lassa fever virus-Z, negati	80.2

>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2	Back alignment and structure

Probab=99.60  E-value=7.9e-16  Score=113.12  Aligned_cols=69  Identities=13%  Similarity=0.198  Sum_probs=61.1

Q ss_pred             CccCceeccccccCCCcEEccCCCcchHHhHHHHHhhhhHhcccCCCCCCCCccccccccCCCC--cHHHHHHHHHHHHh
Q 021263          228 LEYDLTCAVCLDLVFNPYALSCGHLFCKLCACSAASVMVFEGLKSASPDSKCPICREIIHISSI--GAGWQLGCKETWQE  305 (315)
Q Consensus       228 l~~~l~C~IC~~~~~~Pv~l~CgH~FC~~Ci~~~~~~~~~~~~~~~~~~~~CP~Cr~~v~~~~~--n~~l~~lv~~~~~e  305 (315)
                      +.+.+.||||++++.+|++++|||+||..||.+|+.          .+...||+||.++....+  |..++++++.|...
T Consensus         5 ~~~~~~C~IC~~~~~~Pv~~~CgH~fc~~Ci~~~~~----------~~~~~CP~C~~~~~~~~l~~n~~l~~~i~~~~~~   74 (78)
T 1t1h_A            5 FPEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLD----------AGHKTCPKSQETLLHAGLTPNYVLKSLIALWCES   74 (78)
T ss_dssp             CSSSSSCTTTSCCCSSEEEETTTEEEEHHHHHHHHT----------TTCCBCTTTCCBCSSCCCEECTTTHHHHHHHHHH
T ss_pred             CcccCCCCCccccccCCEEcCCCCeecHHHHHHHHH----------HCcCCCCCCcCCCChhhCccCHHHHHHHHHHHHH
Confidence            457899999999999999999999999999999975          246789999999987766  99999999999875


Q ss_pred             c
Q 021263          306 Y  306 (315)
Q Consensus       306 ~  306 (315)
                      .
T Consensus        75 ~   75 (78)
T 1t1h_A           75 N   75 (78)
T ss_dssp             S
T ss_pred             c
Confidence            3

PyMOL of 1t1h

>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B	Back alignment and structure

>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus}	Back alignment and structure

>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens}	Back alignment and structure

>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2	Back alignment and structure

>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens}	Back alignment and structure

>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens}	Back alignment and structure

>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens}	Back alignment and structure

>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens}	Back alignment and structure

>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C	Back alignment and structure

>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens}	Back alignment and structure

>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A	Back alignment and structure

>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C	Back alignment and structure

>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens}	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens}	Back alignment and structure

>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B	Back alignment and structure

>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A	Back alignment and structure

>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1	Back alignment and structure

>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae}	Back alignment and structure

>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus}	Back alignment and structure

>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens}	Back alignment and structure

>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B	Back alignment and structure

>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens}	Back alignment and structure

>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens}	Back alignment and structure

>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1	Back alignment and structure

>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1	Back alignment and structure

>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens}	Back alignment and structure

>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A	Back alignment and structure

>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1	Back alignment and structure

>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A	Back alignment and structure

>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A	Back alignment and structure

>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A*	Back alignment and structure

>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B*	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A	Back alignment and structure

>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A	Back alignment and structure

>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A	Back alignment and structure

>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B	Back alignment and structure

>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus}	Back alignment and structure

>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus}	Back alignment and structure

>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3	Back alignment and structure

>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster}	Back alignment and structure

>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A	Back alignment and structure

>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens}	Back alignment and structure

>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens}	Back alignment and structure

>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3	Back alignment and structure

>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		315
d1jm7a_		103	g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie	1e-07
d1bora_		56	g.44.1.1 (A:) Acute promyelocytic leukaemia proto-	4e-06
d1rmda2		86	g.44.1.1 (A:1-86) V(D)J recombination activating p	6e-06
d1fbva4		79	g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta	1e-05
d1chca_		68	g.44.1.1 (A:) Immediate early protein, IEEHV {Equi	0.001

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103	Back information, alignment and structure


class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: brca1 RING domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 47.0 bits (111), Expect = 1e-07
 Identities = 19/71 (26%), Positives = 31/71 (43%), Gaps = 8/71 (11%)

Query: 227 KLEYDLTCAVCLDLVFNPYALSCGHLFCKLCACSAASVMVFEGLKSASPDSKCPICREII 286
            ++  L C +CL+L+  P +  C H+FCK C            L      S+CP+C+  I
Sbjct: 17  AMQKILECPICLELIKEPVSTKCDHIFCKFCMLKL--------LNQKKGPSQCPLCKNDI 68

Query: 287 HISSIGAGWQL 297
              S+    + 
Sbjct: 69  TKRSLQESTRF 79

PyMOL of d1jm7a_

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56	Back information, alignment and structure

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86	Back information, alignment and structure

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79	Back information, alignment and structure

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		315
d2c2la2		80	STIP1 homology and U box-containing protein 1, STU	99.63
d1t1ha_		78	E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi	99.62
d1jm7a_		103	brca1 RING domain {Human (Homo sapiens) [TaxId: 96	99.52
d1rmda2		86	V(D)J recombination activating protein 1 (RAG1), d	99.5
d1jm7b_		97	bard1 RING domain {Human (Homo sapiens) [TaxId: 96	99.5
d1wgma_		98	Ubiquitin conjugation factor E4A {Human (Homo sapi	99.48
d1fbva4		79	CBL {Human (Homo sapiens) [TaxId: 9606]}	99.3
d2baya1		56	Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac	99.28
d1bora_		56	Acute promyelocytic leukaemia proto-oncoprotein PM	99.23
d1g25a_		65	TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9	99.19
d1chca_		68	Immediate early protein, IEEHV {Equine herpesvirus	99.16
d1ur6b_		52	Not-4 N-terminal RING finger domain {Human (Homo s	99.1
d1iyma_		55	EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45	99.08
d1v87a_		114	Deltex protein 2 RING-H2 domain {Mouse (Mus muscul	98.84
d3dplr1		88	RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase	98.64
d1vyxa_		60	IE1B protein (ORF K3), N-terminal domain {Kaposi's	98.51
d1wima_		94	UbcM4-interacting protein 4 (KIAA0161) {Human (Hom	98.23
d2cs3a1		80	Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [	92.68

>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: U-box
domain: STIP1 homology and U box-containing protein 1, STUB1
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.63  E-value=1.3e-16  Score=116.48  Aligned_cols=69  Identities=10%  Similarity=0.063  Sum_probs=60.8

Q ss_pred             CccCceeccccccCCCcEEccCCCcchHHhHHHHHhhhhHhcccCCCCCCCCccccccccCCCC--cHHHHHHHHHHHHh
Q 021263          228 LEYDLTCAVCLDLVFNPYALSCGHLFCKLCACSAASVMVFEGLKSASPDSKCPICREIIHISSI--GAGWQLGCKETWQE  305 (315)
Q Consensus       228 l~~~l~C~IC~~~~~~Pv~l~CgH~FC~~Ci~~~~~~~~~~~~~~~~~~~~CP~Cr~~v~~~~~--n~~l~~lv~~~~~e  305 (315)
                      +.+++.||||+++|.+||+++|||+||..||.+|+.          .....||.||.++...++  |..|+++|+.|..+
T Consensus         4 iP~~l~CpIc~~l~~dPv~~~cGhtfc~~ci~~~l~----------~~~~~cP~c~~~l~~~~l~pN~~L~~~I~~~l~~   73 (80)
T d2c2la2           4 IPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQ----------RVGHFNPVTRSPLTQEQLIPNLAMKEVIDAFISE   73 (80)
T ss_dssp             CCSTTBCTTTCSBCSSEEECSSCCEEETTHHHHHHH----------HTCSSCTTTCCCCCGGGCEECHHHHHHHHHHHTT
T ss_pred             CCccccCcCcCchhhhhcccCCcCeecHHHHHHHHh----------cCCccCCCccccccccccccHHHHHHHHHHHHHH
Confidence            347899999999999999999999999999999975          245679999999887776  99999999999865


Q ss_pred             c
Q 021263          306 Y  306 (315)
Q Consensus       306 ~  306 (315)
                      .
T Consensus        74 ~   74 (80)
T d2c2la2          74 N   74 (80)
T ss_dssp             C
T ss_pred             C
Confidence            3

PyMOL of d2c2la2

>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]}	Back information, alignment and structure

>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]}	Back information, alignment and structure

>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]}	Back information, alignment and structure

>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure