Citrus Sinensis ID: 021275

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-----
MRFSESRKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDIFQSFFGGSPFGGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNVICTKCKGKGSKSGASMKCSGCQGSGMKVSIRHLGPSMIQQMQHPCNECKGTGETINDKDRCPQCKGEKVIQEKKVLEVIVEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPGKYNWMDVSLNLSAFVVQN
cEEEcccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHcHHHHcccccccccccccccHHHHccccccccccccccccccccccEEEEEEEcHHHHHccEEEEEEEccEEEccccccccccccccccccccccccEEEEEEEcccccEEEEEEEccccccEEEEEcccccccccccEEEEEEEEEEEEEEccccccccEEEEccccccccccccccEEEEEEEEcccccEEEcccEEEEEEccHHHHccccEEEEEcccccEEEEEEcccEEEccccEEEEEEEEEEEEEEEcc
cEEccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccHHHHHHHHHHcHHHcccccccccccccHHHHHHHHcccccccccccccccccccccEEEEEEEEHHHHHcccEEEEEEccEEEccccccccccccccccccccccccHEEEEEccccccEEEEEccccccccccEEEccccccccccccEEEEEEEEEEEEEccccccccEEEEEcccccccccccccEEEEEEEcccccEEEccccEEEEEEEEHHHHHcccEEEEEcccccEEEEEccccEEEEccccEEEEEEEEEEcEcccc
mrfsesrknaSQDDLKKAYRKAAIknhpdkggdpeKFKELAQAYEVlsdpekreIYDQYGEDalkegmgggggahdpfdifqsffggspfgggssrgrrqrrgedvihpLKVSLEDLyngtskklslsrnvictkckgkgsksgasmkcsgcqgsgmkvsirhlgpsmiqqmqhpcneckgtgetindkdrcpqckgekviqEKKVLEVIVEKGmqngqkitfpgeadeapdtvtGDIVFVLQqkehpkfkrkgddlFVEHTLSLTEALCGFQFVIthldgrqlliksqpgevvkpgkynwMDVSLNLSAFVVQN
mrfsesrknasqdDLKKAYRKAAIknhpdkggdpekFKELAQAYevlsdpekrEIYDQYGEDALKEGMGGGGGAHDPFDIFQSFFGGSPFGGGSSRGRRQRRGEDVIHPLKVSLEDLyngtskklslsrnvICTKckgkgsksgasmkcsgCQGSGMKVSIRHLGPSMIQQMQHPCNECKGTgetindkdrcpqckgekviqekkVLEVIVEKGmqngqkitfpgeadeapdTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPGKYNWMDVSLNLSAFVVQN
MRFSESRKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEgmgggggAHDPFDIfqsffggspfgggssrgrrqrrgEDVIHPLKVSLEDLYNGTSKKLSLSRNVIctkckgkgsksgasmkcsgcQGSGMKVSIRHLGPSMIQQMQHPCNECKGTGETINDKDRCPQCKGEKVIQEKKVLEVIVEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPGKYNWMDVSLNLSAFVVQN
********************************************************************************F**F**********************IHPLKVSLEDLYNGTSKKLSLSRNVICTKC*********************************************************QCKGEKVIQEKKVLEVIVEKGMQN**KITF********DTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPGKYNWMDVSLNLSAFVV**
MRFSESRKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYG*******************IFQSF*************************LKVSLEDLYNGTSKKLSLSRNVICTKCKG*****G***KCSGCQGSGMKVSIRHLGPSMIQQMQHPCNECKGTGETINDKDRCPQCKGEKVIQEKKVLEVIVEKGMQNGQKIT*********DTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPGKYNWMDVSLNLSAFVVQ*
***************KKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDIFQSFFGGSPFG***********GEDVIHPLKVSLEDLYNGTSKKLSLSRNVICTKCK***************QGSGMKVSIRHLGPSMIQQMQHPCNECKGTGETINDKDRCPQCKGEKVIQEKKVLEVIVEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPGKYNWMDVSLNLSAFVVQN
*RFSESRKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDIFQSFFGGSPFG**********RGEDVIHPLKVSLEDLYNGTSKKLSLSRNVICTKCKGK*****ASMKCSGCQGSGMKVSIRHLGPSMIQQMQHPCNECKGTGETINDKDRCPQCKGEKVIQEKKVLEVIVEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPGKYNWMDVSLNLSAFVVQN
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRFSESRKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDIFQSFFGGSPFGGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNVICTKCKGKGSKSGASMKCSGCQGSGMKVSIRHLGPSMIQQMQHPCNECKGTGETINDKDRCPQCKGEKVIQEKKVLEVIVEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPGKYNWMDVSLNLSAFVVQN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query315 2.2.26 [Sep-21-2011]
Q04960413 DnaJ protein homolog OS=C N/A no 0.936 0.714 0.909 1e-141
P43644417 DnaJ protein homolog ANJ1 N/A no 0.939 0.709 0.898 1e-139
Q03363397 DnaJ protein homolog 1 (F N/A no 0.939 0.745 0.865 1e-134
P42825419 Chaperone protein dnaJ 2 yes no 0.933 0.701 0.831 1e-133
Q94AW8420 Chaperone protein dnaJ 3 no no 0.936 0.702 0.864 1e-130
P42824418 DnaJ protein homolog 2 OS N/A no 0.939 0.708 0.851 1e-129
Q2HJ94412 DnaJ homolog subfamily A yes no 0.904 0.691 0.578 9e-87
O60884412 DnaJ homolog subfamily A yes no 0.914 0.699 0.567 2e-84
Q9QYJ0412 DnaJ homolog subfamily A yes no 0.914 0.699 0.564 4e-84
P31689397 DnaJ homolog subfamily A no no 0.901 0.715 0.547 1e-83
>sp|Q04960|DNJH_CUCSA DnaJ protein homolog OS=Cucumis sativus GN=DNAJ1 PE=2 SV=1 Back     alignment and function desciption
 Score =  501 bits (1291), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 270/297 (90%), Positives = 281/297 (94%), Gaps = 2/297 (0%)

Query: 8   KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEG 67
           KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEG
Sbjct: 21  KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEG 80

Query: 68  MGGGGGAHDPFDIFQSFFGGSPFGGGSSRGRRQRRG-EDVIHPLKVSLEDLYNGTSKKLS 126
           MGGGG  HDPFDIFQSFFGGSPFGGG S   R++R  EDVIHPLKVSLEDLYNGTSKKLS
Sbjct: 81  MGGGG-GHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSKKLS 139

Query: 127 LSRNVICTKCKGKGSKSGASMKCSGCQGSGMKVSIRHLGPSMIQQMQHPCNECKGTGETI 186
           LSRNVIC+KCKGKGSKSGASMKC GCQGSGMKVSIRHLGPSMIQQMQHPCNECKGTGETI
Sbjct: 140 LSRNVICSKCKGKGSKSGASMKCPGCQGSGMKVSIRHLGPSMIQQMQHPCNECKGTGETI 199

Query: 187 NDKDRCPQCKGEKVIQEKKVLEVIVEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKE 246
           NDKDRC QCKGEKV+QEKKVLEVIVEKGMQN QKITFPGEADEAPDTVTGDIVFVLQQKE
Sbjct: 200 NDKDRCSQCKGEKVVQEKKVLEVIVEKGMQNAQKITFPGEADEAPDTVTGDIVFVLQQKE 259

Query: 247 HPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPGKYNWMD 303
           HPKFKRKGDDLFVEHTLSL E+LCGFQF++THLDGRQLLIKS PGEVVKP ++  ++
Sbjct: 260 HPKFKRKGDDLFVEHTLSLVESLCGFQFILTHLDGRQLLIKSLPGEVVKPDQFKAIN 316
Have a continuous role in plant development probably in the structural organization of compartments.
Cucumis sativus (taxid: 3659)
>sp|P43644|DNJH_ATRNU DnaJ protein homolog ANJ1 OS=Atriplex nummularia PE=2 SV=1 Back     alignment and function description
>sp|Q03363|DNJH1_ALLPO DnaJ protein homolog 1 (Fragment) OS=Allium porrum GN=DNAJ1 PE=2 SV=1 Back     alignment and function description
>sp|P42825|DNAJ2_ARATH Chaperone protein dnaJ 2 OS=Arabidopsis thaliana GN=ATJ2 PE=1 SV=2 Back     alignment and function description
>sp|Q94AW8|DNAJ3_ARATH Chaperone protein dnaJ 3 OS=Arabidopsis thaliana GN=ATJ3 PE=1 SV=2 Back     alignment and function description
>sp|P42824|DNJH2_ALLPO DnaJ protein homolog 2 OS=Allium porrum GN=LDJ2 PE=2 SV=1 Back     alignment and function description
>sp|Q2HJ94|DNJA2_BOVIN DnaJ homolog subfamily A member 2 OS=Bos taurus GN=DNAJA2 PE=2 SV=1 Back     alignment and function description
>sp|O60884|DNJA2_HUMAN DnaJ homolog subfamily A member 2 OS=Homo sapiens GN=DNAJA2 PE=1 SV=1 Back     alignment and function description
>sp|Q9QYJ0|DNJA2_MOUSE DnaJ homolog subfamily A member 2 OS=Mus musculus GN=Dnaja2 PE=1 SV=1 Back     alignment and function description
>sp|P31689|DNJA1_HUMAN DnaJ homolog subfamily A member 1 OS=Homo sapiens GN=DNAJA1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query315
4210948415 DnaJ protein [Hevea brasiliensis] 0.936 0.710 0.902 1e-145
4008159 420 DnaJ homolog [Salix gilgiana] 0.939 0.704 0.886 1e-144
225463715 416 PREDICTED: dnaJ protein homolog [Vitis v 0.939 0.711 0.919 1e-143
350536331 419 DnaJ-like protein [Solanum lycopersicum] 0.939 0.706 0.889 1e-143
161137763 417 DnaJ [Viola baoshanensis] 0.939 0.709 0.912 1e-142
255546721 418 Chaperone protein dnaJ, putative [Ricinu 0.939 0.708 0.922 1e-142
225464824 417 PREDICTED: dnaJ protein homolog [Vitis v 0.939 0.709 0.902 1e-141
296084852394 unnamed protein product [Vitis vinifera] 0.939 0.751 0.902 1e-140
224113389 422 predicted protein [Populus trichocarpa] 0.939 0.701 0.88 1e-140
224097588 420 predicted protein [Populus trichocarpa] 0.939 0.704 0.882 1e-140
>gi|4210948|gb|AAD12055.1| DnaJ protein [Hevea brasiliensis] Back     alignment and taxonomy information
 Score =  521 bits (1343), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 267/296 (90%), Positives = 281/296 (94%), Gaps = 1/296 (0%)

Query: 8   KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEG 67
           KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEG
Sbjct: 22  KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEG 81

Query: 68  MGGGGGAHDPFDIFQSFFGGSPFGGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSKKLSL 127
           MG GGGAHDPFDIFQSFFGG+PFGGG S   R++ GEDVIHPLKVSLEDLYNGTSKKLSL
Sbjct: 82  MGSGGGAHDPFDIFQSFFGGNPFGGGGSSRGRRKEGEDVIHPLKVSLEDLYNGTSKKLSL 141

Query: 128 SRNVICTKCKGKGSKSGASMKCSGCQGSGMKVSIRHLGPSMIQQMQHPCNECKGTGETIN 187
           SRNVIC+KCKGKGSKSGASMKCSGCQGSGMKVSIR LGPSMIQQMQHPCNECKGTGETIN
Sbjct: 142 SRNVICSKCKGKGSKSGASMKCSGCQGSGMKVSIRQLGPSMIQQMQHPCNECKGTGETIN 201

Query: 188 DKDRCPQCKGEKVIQEKKVLEVIVEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEH 247
           DKDRCPQCKGEKV+QEKKVLEVIVEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH
Sbjct: 202 DKDRCPQCKGEKVVQEKKVLEVIVEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEH 261

Query: 248 PKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPGKYNWMD 303
           PKFKRKGDDL V+HTLSLTEALC  QF++THLDG  LLIKSQPGEVVKP ++  ++
Sbjct: 262 PKFKRKGDDLIVDHTLSLTEALCASQFILTHLDG-DLLIKSQPGEVVKPDQFKAIN 316

Source: Hevea brasiliensis

Species: Hevea brasiliensis

Genus: Hevea

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|4008159|dbj|BAA35121.1| DnaJ homolog [Salix gilgiana] Back     alignment and taxonomy information
>gi|225463715|ref|XP_002263156.1| PREDICTED: dnaJ protein homolog [Vitis vinifera] gi|296084435|emb|CBI24994.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|350536331|ref|NP_001234241.1| DnaJ-like protein [Solanum lycopersicum] gi|6782421|gb|AAF28382.1|AF124139_1 DnaJ-like protein [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|161137763|gb|ABX57881.1| DnaJ [Viola baoshanensis] Back     alignment and taxonomy information
>gi|255546721|ref|XP_002514419.1| Chaperone protein dnaJ, putative [Ricinus communis] gi|111143344|gb|ABH06547.1| molecular chaperone [Ricinus communis] gi|223546415|gb|EEF47915.1| Chaperone protein dnaJ, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225464824|ref|XP_002270362.1| PREDICTED: dnaJ protein homolog [Vitis vinifera] gi|147804853|emb|CAN64692.1| hypothetical protein VITISV_030671 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296084852|emb|CBI28261.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224113389|ref|XP_002316479.1| predicted protein [Populus trichocarpa] gi|118486965|gb|ABK95315.1| unknown [Populus trichocarpa] gi|222865519|gb|EEF02650.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224097588|ref|XP_002310999.1| predicted protein [Populus trichocarpa] gi|222850819|gb|EEE88366.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query315
TAIR|locus:2081378420 J3 [Arabidopsis thaliana (taxi 0.926 0.695 0.732 1.1e-110
TAIR|locus:505006628419 J2 "DNAJ homologue 2" [Arabido 0.926 0.696 0.699 3.5e-107
ZFIN|ZDB-GENE-030131-2884413 dnaja2l "DnaJ (Hsp40) homolog, 0.917 0.699 0.489 9.6e-73
UNIPROTKB|Q2HJ94412 DNAJA2 "DnaJ homolog subfamily 0.914 0.699 0.487 2.5e-72
UNIPROTKB|O60884412 DNAJA2 "DnaJ homolog subfamily 0.914 0.699 0.487 3.2e-72
UNIPROTKB|F1RP05412 LOC100521133 "Uncharacterized 0.914 0.699 0.487 3.2e-72
MGI|MGI:1931882412 Dnaja2 "DnaJ (Hsp40) homolog, 0.914 0.699 0.484 1.4e-71
UNIPROTKB|Q5M9H7412 Dnaja2 "DnaJ homolog subfamily 0.914 0.699 0.484 1.4e-71
UNIPROTKB|E2R7F3413 DNAJA2 "Uncharacterized protei 0.914 0.697 0.486 2.9e-71
ZFIN|ZDB-GENE-040426-2884412 dnaja2 "DnaJ (Hsp40) homolog, 0.917 0.701 0.477 2.9e-71
TAIR|locus:2081378 J3 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1093 (389.8 bits), Expect = 1.1e-110, P = 1.1e-110
 Identities = 214/292 (73%), Positives = 226/292 (77%)

Query:     8 KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEX 67
             K+AS +DLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKE 
Sbjct:    23 KSASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEG 82

Query:    68 XXXXXXAHDPFDIXXXXXXXXXXXXXXXXXXXXXXXEDVIHPLKVSLEDLYNGTSKKLSL 127
                    HDPFDI                       EDV+HPLKVSLED+Y GT KKLSL
Sbjct:    83 MGGGGGGHDPFDIFSSFFGGGPFGGNTSRQRRQRRGEDVVHPLKVSLEDVYLGTMKKLSL 142

Query:   128 SRNVIXXXXXXXXXXXXXXXXXXXXQGSGMKVSIRHLGPSMIQQMQHPCNECKGTGETIN 187
             SRN +                    QGSGMKVSIR LGP MIQQMQH CNECKGTGETIN
Sbjct:   143 SRNALCSKCNGKGSKSGASLKCGGCQGSGMKVSIRQLGPGMIQQMQHACNECKGTGETIN 202

Query:   188 DKDRCPQCKGEKVIQEKKVLEVIVEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEH 247
             D+DRCPQCKG+KVI EKKVLEV VEKGMQ+ QKITF G+ADEAPDTVTGDIVFVLQQKEH
Sbjct:   203 DRDRCPQCKGDKVIPEKKVLEVNVEKGMQHSQKITFEGQADEAPDTVTGDIVFVLQQKEH 262

Query:   248 PKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPGKY 299
             PKFKRKG+DLFVEHTLSLTEALCGFQFV+THLDGR LLIKS PGEVVKP  Y
Sbjct:   263 PKFKRKGEDLFVEHTLSLTEALCGFQFVLTHLDGRSLLIKSNPGEVVKPDSY 314
GO:0005524 "ATP binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006457 "protein folding" evidence=ISS
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
GO:0005730 "nucleolus" evidence=IDA
GO:0005618 "cell wall" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0009651 "response to salt stress" evidence=IMP
GO:0043462 "regulation of ATPase activity" evidence=IMP
GO:0005829 "cytosol" evidence=IDA
GO:0009911 "positive regulation of flower development" evidence=IMP
GO:0048573 "photoperiodism, flowering" evidence=IMP
GO:0009506 "plasmodesma" evidence=IDA
GO:0006499 "N-terminal protein myristoylation" evidence=RCA
TAIR|locus:505006628 J2 "DNAJ homologue 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-2884 dnaja2l "DnaJ (Hsp40) homolog, subfamily A, member 2, like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q2HJ94 DNAJA2 "DnaJ homolog subfamily A member 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O60884 DNAJA2 "DnaJ homolog subfamily A member 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RP05 LOC100521133 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1931882 Dnaja2 "DnaJ (Hsp40) homolog, subfamily A, member 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5M9H7 Dnaja2 "DnaJ homolog subfamily A member 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2R7F3 DNAJA2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2884 dnaja2 "DnaJ (Hsp40) homolog, subfamily A, member 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O60884DNJA2_HUMANNo assigned EC number0.56740.91420.6990yesno
P43644DNJH_ATRNUNo assigned EC number0.89890.93960.7098N/Ano
O35824DNJA2_RATNo assigned EC number0.56050.91420.6990yesno
O74752MAS5_SCHPONo assigned EC number0.52200.91740.7100yesno
Q5NVI9DNJA1_PONABNo assigned EC number0.54480.89200.7095yesno
Q03363DNJH1_ALLPONo assigned EC number0.86530.93960.7455N/Ano
Q2HJ94DNJA2_BOVINNo assigned EC number0.57870.90470.6917yesno
Q04960DNJH_CUCSANo assigned EC number0.90900.93650.7142N/Ano
P42824DNJH2_ALLPONo assigned EC number0.85180.93960.7081N/Ano
P42825DNAJ2_ARATHNo assigned EC number0.83160.93330.7016yesno
Q9QYJ0DNJA2_MOUSENo assigned EC number0.56400.91420.6990yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query315
PTZ00037421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 1e-123
COG0484371 COG0484, DnaJ, DnaJ-class molecular chaperone with 5e-98
TIGR02349354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 3e-86
PRK10767371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 1e-72
PRK14278378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 2e-61
PRK14291382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 1e-60
PRK14281397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 3e-58
PRK14289386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 3e-56
PRK14294366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 3e-55
PRK14301373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 4e-55
PRK14280376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 1e-54
PRK14293374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 3e-54
PRK14276380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 2e-53
PRK14290365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 5e-52
PRK14292371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 1e-51
PRK14283378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 1e-51
PRK14298377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 6e-51
PRK14297380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 2e-50
PRK14277386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 1e-49
PRK14286372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 2e-49
PRK14285365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 2e-48
PRK14284391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 2e-46
PRK14279392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 1e-45
PRK14295389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 1e-45
PRK14282369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 5e-44
PRK14287371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 8e-44
PRK14300372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 1e-38
PRK14296372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 9e-38
PRK14288369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 3e-36
cd10747158 cd10747, DnaJ_C, C-terminal substrate binding doma 2e-31
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 3e-26
pfam0022663 pfam00226, DnaJ, DnaJ domain 4e-23
pfam0068465 pfam00684, DnaJ_CXXCXGXG, DnaJ central domain 4e-19
cd1071965 cd10719, DnaJ_zf, Zinc finger domain of DnaJ and H 8e-18
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 9e-18
PRK10266306 PRK10266, PRK10266, curved DNA-binding protein Cbp 1e-17
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 1e-15
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 3e-15
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 3e-15
PHA03102153 PHA03102, PHA03102, Small T antigen; Reviewed 5e-09
pfam0155681 pfam01556, DnaJ_C, DnaJ C terminal domain 9e-09
PHA02624 647 PHA02624, PHA02624, large T antigen; Provisional 4e-08
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 5e-07
COG5269379 COG5269, ZUO1, Ribosome-associated chaperone zuoti 1e-05
cd10747158 cd10747, DnaJ_C, C-terminal substrate binding doma 7e-05
PTZ00341 1136 PTZ00341, PTZ00341, Ring-infected erythrocyte surf 4e-04
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information 
 Score =  359 bits (924), Expect = e-123
 Identities = 150/293 (51%), Positives = 201/293 (68%), Gaps = 11/293 (3%)

Query: 5   ESRKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDAL 64
              K+ +  ++KKAYRK AIK+HPDKGGDPEKFKE+++AYEVLSDPEKR+IYD+YGE   
Sbjct: 35  NLSKDCTTSEIKKAYRKLAIKHHPDKGGDPEKFKEISRAYEVLSDPEKRKIYDEYGE--- 91

Query: 65  KEGMGGGGGAHDPFDIFQSFFGGSPFGGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSKK 124
            EG+ GG    D  D+F   FGG    GG      ++RGED++  LKV+LE +YNG  +K
Sbjct: 92  -EGLEGGEQPADASDLFDLIFGGGRKPGG------KKRGEDIVSHLKVTLEQIYNGAMRK 144

Query: 125 LSLSRNVICTKCKGKGSKSGASMKCSGCQGSGMKVSIRHLGPSMIQQMQHPCNECKGTGE 184
           L+++++VIC  C+G G    A + C  C G G++V IR +G  MI Q Q  CN C G G+
Sbjct: 145 LAINKDVICANCEGHGGPKDAFVDCKLCNGQGIRVQIRQMGS-MIHQTQSTCNSCNGQGK 203

Query: 185 TINDKDRCPQCKGEKVIQEKKVLEVIVEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQ 244
            I +  +C  C G+ V + +K+LEV ++KG+ N  KITF GEADE P+ + G++VF+L +
Sbjct: 204 IIPESKKCKNCSGKGVKKTRKILEVNIDKGVPNQHKITFHGEADEKPNEIPGNVVFILNE 263

Query: 245 KEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPG 297
           K H  FKR+G DLF+   +SL EAL GF F ITHLDGR+LL+ + PGEVVKPG
Sbjct: 264 KPHDTFKREGGDLFITKKISLYEALTGFVFYITHLDGRKLLVNTPPGEVVKPG 316

Length = 421
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|199909 cd10747, DnaJ_C, C-terminal substrate binding domain of DnaJ and HSP40 Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|216058 pfam00684, DnaJ_CXXCXGXG, DnaJ central domain Back     alignment and domain information
>gnl|CDD|199908 cd10719, DnaJ_zf, Zinc finger domain of DnaJ and HSP40 Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|222986 PHA03102, PHA03102, Small T antigen; Reviewed Back     alignment and domain information
>gnl|CDD|216569 pfam01556, DnaJ_C, DnaJ C terminal domain Back     alignment and domain information
>gnl|CDD|222912 PHA02624, PHA02624, large T antigen; Provisional Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|199909 cd10747, DnaJ_C, C-terminal substrate binding domain of DnaJ and HSP40 Back     alignment and domain information
>gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 315
COG0484371 DnaJ DnaJ-class molecular chaperone with C-termina 100.0
PTZ00037421 DnaJ_C chaperone protein; Provisional 100.0
PRK14296372 chaperone protein DnaJ; Provisional 100.0
PRK14288369 chaperone protein DnaJ; Provisional 100.0
PRK14298377 chaperone protein DnaJ; Provisional 100.0
PRK14287371 chaperone protein DnaJ; Provisional 100.0
PRK14276380 chaperone protein DnaJ; Provisional 100.0
PRK14286372 chaperone protein DnaJ; Provisional 100.0
PRK14280376 chaperone protein DnaJ; Provisional 100.0
PRK14282369 chaperone protein DnaJ; Provisional 100.0
PRK14278378 chaperone protein DnaJ; Provisional 100.0
PRK14277386 chaperone protein DnaJ; Provisional 100.0
PRK14285365 chaperone protein DnaJ; Provisional 100.0
PRK14297380 chaperone protein DnaJ; Provisional 100.0
PRK14284391 chaperone protein DnaJ; Provisional 100.0
PRK14279392 chaperone protein DnaJ; Provisional 100.0
KOG0712337 consensus Molecular chaperone (DnaJ superfamily) [ 100.0
PRK14281397 chaperone protein DnaJ; Provisional 100.0
PRK14294366 chaperone protein DnaJ; Provisional 100.0
TIGR02349354 DnaJ_bact chaperone protein DnaJ. This model repre 100.0
PRK14301373 chaperone protein DnaJ; Provisional 100.0
PRK14295389 chaperone protein DnaJ; Provisional 100.0
PRK14290365 chaperone protein DnaJ; Provisional 100.0
PRK10767371 chaperone protein DnaJ; Provisional 100.0
PRK14300372 chaperone protein DnaJ; Provisional 100.0
PRK14291382 chaperone protein DnaJ; Provisional 100.0
PRK14293374 chaperone protein DnaJ; Provisional 100.0
PRK14292371 chaperone protein DnaJ; Provisional 100.0
PRK14283378 chaperone protein DnaJ; Provisional 100.0
PRK14289386 chaperone protein DnaJ; Provisional 100.0
PRK14299291 chaperone protein DnaJ; Provisional 100.0
PRK10266306 curved DNA-binding protein CbpA; Provisional 100.0
KOG0715288 consensus Molecular chaperone (DnaJ superfamily) [ 100.0
KOG0713336 consensus Molecular chaperone (DnaJ superfamily) [ 100.0
TIGR03835871 termin_org_DnaJ terminal organelle assembly protei 100.0
KOG0714306 consensus Molecular chaperone (DnaJ superfamily) [ 99.87
COG0484371 DnaJ DnaJ-class molecular chaperone with C-termina 99.76
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.76
KOG0716279 consensus Molecular chaperone (DnaJ superfamily) [ 99.76
PHA03102153 Small T antigen; Reviewed 99.74
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.73
PRK10767371 chaperone protein DnaJ; Provisional 99.71
KOG0691296 consensus Molecular chaperone (DnaJ superfamily) [ 99.67
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.66
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.66
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.64
KOG0719264 consensus Molecular chaperone (DnaJ superfamily) [ 99.64
PRK14288369 chaperone protein DnaJ; Provisional 99.63
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.62
PRK14282369 chaperone protein DnaJ; Provisional 99.56
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.54
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.54
PRK14298377 chaperone protein DnaJ; Provisional 99.54
PRK14285365 chaperone protein DnaJ; Provisional 99.53
PRK14277386 chaperone protein DnaJ; Provisional 99.53
PRK14290365 chaperone protein DnaJ; Provisional 99.51
PRK14294366 chaperone protein DnaJ; Provisional 99.51
PF0068466 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 99.5
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.5
PRK14279392 chaperone protein DnaJ; Provisional 99.5
PRK14301373 chaperone protein DnaJ; Provisional 99.5
PRK14284391 chaperone protein DnaJ; Provisional 99.49
PRK14278378 chaperone protein DnaJ; Provisional 99.47
PRK14286372 chaperone protein DnaJ; Provisional 99.47
PRK14287371 chaperone protein DnaJ; Provisional 99.47
PRK14300372 chaperone protein DnaJ; Provisional 99.47
PRK14295389 chaperone protein DnaJ; Provisional 99.47
PRK14293374 chaperone protein DnaJ; Provisional 99.45
TIGR02349354 DnaJ_bact chaperone protein DnaJ. This model repre 99.45
PRK14296372 chaperone protein DnaJ; Provisional 99.44
PRK14276380 chaperone protein DnaJ; Provisional 99.43
PRK14281397 chaperone protein DnaJ; Provisional 99.43
PRK14280376 chaperone protein DnaJ; Provisional 99.43
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.41
PTZ00100116 DnaJ chaperone protein; Provisional 99.4
KOG0722329 consensus Molecular chaperone (DnaJ superfamily) [ 99.4
PRK14292371 chaperone protein DnaJ; Provisional 99.4
PRK14297380 chaperone protein DnaJ; Provisional 99.4
PTZ00037421 DnaJ_C chaperone protein; Provisional 99.39
PRK14289386 chaperone protein DnaJ; Provisional 99.38
PRK14283378 chaperone protein DnaJ; Provisional 99.37
PRK05014171 hscB co-chaperone HscB; Provisional 99.36
PRK01356166 hscB co-chaperone HscB; Provisional 99.36
PRK14291382 chaperone protein DnaJ; Provisional 99.35
PHA02624 647 large T antigen; Provisional 99.28
PRK03578176 hscB co-chaperone HscB; Provisional 99.27
PRK00294173 hscB co-chaperone HscB; Provisional 99.26
KOG0720490 consensus Molecular chaperone (DnaJ superfamily) [ 99.25
PF0155681 CTDII: DnaJ C terminal domain; InterPro: IPR002939 99.07
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 98.99
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 98.96
PF0155681 CTDII: DnaJ C terminal domain; InterPro: IPR002939 98.92
PRK01773173 hscB co-chaperone HscB; Provisional 98.81
PLN03165111 chaperone protein dnaJ-related; Provisional 98.8
PRK14299291 chaperone protein DnaJ; Provisional 98.73
KOG0712337 consensus Molecular chaperone (DnaJ superfamily) [ 98.67
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 98.6
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 98.58
COG5269379 ZUO1 Ribosome-associated chaperone zuotin [Transla 98.52
PRK10266306 curved DNA-binding protein CbpA; Provisional 98.5
PF0068466 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 98.34
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.32
TIGR02642186 phage_xxxx uncharacterized phage protein. This unc 98.31
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 98.28
KOG0568342 consensus Molecular chaperone (DnaJ superfamily) [ 98.22
COG1107 715 Archaea-specific RecJ-like exonuclease, contains D 98.12
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 98.12
KOG2813406 consensus Predicted molecular chaperone, contains 97.88
PLN03165111 chaperone protein dnaJ-related; Provisional 97.51
COG1107 715 Archaea-specific RecJ-like exonuclease, contains D 97.35
KOG2813406 consensus Predicted molecular chaperone, contains 96.94
TIGR02642186 phage_xxxx uncharacterized phage protein. This unc 96.36
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 96.14
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 96.06
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 94.93
KOG0715288 consensus Molecular chaperone (DnaJ superfamily) [ 91.67
PF11833194 DUF3353: Protein of unknown function (DUF3353); In 90.38
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 90.08
cd03031147 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d 88.11
KOG2824281 consensus Glutaredoxin-related protein [Posttransl 88.07
PF1344662 RPT: A repeated domain in UCH-protein 86.68
KOG0431453 consensus Auxilin-like protein and related protein 85.02
KOG0724335 consensus Zuotin and related molecular chaperones 84.31
smart00709160 Zpr1 Duplicated domain in the epidermal growth fac 81.64
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 81.2
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=6.4e-83  Score=591.98  Aligned_cols=299  Identities=40%  Similarity=0.723  Sum_probs=270.6

Q ss_pred             CeeeCCCCCCCHHHHHHHHHHHHHHhCCCCCC-CH---HHHHHHHHHHhhcCCCccccccccccccccc-cccCCC--CC
Q 021275            1 MRFSESRKNASQDDLKKAYRKAAIKNHPDKGG-DP---EKFKELAQAYEVLSDPEKREIYDQYGEDALK-EGMGGG--GG   73 (315)
Q Consensus         1 y~vLgv~~~a~~~~ik~ayr~la~~~hPd~~~-~~---~~f~~i~~Ay~~L~d~~~R~~YD~~g~~~~~-~g~~~~--~~   73 (315)
                      |+||||+++||.+|||+|||+||++||||+|+ ++   ++|++|+|||||||||+||++||+||+++++ +++++.  ++
T Consensus         7 YeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~~~gg~gg~g~~~   86 (371)
T COG0484           7 YEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGFKAGGFGGFGFGG   86 (371)
T ss_pred             hhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHhhccCccccccCCcCCCCcCC
Confidence            89999999999999999999999999999999 43   8999999999999999999999999999986 333321  11


Q ss_pred             CC-CCcccccCcccCCCCCCCCCCCCCcCCCcceeeeeeeeeeccccceeeEeeceeeEEccCCCCCCcccCC-ceecCC
Q 021275           74 AH-DPFDIFQSFFGGSPFGGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNVICTKCKGKGSKSGA-SMKCSG  151 (315)
Q Consensus        74 ~~-~~~~~F~~~Fgg~~~~~~~~~~~~~~~~~d~~~~~~~~l~e~~~G~~~~~~~~~~~~C~~C~G~G~~~~~-~~~C~~  151 (315)
                      +. +|.|||++|||++.+  ++++..++.++.|+.+.++|||+|++.|+++++.+++...|++|+|+|+..++ ..+|++
T Consensus        87 fgg~~~DIF~~~FgGg~~--~~~~~~~~~rG~Dl~~~l~isleEa~~G~~~~i~~~~~~~C~~C~GsGak~gt~~~tC~t  164 (371)
T COG0484          87 FGGDFGDIFEDFFGGGGG--GRRRPNRPRRGADLRYNLEITLEEAVFGVKKEIRVTRSVTCSTCHGSGAKPGTDPKTCPT  164 (371)
T ss_pred             CCCCHHHHHHHhhcCCCc--ccCCCCCcccCCceEEEEEeEhhhhccCceeeEecceeeECCcCCCCCCCCCCCCCcCCC
Confidence            22 688999999974432  22333446789999999999999999999999999999999999999999985 678999


Q ss_pred             CcCCceEEEEEecCCcceeEeeeeCCCCCCCceEeCCCCCCCccCCceEEEEeEEEEEEecccccCCcEEEEcCCcCCCC
Q 021275          152 CQGSGMKVSIRHLGPSMIQQMQHPCNECKGTGETINDKDRCPQCKGEKVIQEKKVLEVIVEKGMQNGQKITFPGEADEAP  231 (315)
Q Consensus       152 C~G~G~~~~~~~~~~g~~~~~~~~C~~C~G~G~~~~~~~~C~~C~G~g~~~~~~~~~v~Ip~G~~~G~~i~l~g~G~~~~  231 (315)
                      |+|+|++...+++  |+ .+++++|+.|+|+|+++.  ++|+.|+|.|++.+.++|+|+||||+.+|++|+++|+|++.+
T Consensus       165 C~G~G~v~~~~~~--g~-~~~~~~C~~C~G~G~~i~--~pC~~C~G~G~v~~~~~i~V~IPaGv~~g~~ir~~g~G~~g~  239 (371)
T COG0484         165 CNGSGQVRTVQRT--GF-FSFQQTCPTCNGTGKIIK--DPCGKCKGKGRVKKKKSISVNIPAGVDDGDRIRLSGEGEAGP  239 (371)
T ss_pred             CCCcCeEEEEEee--eE-EEEEEECCCCccceeECC--CCCCCCCCCCeEeeeeEEEEECCCCCccCCEEEEecCcccCC
Confidence            9999998887777  33 567999999999999996  999999999999999999999999999999999999999985


Q ss_pred             -CCCccCEEEEEEEecCCCcEEeCCcEEEEEecCHHHHhCCCEEEEeCCCCCeEEEecCCCceeeCCcEEEEeCCCCcc
Q 021275          232 -DTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPGKYNWMDVSLNLS  309 (315)
Q Consensus       232 -~~~~GDL~v~i~v~~~~~f~r~g~dL~~~~~I~l~~al~G~~~~v~tldG~~~~i~~~~~~v~~pg~~~~i~~~~~~~  309 (315)
                       ++++|||||.|.|++|+.|.|+|+|||++++||+.+|+||++++||||||+ +.|+||||  +++|..++|+|+|.+.
T Consensus       240 ~Ggp~GDLyv~i~v~~h~~F~R~g~dL~~~~~Is~~~AalG~~i~vptl~g~-~~l~ip~G--tq~G~~~rl~gkG~p~  315 (371)
T COG0484         240 NGGPAGDLYVFVHVKPHPIFERDGDDLYCEVPISFTEAALGGEIEVPTLDGR-VKLKIPAG--TQTGEVFRLRGKGMPK  315 (371)
T ss_pred             CCCCCccEEEEEEeecCCCeEECCCceEeccccCHHHHhcCCEEEEEecCCC-EEEecCCC--CccCcEEEEcCCCccc
Confidence             778899999999999999999999999999999999999999999999998 99999999  8889999999999875

>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01556 CTDII: DnaJ C terminal domain; InterPro: IPR002939 Molecular chaperones are a diverse family of proteins that function to protect proteins in the intracellular milieu from irreversible aggregation during synthesis and in times of cellular stress Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>PF01556 CTDII: DnaJ C terminal domain; InterPro: IPR002939 Molecular chaperones are a diverse family of proteins that function to protect proteins in the intracellular milieu from irreversible aggregation during synthesis and in times of cellular stress Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PLN03165 chaperone protein dnaJ-related; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02642 phage_xxxx uncharacterized phage protein Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>KOG2813 consensus Predicted molecular chaperone, contains DnaJ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03165 chaperone protein dnaJ-related; Provisional Back     alignment and domain information
>COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2813 consensus Predicted molecular chaperone, contains DnaJ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02642 phage_xxxx uncharacterized phage protein Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11833 DUF3353: Protein of unknown function (DUF3353); InterPro: IPR021788 This family of proteins are functionally uncharacterised Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs Back     alignment and domain information
>KOG2824 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13446 RPT: A repeated domain in UCH-protein Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00709 Zpr1 Duplicated domain in the epidermal growth factor- and elongation factor-1alpha-binding protein Zpr1 Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query315
1nlt_A248 The Crystal Structure Of Hsp40 Ydj1 Length = 248 2e-41
3agz_A190 Crystal Structure Of Human Hsp40 Hdj1 Peptide-Bindi 2e-16
3agx_A181 Crystal Structure Of Human Hsp40 Hdj1 Peptide-Bindi 3e-16
2qld_A183 Human Hsp40 Hdj1 Length = 183 3e-16
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 1e-14
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 4e-14
2q2g_A180 Crystal Structure Of Dimerization Domain Of Hsp40 F 3e-13
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 1e-12
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 1e-12
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 7e-12
1c3g_A170 S. Cerevisiae Heat Shock Protein 40 Sis1 Length = 1 2e-11
2b26_A173 The Crystal Structure Of The Protein Complex Of Yea 2e-11
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 5e-11
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 6e-11
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 2e-10
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 1e-09
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 1e-09
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 1e-09
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 2e-09
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 2e-09
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 1e-08
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 2e-08
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 4e-06
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 6e-06
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 8e-06
1xao_A121 Hsp40-Ydj1 Dimerization Domain Length = 121 2e-05
3lz8_A329 Structure Of A Putative Chaperone Dnaj From Klebsie 2e-05
2y4t_A450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 8e-04
2y4u_A450 Crystal Structure Of Human P58(Ipk) In Space Group 8e-04
>pdb|1NLT|A Chain A, The Crystal Structure Of Hsp40 Ydj1 Length = 248 Back     alignment and structure 
Iteration: 1

 Score =  166 bits (420), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 81/194 (41%), Positives = 117/194 (60%), Gaps = 1/194 (0%)
Query: 104 EDVIHPLKVSLEDLYNGTSKKLSLSRNVIXXXXXXXXXXXXXXXXXXXXQGSGMKVSIRH 163
           +D+ H +  SLE+LY G + KL+L++ ++                     G G+K   R 
Sbjct: 12  KDIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVKKCTSCNGQGIKFVTRQ 71
Query: 164 LGPSMIQQMQHPCNECKGTGETINDKDRCPQCKGEKVIQEKKVLEVIVEKGMQNGQKITF 223
           +GP MIQ+ Q  C+ C GTG+ I+ KDRC  C G+KV  E+K+LEV VE GM++GQ+I F
Sbjct: 72  MGP-MIQRFQTECDVCHGTGDIIDPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRIVF 130
Query: 224 PGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQ 283
            GEAD+APD + GD+VF++ ++ H  FKR GDDL  E  + L  A+ G +F + H+ G  
Sbjct: 131 KGEADQAPDVIPGDVVFIVSERPHKSFKRDGDDLVYEAEIDLLTAIAGGEFALEHVSGDW 190
Query: 284 LLIKSQPGEVVKPG 297
           L +   PGEV+ PG
Sbjct: 191 LKVGIVPGEVIAPG 204
>pdb|3AGZ|A Chain A, Crystal Structure Of Human Hsp40 Hdj1 Peptide-Binding Domain Complexed With A C-Terminal Peptide Of Hsp70 Length = 190 Back     alignment and structure
>pdb|3AGX|A Chain A, Crystal Structure Of Human Hsp40 Hdj1 Peptide-Binding Domain Length = 181 Back     alignment and structure
>pdb|2QLD|A Chain A, Human Hsp40 Hdj1 Length = 183 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|2Q2G|A Chain A, Crystal Structure Of Dimerization Domain Of Hsp40 From Cryptosporidium Parvum, Cgd2_1800 Length = 180 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|1C3G|A Chain A, S. Cerevisiae Heat Shock Protein 40 Sis1 Length = 170 Back     alignment and structure
>pdb|2B26|A Chain A, The Crystal Structure Of The Protein Complex Of Yeast Hsp40 Sis1 And Hsp70 Ssa1 Length = 173 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|1XAO|A Chain A, Hsp40-Ydj1 Dimerization Domain Length = 121 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure
>pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query315
1nlt_A248 Protein YDJ1, mitochondrial protein import protein 1e-113
3agx_A181 DNAJ homolog subfamily B member 1; chaperone; 1.85 3e-61
3agx_A181 DNAJ homolog subfamily B member 1; chaperone; 1.85 2e-06
2q2g_A180 HSP40 protein, heat shock 40 kDa protein, putative 4e-55
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 2e-53
1c3g_A170 Heat shock protein 40; beta sheets, short helices, 7e-50
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 6e-35
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 1e-34
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 2e-33
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 1e-32
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 6e-32
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 3e-31
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 2e-30
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 2e-30
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 9e-30
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 1e-29
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 1e-29
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 2e-28
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 5e-28
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 8e-28
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 9e-28
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 1e-27
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 2e-27
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 1e-25
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 2e-24
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 5e-24
1xao_A121 YDJ1, mitochondrial protein import protein MAS5; b 2e-23
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 7e-21
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 7e-21
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 4e-20
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 9e-19
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 1e-18
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 3e-18
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 1e-14
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zin 2e-13
2guz_A71 Mitochondrial import inner membrane translocase su 3e-13
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 3e-12
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 1e-10
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 1e-10
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 1e-07
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 4e-07
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Length = 248 Back     alignment and structure
 Score =  326 bits (838), Expect = e-113
 Identities = 96/207 (46%), Positives = 138/207 (66%), Gaps = 1/207 (0%)

Query: 93  GSSRGRRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNVICTKCKGKGSKSGASMKCSGC 152
           G+ R R  +RG+D+ H +  SLE+LY G + KL+L++ ++C +C+G+G K GA  KC+ C
Sbjct: 1   GAQRPRGPQRGKDIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVKKCTSC 60

Query: 153 QGSGMKVSIRHLGPSMIQQMQHPCNECKGTGETINDKDRCPQCKGEKVIQEKKVLEVIVE 212
            G G+K   R +GP MIQ+ Q  C+ C GTG+ I+ KDRC  C G+KV  E+K+LEV VE
Sbjct: 61  NGQGIKFVTRQMGP-MIQRFQTECDVCHGTGDIIDPKDRCKSCNGKKVENERKILEVHVE 119

Query: 213 KGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGF 272
            GM++GQ+I F GEAD+APD + GD+VF++ ++ H  FKR GDDL  E  + L  A+ G 
Sbjct: 120 PGMKDGQRIVFKGEADQAPDVIPGDVVFIVSERPHKSFKRDGDDLVYEAEIDLLTAIAGG 179

Query: 273 QFVITHLDGRQLLIKSQPGEVVKPGKY 299
           +F + H+ G  L +   PGEV+ PG  
Sbjct: 180 EFALEHVSGDWLKVGIVPGEVIAPGMR 206
>3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Length = 181 Back     alignment and structure
>3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Length = 181 Back     alignment and structure
>2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Length = 180 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Length = 170 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} Length = 121 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Length = 79 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query315
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 100.0
1nlt_A248 Protein YDJ1, mitochondrial protein import protein 100.0
3agx_A181 DNAJ homolog subfamily B member 1; chaperone; 1.85 100.0
2q2g_A180 HSP40 protein, heat shock 40 kDa protein, putative 100.0
1c3g_A170 Heat shock protein 40; beta sheets, short helices, 99.97
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.85
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.82
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.81
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.81
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.8
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.8
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 99.8
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.79
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.79
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.78
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.78
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.77
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.76
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.76
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.75
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.73
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.73
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.73
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.72
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.71
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.7
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.68
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.66
2guz_A71 Mitochondrial import inner membrane translocase su 99.65
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.63
1xao_A121 YDJ1, mitochondrial protein import protein MAS5; b 99.58
1nlt_A248 Protein YDJ1, mitochondrial protein import protein 99.57
3i38_A109 Putative chaperone DNAJ; structural genomics, prot 99.57
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.57
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.57
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.56
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.55
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.53
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.52
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.49
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zin 99.46
3i38_A109 Putative chaperone DNAJ; structural genomics, prot 99.13
2guz_B65 Mitochondrial import inner membrane translocase su 99.04
1xao_A121 YDJ1, mitochondrial protein import protein MAS5; b 99.01
3agx_A181 DNAJ homolog subfamily B member 1; chaperone; 1.85 98.75
2q2g_A180 HSP40 protein, heat shock 40 kDa protein, putative 98.71
1c3g_A170 Heat shock protein 40; beta sheets, short helices, 98.7
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 98.6
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 98.54
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zin 98.29
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 98.28
3lcz_A53 YCZA, inhibitor of trap, regulated by T-box (Trp) 97.71
3lcz_A53 YCZA, inhibitor of trap, regulated by T-box (Trp) 97.51
2bx9_A53 Anti-trap, AT, tryptophan RNA-binding attenuator p 97.38
3pmq_A 669 Decaheme cytochrome C MTRF; greek KEY, C type cyto 97.34
2bx9_A53 Anti-trap, AT, tryptophan RNA-binding attenuator p 96.9
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 95.29
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
Probab=100.00  E-value=1.5e-55  Score=410.97  Aligned_cols=242  Identities=28%  Similarity=0.406  Sum_probs=127.6

Q ss_pred             CeeeCCCCCCCHHHHHHHHHHHHHHhCCCCCCCH---HHHHHHHHHHhhcCCCccccccccccccccccccCC-----CC
Q 021275            1 MRFSESRKNASQDDLKKAYRKAAIKNHPDKGGDP---EKFKELAQAYEVLSDPEKREIYDQYGEDALKEGMGG-----GG   72 (315)
Q Consensus         1 y~vLgv~~~a~~~~ik~ayr~la~~~hPd~~~~~---~~f~~i~~Ay~~L~d~~~R~~YD~~g~~~~~~g~~~-----~~   72 (315)
                      |+||||+++||.+|||+|||+||++||||+++++   ++|++|++||++|+||.+|+.||+|+......++.+     ++
T Consensus        31 Y~vLgv~~~as~~eIk~aYr~la~~~HPDk~~~~~a~~~f~~i~~Ay~vL~d~~~R~~YD~~~~~~~~~~~~~~~~~~~~  110 (329)
T 3lz8_A           31 YAILGVQPTDDLKTIKTAYRRLARKYHPDVSKENDAEAKFKDLAEAWEVLKDEQRRAEYDQLWQHRNDPGFGRQRQTHEQ  110 (329)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             HHHcCcCCCCCHHHHHHHHHHHHHHHCCCCCCChHHHHHHHHHHHHHHHhhhhhhhcccchhhccccCCCcccccccccC
Confidence            8999999999999999999999999999998754   799999999999999999999999854432111110     01


Q ss_pred             --CCCCCcccccCcccCCCCCCCCCCCCCcCCCcceeeeeeeeeeccccceeeEeeceeeEEccCCCCCCcccCCceecC
Q 021275           73 --GAHDPFDIFQSFFGGSPFGGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNVICTKCKGKGSKSGASMKCS  150 (315)
Q Consensus        73 --~~~~~~~~F~~~Fgg~~~~~~~~~~~~~~~~~d~~~~~~~~l~e~~~G~~~~~~~~~~~~C~~C~G~G~~~~~~~~C~  150 (315)
                        +..+|.|+|++|||++++++   +.+.+.++.|+.+.+.|+|+|+|.|+++++.+.+.+.|    |            
T Consensus       111 ~f~~~~f~diF~~~Fg~~g~~~---~~~~~~~g~Dl~~~l~vsleea~~G~~k~i~i~~~v~~----g------------  171 (329)
T 3lz8_A          111 SYSQQDFDDIFSSMFGQQAHQR---RRQHAARGHDLEIEVAVFLEETLAEQTRTISYNLPVYN----V------------  171 (329)
T ss_dssp             -----------------------------CCCCCCEEEEECCCTTGGGSCEEEEEEEEEEECC----S------------
T ss_pred             CcCCCchhhhhHhhhcCcCCCC---CCCCcCCCCCEEEEEecchhhhhhccceEEEEEEEeec----C------------
Confidence              12357789999998532211   11234678999999999999999999999988865422    1            


Q ss_pred             CCcCCceEEEEEecCCcceeEeeeeCCCCCCCceEeCCCCCCCccCCceEEEEeEEEEEEecccccCCcEEEEcCCcCCC
Q 021275          151 GCQGSGMKVSIRHLGPSMIQQMQHPCNECKGTGETINDKDRCPQCKGEKVIQEKKVLEVIVEKGMQNGQKITFPGEADEA  230 (315)
Q Consensus       151 ~C~G~G~~~~~~~~~~g~~~~~~~~C~~C~G~G~~~~~~~~C~~C~G~g~~~~~~~~~v~Ip~G~~~G~~i~l~g~G~~~  230 (315)
                          .|                           .+              .+...++++|+||||+++|++|+|+|+|++.
T Consensus       172 ----~G---------------------------~v--------------~~~~~~~l~V~IP~Gv~~G~~Irl~G~G~~g  206 (329)
T 3lz8_A          172 ----FG---------------------------MI--------------ESETPKTLNVKIPAGVVDGQRIRLKGQGTPG  206 (329)
T ss_dssp             ----CC----------------------------C--------------CEEEEEEEEEEECTTCCTTCEEEESSCSCCC
T ss_pred             ----Ce---------------------------EE--------------EEecceEEEEeCCCCCCCCCEEEEcccccCC
Confidence                12                           11              1223568999999999999999999999987


Q ss_pred             -CCCCccCEEEEEEEecCCCcEEeCCcEEEEEecCHHHHhCCCEEEEeCCCCCeEEEecCCCceeeCCcEEEEeCCCCcc
Q 021275          231 -PDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPGKYNWMDVSLNLS  309 (315)
Q Consensus       231 -~~~~~GDL~v~i~v~~~~~f~r~g~dL~~~~~I~l~~al~G~~~~v~tldG~~~~i~~~~~~v~~pg~~~~i~~~~~~~  309 (315)
                       .++.+|||||+|+|+||+.|+|+|+||+++++|+|+|||+|++++|+||||+ +.|+||++  ++||++++|+|+|-+.
T Consensus       207 ~~gg~~GDL~v~I~v~~h~~F~R~G~DL~~~~~Isl~eAllG~~v~VptLdG~-v~l~ip~g--t~~g~~~rl~G~GmP~  283 (329)
T 3lz8_A          207 ENGGPNGDLWLVIHIAPHPLFDIVGHNLEIVLPLAPWEAALGAKVTVPTLKES-ILLTVPPG--SQAGQRLRIKGKGLVS  283 (329)
T ss_dssp             ---CCCCCEEEEECCCCCSSCEEETTEEEEEEEECHHHHHHCEEEEECCSSSC-EEEEECTT--CCTTCEEEETTCSCBC
T ss_pred             CCCCCCCcEEEEEEEecCCccEEcCCcEEEEEECCHHHHcCCCeEEEECCCCC-EEEEECCC--CCCCCEEEEcCCCCCC
Confidence             4678999999999999999999999999999999999999999999999997 79999998  8999999999999874
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Back     alignment and structure
>2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Back     alignment and structure
>3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} Back     alignment and structure
>3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Back     alignment and structure
>2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Back     alignment and structure
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A Back     alignment and structure
>3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A Back     alignment and structure
>2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* Back     alignment and structure
>3pmq_A Decaheme cytochrome C MTRF; greek KEY, C type cytochrome, outer membrane, electron trans; HET: HEC; 3.20A {Shewanella oneidensis} Back     alignment and structure
>2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 315
d1nlta374 g.54.1.1 (A:139-212) Mitochondrial protein import 2e-23
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 4e-16
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 2e-14
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 1e-13
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 1e-13
d1exka_79 g.54.1.1 (A:) Cysteine-rich domain of the chaperon 9e-13
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 2e-12
d1c3ga180 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Ba 2e-11
d1c3ga180 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Ba 0.001
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 3e-11
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 4e-11
d1nlta280 b.4.1.1 (A:258-337) Mitochondrial protein import p 1e-10
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 1e-10
d1nlta174 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protei 2e-09
d1c3ga290 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Ba 7e-08
d1m1qa_90 a.138.1.3 (A:) Flavocytochrome c3 (respiratory fum 7e-07
>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 74 Back     information, alignment and structure

class: Small proteins
fold: DnaJ/Hsp40 cysteine-rich domain
superfamily: DnaJ/Hsp40 cysteine-rich domain
family: DnaJ/Hsp40 cysteine-rich domain
domain: Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 89.4 bits (221), Expect = 2e-23
 Identities = 35/75 (46%), Positives = 49/75 (65%), Gaps = 1/75 (1%)

Query: 129 RNVICTKCKGKGSKSGASMKCSGCQGSGMKVSIRHLGPSMIQQMQHPCNECKGTGETIND 188
           + ++C +C+G+G K GA  KC+ C G G+K   R +GP MIQ+ Q  C+ C GTG+ I+ 
Sbjct: 1   KQILCKECEGRGGKKGAVKKCTSCNGQGIKFVTRQMGP-MIQRFQTECDVCHGTGDIIDP 59

Query: 189 KDRCPQCKGEKVIQE 203
           KDRC  C G+KV  E
Sbjct: 60  KDRCKSCNGKKVENE 74
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Length = 79 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure
>d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 80 Back     information, alignment and structure
>d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 80 Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 80 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 74 Back     information, alignment and structure
>d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 90 Back     information, alignment and structure
>d1m1qa_ a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]} Length = 90 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query315
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.86
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.81
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.75
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.73
d1nlta174 Mitochondrial protein import protein mas5 (Hsp40, 99.66
d1nlta374 Mitochondrial protein import protein mas5 (Hsp40, 99.64
d1c3ga180 Heat shock protein 40 Sis1 {Baker's yeast (Sacchar 99.63
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.61
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.6
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.6
d1exka_79 Cysteine-rich domain of the chaperone protein DnaJ 99.52
d1nlta280 Mitochondrial protein import protein mas5 (Hsp40, 99.48
d1c3ga290 Heat shock protein 40 Sis1 {Baker's yeast (Sacchar 99.46
d1c3ga290 Heat shock protein 40 Sis1 {Baker's yeast (Sacchar 98.99
d1nlta280 Mitochondrial protein import protein mas5 (Hsp40, 98.89
d1nlta174 Mitochondrial protein import protein mas5 (Hsp40, 98.52
d1exka_79 Cysteine-rich domain of the chaperone protein DnaJ 98.4
d1nlta374 Mitochondrial protein import protein mas5 (Hsp40, 97.82
d1c3ga180 Heat shock protein 40 Sis1 {Baker's yeast (Sacchar 97.39
d1m1qa_90 Flavocytochrome c3 (respiratory fumarate reductase 96.47
d1m1qa_90 Flavocytochrome c3 (respiratory fumarate reductase 92.88
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.86  E-value=4.2e-23  Score=149.74  Aligned_cols=64  Identities=44%  Similarity=0.775  Sum_probs=60.2

Q ss_pred             CeeeCCCCCCCHHHHHHHHHHHHHHhCCCCCCCH----HHHHHHHHHHhhcCCCcccccccccccccc
Q 021275            1 MRFSESRKNASQDDLKKAYRKAAIKNHPDKGGDP----EKFKELAQAYEVLSDPEKREIYDQYGEDAL   64 (315)
Q Consensus         1 y~vLgv~~~a~~~~ik~ayr~la~~~hPd~~~~~----~~f~~i~~Ay~~L~d~~~R~~YD~~g~~~~   64 (315)
                      |+||||+++||.+|||+|||+|+++||||+++++    ++|++|++||+||+||.+|+.||+||+.++
T Consensus         6 Y~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~~   73 (75)
T d1xbla_           6 YEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAF   73 (75)
T ss_dssp             TTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTSSC
T ss_pred             HHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCcccc
Confidence            8999999999999999999999999999998753    689999999999999999999999998765
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m1qa_ a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d1m1qa_ a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure