Citrus Sinensis ID: 021510


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-
MVGCDAFPLLQSLILHNLINMERLCIDRLKVESFNQLKNIEAYNCDKLSNIFWFSTTKCLPRLERIAVINCSKMKEIFSIGEEVDNAIEKIEFAQLRSLSLGNLPEVTSFCCEVETPSASPNRQVSQEESTAMYCSSEITLDISTLLFNEKVALPNLEVLEISEINVDQIWHYNHLPVTFPRFQNLTRLIVWHCHKLKYIFSASMIRSLKQLQRLEICSCEDLQEIISENRTDQVIPYFVFPQLTTLKLQDLPKLRCLYPGMHSSEWPALEILLVYGCDKLKIFAADLSQNNENDQLGIPAQQLPLPLGKV
cccccccccccEEEEEcccccEEcccccccccccccccEEEEEcccccccccccccccccccccEEEEEEcccccEEEEccccccccccEEEcccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccEEcccccccccccccccccEEEEEcccccccccccHHHcccccccEEEEEcccccccccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccc
cccccccHcHHEEEEcccHcHHHHHccccccEEcccccEEEEcccHHHHHHccccHHHHcccccEEEEEccccHHHEEcccccccccccEEEccccccEEcccccccEEEccccccccccccccccccEEEEEccccEEEEEccccccccccccccccEEEEEccccEEEccccccccccccccccEEEEEEcccccHHcccHHHHHHHHHHcEEEEcccHHHHHHEcccccccccccEEcccccEEEEcccccccEcccccccccccccEEEEEEcccccEEEcccccccccccccccccHccccccccc
mvgcdafpLLQSLILHNLINMERLCIDRLKvesfnqlknieayncdklsnifwfsttkclprlerIAVINCSKMKEIFSIGEEVDNAIEKIEFAQLRSlslgnlpevtsfccevetpsaspnrqvsqeestamycsSEITLDISTLLfnekvalpnlevleiseinvdqiwhynhlpvtfprfqNLTRLIVWHCHKLKYIFSASMIRSLKQLQRLEICSCEDLQEIIsenrtdqvipyfvfpqlttlklqdlpklrclypgmhssewpALEILLVYGCDKLKIFAADLsqnnendqlgipaqqlplplgkv
MVGCDAFPLLQSLILHNLINMERLCIDRLKVESFNQLKNIeayncdklsniFWFSTTKCLPRLERIAVINCSKMKEIFSIGEEVDNAIEKIEFAQLRSLSLGNLPEVTSFCCEVEtpsaspnrqvsqEESTAMYCSSEITLDISTLLFNEKVALPNLEVLEISEINVDQIWHYNHLPVTFPRFQNLTRLIVWHCHKLKYIFSASMIRSLKQLQRLEICSCEDLQEIIsenrtdqviPYFVFPQLTTLKLQDLPKLRCLYPGMHSSEWPALEILLVYGCDKLKIFAADLSQNNEndqlgipaqqlplplgkv
MVGCDAFPLLQSLILHNLINMERLCIDRLKVESFNQLKNIEAYNCDKLSNIFWFSTTKCLPRLERIAVINCSKMKEIFSIGEEVDNAIEKIEFAQLRSLSLGNLPEVTSFCCEVETPSASPNRQVSQEESTAMYCSSEITLDISTLLFNEKVALPNLEVLEISEINVDQIWHYNHLPVTFPRFQNLTRLIVWHCHKLKYIFSASMIRSLKQLQRLEICSCEDLQEIISENRTDQVIPYFVFPQLTTLKLQDLPKLRCLYPGMHSSEWPALEILLVYGCDKLKIFAADLSQNNENDQLGIPAQQLPLPLGKV
**GCDAFPLLQSLILHNLINMERLCIDRLKVESFNQLKNIEAYNCDKLSNIFWFSTTKCLPRLERIAVINCSKMKEIFSIGEEVDNAIEKIEFAQLRSLSLGNLPEVTSFCCEV******************MYCSSEITLDISTLLFNEKVALPNLEVLEISEINVDQIWHYNHLPVTFPRFQNLTRLIVWHCHKLKYIFSASMIRSLKQLQRLEICSCEDLQEIISENRTDQVIPYFVFPQLTTLKLQDLPKLRCLYPGMHSSEWPALEILLVYGCDKLKIFAADL***********************
MVGCDAFPLLQSLILHNLINMERLCIDRLKVESFNQLKNIEAYNCDKLSNIFWFSTTKCLPRLERIAVINCSKMKEIFSIGEEVDNAIEKIEFAQLRSLSLGNLPEVTSFCCEVETPSASPNRQVSQEESTAMYCSSEITLDISTLLFNEKVALPNLEVLEISEINVDQIWHYNHLPVTFPRFQNLTRLIVWHCHKLKYIFSASMIRSLKQLQRLEICSCEDLQE**************VFPQLTTLKLQDLPKLRCLYPGMHSSEWPALEILLVYGCDKLKI*******************QLPLPLGKV
MVGCDAFPLLQSLILHNLINMERLCIDRLKVESFNQLKNIEAYNCDKLSNIFWFSTTKCLPRLERIAVINCSKMKEIFSIGEEVDNAIEKIEFAQLRSLSLGNLPEVTSFCCEV******************MYCSSEITLDISTLLFNEKVALPNLEVLEISEINVDQIWHYNHLPVTFPRFQNLTRLIVWHCHKLKYIFSASMIRSLKQLQRLEICSCEDLQEIISENRTDQVIPYFVFPQLTTLKLQDLPKLRCLYPGMHSSEWPALEILLVYGCDKLKIFAADLSQNNENDQLGIPAQQLPLPLGKV
MVGCDAFPLLQSLILHNLINMERLCIDRLKVESFNQLKNIEAYNCDKLSNIFWFSTTKCLPRLERIAVINCSKMKEIFSIGEEVDNAIEKIEFAQLRSLSLGNLPEVTSFCCEVETPSASPNRQVSQEESTAMYCSSEITLDISTLLFNEKVALPNLEVLEISEINVDQIWHYNHLPVTFPRFQNLTRLIVWHCHKLKYIFSASMIRSLKQLQRLEICSCEDLQEIISENRTDQVIPYFVFPQLTTLKLQDLPKLRCLYPGMHSSEWPALEILLVYGCDKLKIFAADLSQ****DQLGIPAQQLPLPLG**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGCDAFPLLQSLILHNLINMERLCIDRLKVESFNQLKNIEAYNCDKLSNIFWFSTTKCLPRLERIAVINCSKMKEIFSIGEEVDNAIEKIEFAQLRSLSLGNLPEVTSFCCEVETPSASPNRQVSQEESTAMYCSSEITLDISTLLFNEKVALPNLEVLEISEINVDQIWHYNHLPVTFPRFQNLTRLIVWHCHKLKYIFSASMIRSLKQLQRLEICSCEDLQEIISENRTDQVIPYFVFPQLTTLKLQDLPKLRCLYPGMHSSEWPALEILLVYGCDKLKIFAADLSQNNENDQLGIPAQQLPLPLGKV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query311 2.2.26 [Sep-21-2011]
Q42484909 Disease resistance protei yes no 0.389 0.133 0.307 2e-08
O81825919 Probable disease resistan no no 0.395 0.133 0.330 4e-05
O64973889 Disease resistance protei no no 0.398 0.139 0.282 0.0004
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function desciption
 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 77/130 (59%), Gaps = 9/130 (6%)

Query: 154 LPNLEVLEISEI-NVDQIWHYNHLPVTFPRFQNLTRLIVWHCHKLKYIFSASMIRSLKQL 212
           LP+LEVL +  + N+ ++W  +   V+    +N+  + + HC+KLK +   S ++ L +L
Sbjct: 744 LPSLEVLTLHSLHNLTRVWGNS---VSQDCLRNIRCINISHCNKLKNV---SWVQKLPKL 797

Query: 213 QRLEICSCEDLQEIISENRTDQVIPYFVFPQLTTLKLQDLPKLRCLYPGMHSSEWPALEI 272
           + +E+  C +++E+ISE+ +  V    +FP L TL+ +DLP+L  + P   S  +  +E 
Sbjct: 798 EVIELFDCREIEELISEHESPSVEDPTLFPSLKTLRTRDLPELNSILPSRFS--FQKVET 855

Query: 273 LLVYGCDKLK 282
           L++  C ++K
Sbjct: 856 LVITNCPRVK 865




Disease resistance (R) protein that specifically recognizes the AvrRpt2 type III effector avirulence protein from Pseudomonas syringae. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via an indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth. Acts via its interaction with RIN4, and probably triggers the plant resistance when RIN4 is degraded by AvrRpt2.
Arabidopsis thaliana (taxid: 3702)
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function description
>sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query311
224110992 2359 cc-nbs-lrr resistance protein [Populus t 0.929 0.122 0.386 9e-44
296087872 1152 unnamed protein product [Vitis vinifera] 0.887 0.239 0.328 4e-38
353685492 2756 Rpp4C3 [Phaseolus vulgaris] 0.839 0.094 0.393 5e-38
224111296 1315 cc-nbs-lrr resistance protein [Populus t 0.884 0.209 0.377 9e-38
224111284 1340 cc-nbs-lrr resistance protein [Populus t 0.858 0.199 0.382 3e-37
255563252 1603 Disease resistance protein RPS5, putativ 0.903 0.175 0.333 4e-35
224083434 1144 cc-nbs-lrr resistance protein [Populus t 0.813 0.221 0.388 3e-34
353685480 2629 Rpp4C4 [Phaseolus vulgaris] 0.858 0.101 0.388 3e-34
224143316 1337 cc-nbs-lrr resistance protein [Populus t 0.858 0.199 0.364 2e-33
353685494 2654 Rpp4C1 [Phaseolus vulgaris] 0.868 0.101 0.366 6e-33
>gi|224110992|ref|XP_002332999.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834484|gb|EEE72961.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  183 bits (464), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 118/305 (38%), Positives = 179/305 (58%), Gaps = 16/305 (5%)

Query: 1    MVGCDAFPLLQSLILHNLINMERLCIDRLKVESFNQLKNIEAYNCDKLSNIFWFSTTKCL 60
            MV  +AFP+L+SLIL++L +++++C   L+VESF +L+ I   +C+KL+N+F F   + L
Sbjct: 778  MVSSNAFPILESLILYDLSSLKKICHGALRVESFAKLRIIAVEHCNKLTNLFSFFVARGL 837

Query: 61   PRLERIAVINCSKMKEIFSIGEEVD------NAIEKIEFAQLRSLSLGNLPEVTSFCCEV 114
             +L++I +  C KM+E+  + EE D        ++ I+F QL SLSL  LP + +F  +V
Sbjct: 838  SQLQKIKIAFCMKMEEV--VAEESDELGDQNEVVDVIQFTQLYSLSLQYLPHLMNFYSKV 895

Query: 115  ETPSAS---PNRQVSQEESTAMYCSSEITLDISTLLFNEKVALPNLEVLEISEINVDQIW 171
            +  S S   P   +++  S  +   SE  L   T LFNEK+  PNLE L +  IN+D++W
Sbjct: 896  KPSSLSRTQPKPSITEARSEEII--SEDELRTPTQLFNEKILFPNLEDLNLYAINIDKLW 953

Query: 172  HYNHLPVTFPRFQNLTRLIVWHCHKLKYIFSASMIRSLKQLQRLEICSCEDLQEIIS-EN 230
            +  H P      QNL RL+V  C  LKY+F +S++  L QL+ L I +C  ++EII+   
Sbjct: 954  NDQH-PSISVSIQNLQRLVVNQCGSLKYLFPSSLVNILVQLKHLSITNCMSVEEIIAIGG 1012

Query: 231  RTDQVIPYFVFPQLTTLKLQDLPKLRCLYPGMHSSEWPALEILLVYGCDKLKIFAADLSQ 290
              ++     VFP+L  ++L DLPKLR    G  S E P L+ + +  C + K FAAD S 
Sbjct: 1013 LKEEETTSTVFPKLEFMELSDLPKLRRFCIG-SSIECPLLKRMRICACPEFKTFAADFSC 1071

Query: 291  NNEND 295
             N ND
Sbjct: 1072 ANIND 1076




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|296087872|emb|CBI35155.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|353685492|gb|AER13169.1| Rpp4C3 [Phaseolus vulgaris] Back     alignment and taxonomy information
>gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224111284|ref|XP_002332949.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834261|gb|EEE72738.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255563252|ref|XP_002522629.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223538105|gb|EEF39716.1| Disease resistance protein RPS5, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224083434|ref|XP_002307025.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222856474|gb|EEE94021.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|353685480|gb|AER13157.1| Rpp4C4 [Phaseolus vulgaris] Back     alignment and taxonomy information
>gi|224143316|ref|XP_002336027.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222838884|gb|EEE77235.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|353685494|gb|AER13171.1| Rpp4C1 [Phaseolus vulgaris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query311
TAIR|locus:2005517909 RPS2 "RESISTANT TO P. SYRINGAE 0.389 0.133 0.307 3.1e-10
TAIR|locus:2132741892 AT4G10780 [Arabidopsis thalian 0.678 0.236 0.274 1.6e-06
TAIR|locus:2131689919 AT4G27220 [Arabidopsis thalian 0.398 0.134 0.330 3.7e-06
TAIR|locus:2171589 948 AT5G47260 [Arabidopsis thalian 0.446 0.146 0.269 0.00017
TAIR|locus:2201996889 RPS5 "AT1G12220" [Arabidopsis 0.382 0.133 0.296 0.00035
TAIR|locus:2166320888 AT5G63020 [Arabidopsis thalian 0.681 0.238 0.228 0.00059
TAIR|locus:2094498 1981 AT3G25510 [Arabidopsis thalian 0.887 0.139 0.250 0.00069
TAIR|locus:2008510 967 AT1G61190 "AT1G61190" [Arabido 0.437 0.140 0.292 0.00071
TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 175 (66.7 bits), Expect = 3.1e-10, P = 3.1e-10
 Identities = 40/130 (30%), Positives = 77/130 (59%)

Query:   154 LPNLEVLEISEI-NVDQIWHYNHLPVTFPRFQNLTRLIVWHCHKLKYIFSASMIRSLKQL 212
             LP+LEVL +  + N+ ++W  +   V+    +N+  + + HC+KLK +   S ++ L +L
Sbjct:   744 LPSLEVLTLHSLHNLTRVWGNS---VSQDCLRNIRCINISHCNKLKNV---SWVQKLPKL 797

Query:   213 QRLEICSCEDLQEIISENRTDQVIPYFVFPQLTTLKLQDLPKLRCLYPGMHSSEWPALEI 272
             + +E+  C +++E+ISE+ +  V    +FP L TL+ +DLP+L  + P   S +   +E 
Sbjct:   798 EVIELFDCREIEELISEHESPSVEDPTLFPSLKTLRTRDLPELNSILPSRFSFQ--KVET 855

Query:   273 LLVYGCDKLK 282
             L++  C ++K
Sbjct:   856 LVITNCPRVK 865


GO:0000166 "nucleotide binding" evidence=IEA
GO:0006952 "defense response" evidence=ISS;TAS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
GO:0009626 "plant-type hypersensitive response" evidence=IMP
GO:0016045 "detection of bacterium" evidence=RCA;IMP
GO:0005515 "protein binding" evidence=IPI
GO:0005886 "plasma membrane" evidence=IDA
GO:0042742 "defense response to bacterium" evidence=RCA;IMP
GO:0000165 "MAPK cascade" evidence=RCA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009595 "detection of biotic stimulus" evidence=RCA
GO:0009617 "response to bacterium" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0009863 "salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0009963 "positive regulation of flavonoid biosynthetic process" evidence=RCA
GO:0010200 "response to chitin" evidence=RCA
GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0031347 "regulation of defense response" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0043069 "negative regulation of programmed cell death" evidence=RCA
GO:0043900 "regulation of multi-organism process" evidence=RCA
GO:0045087 "innate immune response" evidence=RCA
GO:0050776 "regulation of immune response" evidence=RCA
GO:0050832 "defense response to fungus" evidence=RCA
GO:0051707 "response to other organism" evidence=RCA
TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171589 AT5G47260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 311
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.74
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.7
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.55
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.49
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.14
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.08
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.95
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.92
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.85
KOG4341483 consensus F-box protein containing LRR [General fu 98.84
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.83
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.8
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.79
KOG4341483 consensus F-box protein containing LRR [General fu 98.71
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.69
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.69
KOG0472 565 consensus Leucine-rich repeat protein [Function un 98.66
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.5
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.47
KOG0617264 consensus Ras suppressor protein (contains leucine 98.47
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.46
KOG0472 565 consensus Leucine-rich repeat protein [Function un 98.45
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.44
KOG0617264 consensus Ras suppressor protein (contains leucine 98.35
PRK15386 426 type III secretion protein GogB; Provisional 98.26
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.2
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.17
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.16
KOG4237498 consensus Extracellular matrix protein slit, conta 98.14
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.05
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.02
PRK15386 426 type III secretion protein GogB; Provisional 98.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.94
KOG4237 498 consensus Extracellular matrix protein slit, conta 97.91
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.82
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.69
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.56
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.53
KOG1259490 consensus Nischarin, modulator of integrin alpha5 97.45
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.36
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 97.32
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.22
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 97.22
KOG1259490 consensus Nischarin, modulator of integrin alpha5 97.16
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 96.78
PLN03150623 hypothetical protein; Provisional 96.55
PLN03150623 hypothetical protein; Provisional 96.43
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.42
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.4
KOG2982 418 consensus Uncharacterized conserved protein [Funct 96.31
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.17
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.97
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 95.93
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.82
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.35
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.27
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 94.97
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 94.82
KOG2123388 consensus Uncharacterized conserved protein [Funct 93.92
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 93.88
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 93.79
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 93.44
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 93.29
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.5
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 92.11
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 92.1
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 91.97
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 90.66
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 88.28
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 87.18
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 84.28
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 80.94
>PLN03210 Resistant to P Back     alignment and domain information
Probab=99.74  E-value=1.8e-17  Score=168.25  Aligned_cols=253  Identities=18%  Similarity=0.264  Sum_probs=140.4

Q ss_pred             cCCcccEEeecccccccccccccccccCCCCccEEEEcCCCCCcccccchhhhccCcccEEEEccccccceecccccccc
Q 021510            6 AFPLLQSLILHNLINMERLCIDRLKVESFNQLKNIEAYNCDKLSNIFWFSTTKCLPRLERIAVINCSKMKEIFSIGEEVD   85 (311)
Q Consensus         6 ~l~~L~~L~L~~~~~l~~l~~~~~~~~~l~~L~~L~l~~c~~l~~~~~~~~~~~l~~L~~L~i~~c~~l~~~~~~~~~~~   85 (311)
                      .+++|+.|+|+++.+++.+    +.++.+++|++|++++|..+..+  |..++.+++|++|++++|..++.++.      
T Consensus       632 ~l~~Lk~L~Ls~~~~l~~i----p~ls~l~~Le~L~L~~c~~L~~l--p~si~~L~~L~~L~L~~c~~L~~Lp~------  699 (1153)
T PLN03210        632 SLTGLRNIDLRGSKNLKEI----PDLSMATNLETLKLSDCSSLVEL--PSSIQYLNKLEDLDMSRCENLEILPT------  699 (1153)
T ss_pred             cCCCCCEEECCCCCCcCcC----CccccCCcccEEEecCCCCcccc--chhhhccCCCCEEeCCCCCCcCccCC------
Confidence            3455555555555444442    23455566666666666666554  44556666666666666666665552      


Q ss_pred             cccceeeecccceEecCCCCCccccccCCCCCC----------CCC-Cccccccccccccccccccccc-cccccc-ccc
Q 021510           86 NAIEKIEFAQLRSLSLGNLPEVTSFCCEVETPS----------ASP-NRQVSQEESTAMYCSSEITLDI-STLLFN-EKV  152 (311)
Q Consensus        86 ~~~~~~~l~~L~~L~l~~~~~l~~l~~~~~~~~----------~~~-~~~~~~~~~l~l~~~~~~~~~~-~~~~~~-~~~  152 (311)
                         . ..+++|+.|.+++|..+..++.......          ..+ ......+..+.+.......... ..+... ...
T Consensus       700 ---~-i~l~sL~~L~Lsgc~~L~~~p~~~~nL~~L~L~~n~i~~lP~~~~l~~L~~L~l~~~~~~~l~~~~~~l~~~~~~  775 (1153)
T PLN03210        700 ---G-INLKSLYRLNLSGCSRLKSFPDISTNISWLDLDETAIEEFPSNLRLENLDELILCEMKSEKLWERVQPLTPLMTM  775 (1153)
T ss_pred             ---c-CCCCCCCEEeCCCCCCccccccccCCcCeeecCCCccccccccccccccccccccccchhhccccccccchhhhh
Confidence               1 1456667777776665554432110000          000 0000000000000000000000 000000 011


Q ss_pred             cCCCccEEEeeee-eceeeeccCCCCCCCCCCCcccEEEEecCCCCccccchHHHhccCCCcEEEEccccccceeccccc
Q 021510          153 ALPNLEVLEISEI-NVDQIWHYNHLPVTFPRFQNLTRLIVWHCHKLKYIFSASMIRSLKQLQRLEICSCEDLQEIISENR  231 (311)
Q Consensus       153 ~l~~L~~L~l~~~-~l~~i~~~~~~p~~~~~l~~L~~L~i~~c~~l~~~~~~~~~~~l~~L~~L~l~~c~~l~~~~~~~~  231 (311)
                      ..++|++|++++| .+..+      |..++++++|+.|++.+|..++.+ |..  .++++|++|++++|.++..++....
T Consensus       776 ~~~sL~~L~Ls~n~~l~~l------P~si~~L~~L~~L~Ls~C~~L~~L-P~~--~~L~sL~~L~Ls~c~~L~~~p~~~~  846 (1153)
T PLN03210        776 LSPSLTRLFLSDIPSLVEL------PSSIQNLHKLEHLEIENCINLETL-PTG--INLESLESLDLSGCSRLRTFPDIST  846 (1153)
T ss_pred             ccccchheeCCCCCCcccc------ChhhhCCCCCCEEECCCCCCcCee-CCC--CCccccCEEECCCCCcccccccccc
Confidence            2357777777777 44444      666778888888888888888876 543  2678888888888876654422100


Q ss_pred             ----------ccC--cCCcccCCccCeEecccCcccccccCCCcccCCCcccEEEEecCCCccccc
Q 021510          232 ----------TDQ--VIPYFVFPQLTTLKLQDLPKLRCLYPGMHSSEWPALEILLVYGCDKLKIFA  285 (311)
Q Consensus       232 ----------~~~--~~~~~~~~~L~~L~l~~c~~L~~l~~~~~~~~~~~L~~L~i~~c~~l~~lp  285 (311)
                                ...  ......+++|+.|++.+|++|+.++...  ..+++|+.+++.+|++++.++
T Consensus       847 nL~~L~Ls~n~i~~iP~si~~l~~L~~L~L~~C~~L~~l~~~~--~~L~~L~~L~l~~C~~L~~~~  910 (1153)
T PLN03210        847 NISDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNI--SKLKHLETVDFSDCGALTEAS  910 (1153)
T ss_pred             ccCEeECCCCCCccChHHHhcCCCCCEEECCCCCCcCccCccc--ccccCCCeeecCCCccccccc
Confidence                      000  0112348899999999999999988765  578999999999999987554



syringae 6; Provisional

>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query311
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 44.5 bits (104), Expect = 4e-05
 Identities = 45/295 (15%), Positives = 88/295 (29%), Gaps = 80/295 (27%)

Query: 50  NIFWFSTTKCLPRLERIAVIN--CSKMKEIFSIGEE-VDNAIEKIEFAQ--LRSL----- 99
            IFW +   C      + ++     ++   ++   +   N   +I   Q  LR L     
Sbjct: 183 KIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKP 242

Query: 100 ---SLGNLPEVTS--------FCCEV----------ETPSASPNRQVSQEESTAMYCSSE 138
               L  L  V +          C++          +  SA+    +S +  +      E
Sbjct: 243 YENCLLVLLNVQNAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDE 302

Query: 139 ITLDISTLLFNEKVA-LPNLEVLEISEINVDQIW-HYNHLPVTFPRFQNLTRLIVWHCHK 196
               +     + +   LP  EVL  +   +  I         T+  ++++       C K
Sbjct: 303 -VKSLLLKYLDCRPQDLPR-EVLTTNPRRLSIIAESIRDGLATWDNWKHVN------CDK 354

Query: 197 LKYIFSASMIRSLKQLQRLEICSC-EDLQEIISENRTDQVIPYFVFPQLTTLKLQDLPKL 255
           L  I  +    SL  L+  E     + L                VFP    +    L  +
Sbjct: 355 LTTIIES----SLNVLEPAEYRKMFDRL---------------SVFPPSAHIPTILLSLI 395

Query: 256 RCLYPGMHSSEWPALE----ILLVYGCDKLKIFAADLSQNNENDQLGIPAQQLPL 306
                      W  +     +++V    K  +    + +  +   + IP+  L L
Sbjct: 396 -----------WFDVIKSDVMVVVNKLHKYSL----VEKQPKESTISIPSIYLEL 435


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query311
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.82
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.76
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.65
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.65
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.64
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.63
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.62
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.62
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.62
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.61
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.61
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.61
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.61
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.6
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.59
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.59
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.58
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.58
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.58
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.58
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.58
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.57
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.57
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.57
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.57
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.57
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.57
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.56
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.56
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.56
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.56
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.56
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.56
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.56
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.55
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.55
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.55
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.54
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.53
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.53
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.53
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.52
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.51
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.51
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.51
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.5
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.5
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.5
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.49
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.49
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.48
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.48
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.48
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.48
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.46
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.46
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.45
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.44
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.44
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.44
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.43
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.43
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.43
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.43
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.43
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.42
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.41
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.39
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.39
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.39
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.38
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.38
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.38
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.37
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.35
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.35
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.33
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.33
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.33
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.32
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.3
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.3
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.29
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.29
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.28
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.27
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.27
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.26
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.25
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.22
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.22
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.21
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.18
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.17
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.16
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.13
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.06
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.03
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.03
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.03
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.02
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.0
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.99
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.98
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.98
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.98
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 98.98
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.96
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.95
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.95
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 98.93
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.92
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.9
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.87
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.85
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.83
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.82
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.8
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.77
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.76
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.64
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.63
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.62
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.6
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.57
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.55
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.52
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.47
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.44
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.42
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.38
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.35
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.26
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.25
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.22
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.18
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.17
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.15
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.13
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.12
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.91
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 97.89
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.82
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 97.75
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.75
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.53
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.06
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.57
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 96.52
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.44
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 95.87
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 95.49
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.02
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 94.25
4gt6_A394 Cell surface protein; leucine rich repeats, putati 92.26
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 90.25
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 80.29
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.82  E-value=1.9e-19  Score=158.46  Aligned_cols=235  Identities=20%  Similarity=0.274  Sum_probs=181.6

Q ss_pred             cCCcccEEeecccccccccccccccccCCCCccEEEEcCCCCCcccccchhhhccCcccEEEEccccccceecccccccc
Q 021510            6 AFPLLQSLILHNLINMERLCIDRLKVESFNQLKNIEAYNCDKLSNIFWFSTTKCLPRLERIAVINCSKMKEIFSIGEEVD   85 (311)
Q Consensus         6 ~l~~L~~L~L~~~~~l~~l~~~~~~~~~l~~L~~L~l~~c~~l~~~~~~~~~~~l~~L~~L~i~~c~~l~~~~~~~~~~~   85 (311)
                      .++++++|+++++. ++.+   +..++.+++|++|+++++. ++.+  +..++.+++|++|+++++. +..++.      
T Consensus        79 ~~~~l~~L~L~~n~-l~~l---p~~l~~l~~L~~L~L~~n~-l~~l--p~~~~~l~~L~~L~Ls~n~-l~~lp~------  144 (328)
T 4fcg_A           79 TQPGRVALELRSVP-LPQF---PDQAFRLSHLQHMTIDAAG-LMEL--PDTMQQFAGLETLTLARNP-LRALPA------  144 (328)
T ss_dssp             TSTTCCEEEEESSC-CSSC---CSCGGGGTTCSEEEEESSC-CCCC--CSCGGGGTTCSEEEEESCC-CCCCCG------
T ss_pred             cccceeEEEccCCC-chhc---ChhhhhCCCCCEEECCCCC-ccch--hHHHhccCCCCEEECCCCc-cccCcH------
Confidence            45889999999964 6665   4556889999999999974 5554  5667899999999999974 445542      


Q ss_pred             cccceeeecccceEecCCCCCccccccCCCCCCCCCCcccccccccccccccccccccccccccccccCCCccEEEeeee
Q 021510           86 NAIEKIEFAQLRSLSLGNLPEVTSFCCEVETPSASPNRQVSQEESTAMYCSSEITLDISTLLFNEKVALPNLEVLEISEI  165 (311)
Q Consensus        86 ~~~~~~~l~~L~~L~l~~~~~l~~l~~~~~~~~~~~~~~~~~~~~l~l~~~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~  165 (311)
                         .+..+++|++|++++|..++.++.....                            ......+..+++|++|++++|
T Consensus       145 ---~l~~l~~L~~L~L~~n~~~~~~p~~~~~----------------------------~~~~~~~~~l~~L~~L~L~~n  193 (328)
T 4fcg_A          145 ---SIASLNRLRELSIRACPELTELPEPLAS----------------------------TDASGEHQGLVNLQSLRLEWT  193 (328)
T ss_dssp             ---GGGGCTTCCEEEEEEETTCCCCCSCSEE----------------------------EC-CCCEEESTTCCEEEEEEE
T ss_pred             ---HHhcCcCCCEEECCCCCCccccChhHhh----------------------------ccchhhhccCCCCCEEECcCC
Confidence               4567899999999998777665542110                            000112344899999999999


Q ss_pred             eceeeeccCCCCCCCCCCCcccEEEEecCCCCccccchHHHhccCCCcEEEEccccccceecccccccCcCCcccCCccC
Q 021510          166 NVDQIWHYNHLPVTFPRFQNLTRLIVWHCHKLKYIFSASMIRSLKQLQRLEICSCEDLQEIISENRTDQVIPYFVFPQLT  245 (311)
Q Consensus       166 ~l~~i~~~~~~p~~~~~l~~L~~L~i~~c~~l~~~~~~~~~~~l~~L~~L~l~~c~~l~~~~~~~~~~~~~~~~~~~~L~  245 (311)
                      +++.+      |..+..+++|++|+++++ .+..+ +.. +..+++|++|++++|.....++.  ...      .+++|+
T Consensus       194 ~l~~l------p~~l~~l~~L~~L~L~~N-~l~~l-~~~-l~~l~~L~~L~Ls~n~~~~~~p~--~~~------~l~~L~  256 (328)
T 4fcg_A          194 GIRSL------PASIANLQNLKSLKIRNS-PLSAL-GPA-IHHLPKLEELDLRGCTALRNYPP--IFG------GRAPLK  256 (328)
T ss_dssp             CCCCC------CGGGGGCTTCCEEEEESS-CCCCC-CGG-GGGCTTCCEEECTTCTTCCBCCC--CTT------CCCCCC
T ss_pred             CcCcc------hHhhcCCCCCCEEEccCC-CCCcC-chh-hccCCCCCEEECcCCcchhhhHH--Hhc------CCCCCC
Confidence            88765      666788999999999996 45555 444 78899999999999985555432  222      289999


Q ss_pred             eEecccCcccccccCCCcccCCCcccEEEEecCCCccccccccccCCCCCccccccccc
Q 021510          246 TLKLQDLPKLRCLYPGMHSSEWPALEILLVYGCDKLKIFAADLSQNNENDQLGIPAQQL  304 (311)
Q Consensus       246 ~L~l~~c~~L~~l~~~~~~~~~~~L~~L~i~~c~~l~~lp~~~~~~~~~~~~~~~~~~~  304 (311)
                      .|++++|..++.++...  ..+++|++|++++|+.++.+|..+........+.+|.+.+
T Consensus       257 ~L~L~~n~~~~~~p~~~--~~l~~L~~L~L~~n~~~~~iP~~l~~L~~L~~l~l~~~~~  313 (328)
T 4fcg_A          257 RLILKDCSNLLTLPLDI--HRLTQLEKLDLRGCVNLSRLPSLIAQLPANCIILVPPHLQ  313 (328)
T ss_dssp             EEECTTCTTCCBCCTTG--GGCTTCCEEECTTCTTCCCCCGGGGGSCTTCEEECCGGGS
T ss_pred             EEECCCCCchhhcchhh--hcCCCCCEEeCCCCCchhhccHHHhhccCceEEeCCHHHH
Confidence            99999999999888765  6799999999999999999999999888888888876554



>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query311
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.5
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.48
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.46
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.44
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.38
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.38
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.38
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.35
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.35
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.35
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.35
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.34
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.33
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.32
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.31
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.29
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.28
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.21
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.21
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.2
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.93
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.8
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.76
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.76
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.7
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.66
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.61
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.55
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.54
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.37
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.16
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.07
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.75
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 96.7
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 95.98
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 95.64
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 95.52
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 95.25
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 92.64
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 88.81
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 85.41
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.50  E-value=9.2e-13  Score=112.19  Aligned_cols=230  Identities=17%  Similarity=0.146  Sum_probs=117.4

Q ss_pred             CCcccEEeecccccccccccccccccCCCCccEEEEcCCCCCcccccchhhhccCcccEEEEccccccceeccccccccc
Q 021510            7 FPLLQSLILHNLINMERLCIDRLKVESFNQLKNIEAYNCDKLSNIFWFSTTKCLPRLERIAVINCSKMKEIFSIGEEVDN   86 (311)
Q Consensus         7 l~~L~~L~L~~~~~l~~l~~~~~~~~~l~~L~~L~l~~c~~l~~~~~~~~~~~l~~L~~L~i~~c~~l~~~~~~~~~~~~   86 (311)
                      .+++++|+|+++ +++++..  ..+..+++|++|+++++... .+ ++..+..+++|++|+++++ .++.++.       
T Consensus        30 ~~~l~~L~Ls~N-~i~~l~~--~~f~~l~~L~~L~l~~n~~~-~i-~~~~f~~l~~L~~L~l~~n-~l~~l~~-------   96 (305)
T d1xkua_          30 PPDTALLDLQNN-KITEIKD--GDFKNLKNLHTLILINNKIS-KI-SPGAFAPLVKLERLYLSKN-QLKELPE-------   96 (305)
T ss_dssp             CTTCCEEECCSS-CCCCBCT--TTTTTCTTCCEEECCSSCCC-CB-CTTTTTTCTTCCEEECCSS-CCSBCCS-------
T ss_pred             CCCCCEEECcCC-cCCCcCh--hHhhcccccccccccccccc-cc-chhhhhCCCccCEecccCC-ccCcCcc-------
Confidence            366777777775 4665421  23566777777777776433 32 1344666777777777775 3444432       


Q ss_pred             ccceeeecccceEecCCCCCccccccCCCCCCCCCCcccccccccccccccccccccccccccccccCCCccEEEeeeee
Q 021510           87 AIEKIEFAQLRSLSLGNLPEVTSFCCEVETPSASPNRQVSQEESTAMYCSSEITLDISTLLFNEKVALPNLEVLEISEIN  166 (311)
Q Consensus        87 ~~~~~~l~~L~~L~l~~~~~l~~l~~~~~~~~~~~~~~~~~~~~l~l~~~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~  166 (311)
                          ..++.++.|.+.+. .+..++........       ....+....   ............+..+++|+.+++.+|+
T Consensus        97 ----~~~~~l~~L~~~~n-~l~~l~~~~~~~~~-------~~~~l~~~~---n~~~~~~~~~~~~~~l~~L~~l~l~~n~  161 (305)
T d1xkua_          97 ----KMPKTLQELRVHEN-EITKVRKSVFNGLN-------QMIVVELGT---NPLKSSGIENGAFQGMKKLSYIRIADTN  161 (305)
T ss_dssp             ----SCCTTCCEEECCSS-CCCBBCHHHHTTCT-------TCCEEECCS---SCCCGGGBCTTGGGGCTTCCEEECCSSC
T ss_pred             ----chhhhhhhhhcccc-chhhhhhhhhhccc-------ccccccccc---ccccccCCCccccccccccCccccccCC
Confidence                12345555555543 22222211000000       000000000   0000000011123446677777777776


Q ss_pred             ceeeeccCCCCCCCCCCCcccEEEEecCCCCccccchHHHhccCCCcEEEEccccccceecccccccCcCCcccCCccCe
Q 021510          167 VDQIWHYNHLPVTFPRFQNLTRLIVWHCHKLKYIFSASMIRSLKQLQRLEICSCEDLQEIISENRTDQVIPYFVFPQLTT  246 (311)
Q Consensus       167 l~~i~~~~~~p~~~~~l~~L~~L~i~~c~~l~~~~~~~~~~~l~~L~~L~l~~c~~l~~~~~~~~~~~~~~~~~~~~L~~  246 (311)
                      +..+      |..  .+++|+.|++.++...... + ..+..++.+++|+++++. ++.+... .      +..+++|++
T Consensus       162 l~~l------~~~--~~~~L~~L~l~~n~~~~~~-~-~~~~~~~~l~~L~~s~n~-l~~~~~~-~------~~~l~~L~~  223 (305)
T d1xkua_         162 ITTI------PQG--LPPSLTELHLDGNKITKVD-A-ASLKGLNNLAKLGLSFNS-ISAVDNG-S------LANTPHLRE  223 (305)
T ss_dssp             CCSC------CSS--CCTTCSEEECTTSCCCEEC-T-GGGTTCTTCCEEECCSSC-CCEECTT-T------GGGSTTCCE
T ss_pred             cccc------Ccc--cCCccCEEECCCCcCCCCC-h-hHhhcccccccccccccc-ccccccc-c------cccccccee
Confidence            5544      221  3457777777765443322 3 235666777777777765 5555321 1      112677777


Q ss_pred             EecccCcccccccCCCcccCCCcccEEEEecCCCcccccc
Q 021510          247 LKLQDLPKLRCLYPGMHSSEWPALEILLVYGCDKLKIFAA  286 (311)
Q Consensus       247 L~l~~c~~L~~l~~~~~~~~~~~L~~L~i~~c~~l~~lp~  286 (311)
                      |+++++ ++++++.+.  ..+++|++|+++++ +++.++.
T Consensus       224 L~L~~N-~L~~lp~~l--~~l~~L~~L~Ls~N-~i~~i~~  259 (305)
T d1xkua_         224 LHLNNN-KLVKVPGGL--ADHKYIQVVYLHNN-NISAIGS  259 (305)
T ss_dssp             EECCSS-CCSSCCTTT--TTCSSCCEEECCSS-CCCCCCT
T ss_pred             eecccc-ccccccccc--ccccCCCEEECCCC-ccCccCh
Confidence            777775 566665543  45677777777775 4666543



>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure