Citrus Sinensis ID: 021588

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310
MSRSCSQCGNNGHNSRTCAEAGGGGSSGAGSEENGIMLFGVRVTEGSSSFRKSISMDNLSQFDQPQDSNADAGYASDDIVHASGRSRERKRGVPWTEDEHRLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLRRFNQNKRRRRSSLFDITASSTDTFMGSTMEEEQARHQETITVPLPQPQLNRHPGGFPVSAYPVKHSAVVLPFTGEKSMGNLTIGPSNKPRTSPKLIRPIPIHPVPPSSKLGGLNLNQKATHVDVDTLPLSLKLSTPSSSSDEQSAQTPHSSAAFQAMSSGDSNSIISVA
cccccccccccccccccccccccccccccccccccEEEEcEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccEEcc
cccccccccccccccccccccccccccccccccccEEEEEEEEEcccHHHHHcccccccHcccccccccccccccccccccccccHHHHcccccccHHHHHHHHHHHHHHccccccccccccEEcccHHHHHHHHHHHHHHHcccccHcccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEc
msrscsqcgnnghnsrtcaeaggggssgagseenGIMLFGVRVtegsssfrksismdnlsqfdqpqdsnadagyasddivhasgrsrerkrgvpwtedEHRLFLLGLqkvgkgdwrgisrnfvktrtptqvaSHAQKYFLRRFNQNKrrrrsslfditasstdtfmgsTMEEEQARHQetitvplpqpqlnrhpggfpvsaypvkhsavvlpftgeksmgnltigpsnkprtspklirpipihpvppssklgglnlnqkathvdvdtlplslklstpssssdeqsaqtphsSAAFQAmssgdsnsiisva
msrscsqcgnnghnsrtcaEAGGGGSSGAGSEENGIMLFGVRVTEGSSSFRKSISMDNLSQFDQPQDSNADAGYASDdivhasgrsrerkrgvpwtedehrLFLLglqkvgkgdwRGISRnfvktrtptqvashaqkyflrrfnqnkrrrrsslfditasstdtfmGSTMEEEQARHQETITVPLPQPQLNRHPGGFPVSAYPVKHSAVVLPFTGEKSMGNLTIGPSNKPRTSPKLIRPIPIHPVPPSSKLGGLNLNQKATHVDVDTLPLSLKLSTPSSSSDEQSAQTPHSSAAfqamssgdsnsiisva
MSRSCSQCGNNGHNSRTCaeaggggssgagseeNGIMLFGVRVTEGSSSFRKSISMDNLSQFDQPQDSNADAGYASDDIVHASGRSRERKRGVPWTEDEHRLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLrrfnqnkrrrrSSLFDITASSTDTFMGSTMEEEQARHQETITVPLPQPQLNRHPGGFPVSAYPVKHSAVVLPFTGEKSMGNLTIGPSNKPRTSPKLIRPIPIHPVPPSSKLGGLNLNQKATHVDVDtlplslklstpssssDEQSAQTPHSSAAFQAMSSGDSNSIISVA
************************************MLFGV****************************************************PWTEDEHRLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLRRF******************************************************PVSAYPVKHSAVVLPFT************************************************************************************************
*SRSCSQCGNNGHNSR*******************IMLFGVR*****************************************************TEDEHRLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY******************************************************************************************************PI***************************************************************IISVA
*************NSRTC***********GSEENGIMLFGVRVTEGSSSFRKSISMDNLSQFDQPQDSNADAGYASDDIVHAS**********PWTEDEHRLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLRRFNQNKRRRRSSLFDITASSTDTFM************ETITVPLPQPQLNRHPGGFPVSAYPVKHSAVVLPFTGEKSMGNLTIGPSNKPRTSPKLIRPIPIHPVPPSSKLGGLNLNQKATHVDVDTLPLSLK*************************************
*********************************NGIMLFGVRVTEGSSSFRK***************************************GVPWTEDEHRLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLRRFN******************************************************VSAYPVKHSAVVLPFTGEKSMGNLTIGPSNKPRTSPKLIRPIPIHP******************************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRSCSQCGNNGHNSRTCAEAGGGGSSGAGSEENGIMLFGVRVTEGSSSFRKSISMDNLSQFDQPQDSNADAGYASDDIVHASGRSRERKRGVPWTEDEHRLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLRRFNQNKRRRRSSLFDITASSTDTFMGSTMEEEQARHQETITVPLPQPQLNRHPGGFPVSAYPVKHSAVVLPFTGEKSMGNLTIGPSNKPRTSPKLIRPIPIHPVPPSSKLGGLNLNQKATHVDVDTLPLSLKLSTPSSSSDEQSAQTPHSSAAFQAMSSGDSNSIISVA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query310 2.2.26 [Sep-21-2011]
Q2V9B0297 Transcription factor MYB1 N/A no 0.851 0.888 0.452 1e-40
Q8S9H7307 Transcription factor DIVA N/A no 0.248 0.250 0.696 9e-27
Q869R9 734 Myb-like protein J OS=Dic yes no 0.209 0.088 0.5 3e-12
Q54HX6 977 Myb-like protein I OS=Dic no no 0.180 0.057 0.491 4e-08
Q54Z40 1217 Myb-like protein H OS=Dic no no 0.209 0.053 0.333 7e-07
Q6R0H0287 Transcription factor ASG4 no no 0.145 0.156 0.489 8e-05
Q6R0H1 645 Protein LHY OS=Arabidopsi no no 0.164 0.079 0.410 9e-05
Q54IF9 423 Myb-like protein G OS=Dic no no 0.145 0.106 0.446 0.0001
P92973 608 Protein CCA1 OS=Arabidops no no 0.158 0.080 0.407 0.0005
>sp|Q2V9B0|MY1R1_SOLTU Transcription factor MYB1R1 OS=Solanum tuberosum PE=2 SV=1 Back     alignment and function desciption
 Score =  167 bits (423), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 138/305 (45%), Positives = 169/305 (55%), Gaps = 41/305 (13%)

Query: 23  GGGSSGAGSEENGIMLFGVRVTEGSSSFRKSISMDNLSQFDQPQDSNA------------ 70
           GGG  G       IMLFGVRV       RKS+S+++LSQ++ P  +N             
Sbjct: 17  GGGFGGE------IMLFGVRVK--VDPMRKSVSLNDLSQYEHPNANNNNNGGDNNESSKV 68

Query: 71  --DAGYASDD--IVHASGRSRERKRGVPWTEDEHRLFLLGLQKVGKGDWRGISRNFVKTR 126
             D GYAS D  + H S   RERKRGVPWTE+EH+LFLLGLQKVGKGDWRGISRNFVKTR
Sbjct: 69  AQDEGYASADDAVQHQSNSGRERKRGVPWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTR 128

Query: 127 TPTQVASHAQKYFLRRFNQNKRRRRSSLFDITASSTDTFMGSTMEEEQARHQETITVPLP 186
           TPTQVASHAQKYFLRR N N+RRRRSSLFDIT  S      S M  E+  +++ I V  P
Sbjct: 129 TPTQVASHAQKYFLRRSNLNRRRRRSSLFDITTDSV-----SVMPIEEVENKQEIPVVAP 183

Query: 187 QPQLNRHPGGFPVSAYPVKHSAVVLPFTGEKSMGNLTIGPSNKPRTSPKLIRPIPIHPVP 246
                     FPV+        ++ P   +KS    T+   +   +S  L+ P+P+  +P
Sbjct: 184 ATLPTTKTNAFPVAP---TVGPIIFPVQIDKSREYPTLLRHDHGNSS-MLVGPVPMFSMP 239

Query: 247 PSSKLGGLNLNQKATHVDVDTLPLSLKLSTPSSSSDEQSAQTPHSSAAFQAMSS-GDSNS 305
             S    LN N  +T       P SL L    S    Q++ T HS  A+  MSS  +  S
Sbjct: 240 NPSTAIDLNANHNST-----IEPSSLSLRLSLSLDQGQASSTRHS--AYNVMSSFSNGES 292

Query: 306 IISVA 310
           II VA
Sbjct: 293 IIRVA 297
Binds selectively to the DNA sequence 5'-[GA]GATAA-3' and may act as a transcription factor involved in the regulation of drought-responsive genes. Enhances stomatal closure in response to abscisic acid (ABA). Confers drought and salt tolerance.
Solanum tuberosum (taxid: 4113)
>sp|Q8S9H7|DIV_ANTMA Transcription factor DIVARICATA OS=Antirrhinum majus GN=DIVARICATA PE=2 SV=1 Back     alignment and function description
>sp|Q869R9|MYBJ_DICDI Myb-like protein J OS=Dictyostelium discoideum GN=mybJ PE=3 SV=1 Back     alignment and function description
>sp|Q54HX6|MYBI_DICDI Myb-like protein I OS=Dictyostelium discoideum GN=mybI PE=3 SV=1 Back     alignment and function description
>sp|Q54Z40|MYBH_DICDI Myb-like protein H OS=Dictyostelium discoideum GN=mybH PE=3 SV=1 Back     alignment and function description
>sp|Q6R0H0|ASG4_ARATH Transcription factor ASG4 OS=Arabidopsis thaliana GN=ASG4 PE=2 SV=1 Back     alignment and function description
>sp|Q6R0H1|LHY_ARATH Protein LHY OS=Arabidopsis thaliana GN=LHY PE=1 SV=2 Back     alignment and function description
>sp|Q54IF9|MYBG_DICDI Myb-like protein G OS=Dictyostelium discoideum GN=mybG PE=3 SV=1 Back     alignment and function description
>sp|P92973|CCA1_ARATH Protein CCA1 OS=Arabidopsis thaliana GN=CCA1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query310
147793149300 hypothetical protein VITISV_028723 [Viti 0.954 0.986 0.681 1e-101
225424819288 PREDICTED: transcription factor MYB1R1 i 0.916 0.986 0.662 1e-96
255558326331 transcription factor, putative [Ricinus 0.874 0.818 0.673 6e-94
327412633334 putative MYB transcription factor [Rosa 0.980 0.910 0.620 5e-88
118487153312 unknown [Populus trichocarpa] 0.925 0.919 0.658 2e-87
224110974307 predicted protein [Populus trichocarpa] 0.922 0.931 0.653 5e-86
302398975323 MYBR domain class transcription factor [ 0.954 0.916 0.593 3e-85
351722587296 MYB transcription factor MYB138 [Glycine 0.825 0.864 0.619 1e-81
356498079300 PREDICTED: transcription factor MYB1R1 [ 0.832 0.86 0.635 2e-79
357486371314 DIV1B protein [Medicago truncatula] gi|3 0.909 0.898 0.526 3e-70
>gi|147793149|emb|CAN73090.1| hypothetical protein VITISV_028723 [Vitis vinifera] gi|296086475|emb|CBI32064.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  375 bits (964), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 214/314 (68%), Positives = 239/314 (76%), Gaps = 18/314 (5%)

Query: 1   MSRSCSQCGNNGHNSRTCAEAGGGGSSGAGSEENGIMLFGVRVTEGSSSFRKSISMDNLS 60
           MSRSCSQCGNNGHNSRTC E+GG     AG+  N IMLFGVR+TEG+  FRKS SM NLS
Sbjct: 1   MSRSCSQCGNNGHNSRTCTESGG-----AGAAANDIMLFGVRITEGA--FRKSASMTNLS 53

Query: 61  QFDQPQDSNADAGYASDDIVHASGRSRERKRGVPWTEDEHRLFLLGLQKVGKGDWRGISR 120
           Q++QPQDSNADAGYASDD+VHAS RSRERKRGVPWTE+EHRLFLLGLQKVGKGDWRGISR
Sbjct: 54  QYEQPQDSNADAGYASDDVVHASARSRERKRGVPWTEEEHRLFLLGLQKVGKGDWRGISR 113

Query: 121 NFVKTRTPTQVASHAQKYFLRRFNQNKRRRRSSLFDITASSTDTFMGSTMEEEQARHQET 180
           NFVKTRTPTQVASHAQKYFLRR N N+RRRRSSLFDITA   DTFMGST+ EE   HQET
Sbjct: 114 NFVKTRTPTQVASHAQKYFLRRNNHNRRRRRSSLFDITA---DTFMGSTILEEDQVHQET 170

Query: 181 ITVPLPQPQLNRHPGGFPVSAYPVKHSAVVLPFTGEKSMGNLTIGPSNKPRTSPKLIRPI 240
           ++ P     LN   GGFPV  +PV  + VVLP     SM  LT+G SN+ +   KLIRPI
Sbjct: 171 VSPPQLHSHLNGSAGGFPVPTFPVTMAPVVLPVASNGSMEILTLGQSNQAKGPTKLIRPI 230

Query: 241 PIHPVPPSSKLGGLNLNQKATHVDVDTLPLSLKLSTPSSSSDEQSAQTPHSSAAFQAMS- 299
           PI PVPPSSK+  LNLN  +T    D LPLSLK S+ +S+S +    T HSS AFQAMS 
Sbjct: 231 PILPVPPSSKMADLNLNIPST---ADPLPLSLKPSSSTSTSPQSPTATRHSS-AFQAMSE 286

Query: 300 ---SGDSNSIISVA 310
              S   ++IISVA
Sbjct: 287 SFNSSTGDNIISVA 300

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225424819|ref|XP_002271980.1| PREDICTED: transcription factor MYB1R1 isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255558326|ref|XP_002520190.1| transcription factor, putative [Ricinus communis] gi|223540682|gb|EEF42245.1| transcription factor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|327412633|emb|CCA29105.1| putative MYB transcription factor [Rosa rugosa] Back     alignment and taxonomy information
>gi|118487153|gb|ABK95405.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224110974|ref|XP_002315700.1| predicted protein [Populus trichocarpa] gi|222864740|gb|EEF01871.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|302398975|gb|ADL36782.1| MYBR domain class transcription factor [Malus x domestica] Back     alignment and taxonomy information
>gi|351722587|ref|NP_001237761.1| MYB transcription factor MYB138 [Glycine max] gi|110931720|gb|ABH02859.1| MYB transcription factor MYB138 [Glycine max] Back     alignment and taxonomy information
>gi|356498079|ref|XP_003517881.1| PREDICTED: transcription factor MYB1R1 [Glycine max] Back     alignment and taxonomy information
>gi|357486371|ref|XP_003613473.1| DIV1B protein [Medicago truncatula] gi|355514808|gb|AES96431.1| DIV1B protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query310
TAIR|locus:2020653261 AT1G70000 [Arabidopsis thalian 0.596 0.708 0.652 3.7e-70
TAIR|locus:2094942387 AT3G16350 [Arabidopsis thalian 0.612 0.490 0.396 6.6e-41
TAIR|locus:2011216285 AT1G19000 [Arabidopsis thalian 0.367 0.4 0.569 2e-37
TAIR|locus:2171519365 AT5G47390 [Arabidopsis thalian 0.516 0.438 0.481 4e-35
TAIR|locus:2165106233 AT5G56840 [Arabidopsis thalian 0.467 0.622 0.459 3e-33
TAIR|locus:2027181265 AT1G74840 [Arabidopsis thalian 0.674 0.788 0.439 6.7e-33
TAIR|locus:2151621317 AT5G61620 [Arabidopsis thalian 0.5 0.488 0.437 6.9e-31
TAIR|locus:2028461314 AT1G49010 [Arabidopsis thalian 0.670 0.662 0.36 5.7e-27
TAIR|locus:2159607298 AT5G08520 [Arabidopsis thalian 0.596 0.620 0.379 4.6e-25
TAIR|locus:2175478215 AT5G04760 [Arabidopsis thalian 0.396 0.572 0.507 2.3e-23
TAIR|locus:2020653 AT1G70000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 605 (218.0 bits), Expect = 3.7e-70, Sum P(2) = 3.7e-70
 Identities = 126/193 (65%), Positives = 137/193 (70%)

Query:     1 MSRSCSQCGNNGHNSRTCXXXXXXXXXXXXXXXN--GIMLFGVRVTEGSSS-FRKSISMD 57
             MSRSCSQCGNNGHNSRTC                   IMLFGVRVTE SSS FRKS+SM+
Sbjct:     1 MSRSCSQCGNNGHNSRTCPTDITTTGDNNDKGGGEKAIMLFGVRVTEASSSCFRKSVSMN 60

Query:    58 NLSQFDQPQDSNA--DAGYASDDIVHASGRSRERKRGVPWTEDEHRLFLLGLQKVGKGDW 115
             NLSQFDQ  D N   D GYASDD+VHASGR+RERKRG PWTE+EHRLFL GL KVGKGDW
Sbjct:    61 NLSQFDQTPDPNPTDDGGYASDDVVHASGRNRERKRGTPWTEEEHRLFLTGLHKVGKGDW 120

Query:   116 RGISRNFVKTRTPTQVASHAQKYFLXXXXXXXXXXXSSLFDITASSTDTFMGSTMEEEQA 175
             RGISRNFVKTRTPTQVASHAQKYFL           SSLFDIT    D+F+GS+ EE Q 
Sbjct:   121 RGISRNFVKTRTPTQVASHAQKYFLRRTNQNRRRRRSSLFDITP---DSFIGSSKEENQL 177

Query:   176 RHQETITVPLPQP 188
             +    +  P+P P
Sbjct:   178 QTPLELIRPVPIP 190
GO:0003676 "nucleic acid binding" evidence=IEA;ISS
GO:0003677 "DNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
GO:0009651 "response to salt stress" evidence=IEP
GO:0009723 "response to ethylene stimulus" evidence=IEP
GO:0009733 "response to auxin stimulus" evidence=IEP
GO:0009737 "response to abscisic acid stimulus" evidence=IEP
GO:0009739 "response to gibberellin stimulus" evidence=IEP
GO:0009751 "response to salicylic acid stimulus" evidence=IEP
GO:0009753 "response to jasmonic acid stimulus" evidence=IEP
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0080167 "response to karrikin" evidence=IEP
TAIR|locus:2094942 AT3G16350 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011216 AT1G19000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171519 AT5G47390 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2165106 AT5G56840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027181 AT1G74840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151621 AT5G61620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2028461 AT1G49010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2159607 AT5G08520 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175478 AT5G04760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query310
TIGR0155757 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domai 6e-17
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 1e-09
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 2e-09
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 2e-09
cd1166146 cd11661, SANT_MTA3_like, Myb-Like Dna-Binding Doma 1e-04
cd1166050 cd11660, SANT_TRF, Telomere repeat binding factor- 5e-04
COG5114 432 COG5114, COG5114, Histone acetyltransferase comple 0.001
>gnl|CDD|130620 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information 
 Score = 73.2 bits (180), Expect = 6e-17
 Identities = 26/57 (45%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 90  KRGVPWTEDEHRLFLLGLQKVGKGDW---RGISRNFVKTR-TPTQVASHAQKYFLRR 142
           K  V WTED H  FL  +QK+G  DW   + I    V    T  QVASH QKY L++
Sbjct: 1   KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLKQ 57

This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif. Length = 57
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|212559 cd11661, SANT_MTA3_like, Myb-Like Dna-Binding Domain of MTA3 and related proteins Back     alignment and domain information
>gnl|CDD|212558 cd11660, SANT_TRF, Telomere repeat binding factor-like DNA-binding domains of the SANT/myb-like family Back     alignment and domain information
>gnl|CDD|227445 COG5114, COG5114, Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 310
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 99.73
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.5
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.21
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.2
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 98.95
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 98.92
PLN03212249 Transcription repressor MYB5; Provisional 98.76
PLN03091 459 hypothetical protein; Provisional 98.71
KOG0048238 consensus Transcription factor, Myb superfamily [T 98.46
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 98.31
PLN03212249 Transcription repressor MYB5; Provisional 98.27
KOG0724335 consensus Zuotin and related molecular chaperones 98.22
PLN03091 459 hypothetical protein; Provisional 98.18
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 98.12
KOG1279506 consensus Chromatin remodeling factor subunit and 97.91
KOG0048238 consensus Transcription factor, Myb superfamily [T 97.64
KOG0049 939 consensus Transcription factor, Myb superfamily [T 97.6
KOG4329445 consensus DNA-binding protein [General function pr 97.37
PLN03162526 golden-2 like transcription factor; Provisional 96.99
KOG0049 939 consensus Transcription factor, Myb superfamily [T 96.88
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 96.39
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 95.97
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 95.43
KOG4468 782 consensus Polycomb-group transcriptional regulator 95.05
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 94.92
smart0042668 TEA TEA domain. 94.88
KOG4167907 consensus Predicted DNA-binding protein, contains 94.87
PF0009818 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc fi 94.74
COG5147 512 REB1 Myb superfamily proteins, including transcrip 94.31
KOG0051607 consensus RNA polymerase I termination factor, Myb 94.27
PLN031421033 Probable chromatin-remodeling complex ATPase chain 94.09
KOG0724335 consensus Zuotin and related molecular chaperones 94.02
KOG3554 693 consensus Histone deacetylase complex, MTA1 compon 93.89
PF1439249 zf-CCHC_4: Zinc knuckle 93.41
PF1528840 zf-CCHC_6: Zinc knuckle 93.09
KOG0051607 consensus RNA polymerase I termination factor, Myb 93.04
KOG3841 455 consensus TEF-1 and related transcription factor, 92.55
PF01285 431 TEA: TEA/ATTS domain family; InterPro: IPR000818 T 91.89
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 91.33
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 89.44
KOG1194 534 consensus Predicted DNA-binding protein, contains 89.2
PLN031421033 Probable chromatin-remodeling complex ATPase chain 88.36
COG5147 512 REB1 Myb superfamily proteins, including transcrip 87.13
KOG4282345 consensus Transcription factor GT-2 and related pr 86.2
smart0034326 ZnF_C2HC zinc finger. 84.95
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 81.25
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information 
Probab=99.73  E-value=5.1e-18  Score=126.27  Aligned_cols=53  Identities=49%  Similarity=0.691  Sum_probs=47.4

Q ss_pred             cCCCccCHHHHHHHHHHHHHcCCCCH---HhhhhhhcCCC-CHHHHHHHHHHHHHHH
Q 021588           90 KRGVPWTEDEHRLFLLGLQKVGKGDW---RGISRNFVKTR-TPTQVASHAQKYFLRR  142 (310)
Q Consensus        90 Kkg~~WTeEEH~lFLeGLekyGkGdW---k~IA~~~V~TR-T~~QVrSHAQKYf~r~  142 (310)
                      |++..||+|||++||+||+.||.|+|   +.|++.++.+| |+.||+||+||||+++
T Consensus         1 k~r~~WT~eeh~~Fl~ai~~~G~g~~a~pk~I~~~~~~~~lT~~qV~SH~QKy~~k~   57 (57)
T TIGR01557         1 KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLKQ   57 (57)
T ss_pred             CCCCCCCHHHHHHHHHHHHHhCCCcccchHHHHHHcCCCCCCHHHHHHHHHHHHccC
Confidence            45678999999999999999999999   99996555688 9999999999999863

This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by Pfam model pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif.
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG4329 consensus DNA-binding protein [General function prediction only] Back     alignment and domain information
>PLN03162 golden-2 like transcription factor; Provisional Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>smart00426 TEA TEA domain Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PF00098 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] Back     alignment and domain information
>PF14392 zf-CCHC_4: Zinc knuckle Back     alignment and domain information
>PF15288 zf-CCHC_6: Zinc knuckle Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG3841 consensus TEF-1 and related transcription factor, TEAD family [Transcription] Back     alignment and domain information
>PF01285 TEA: TEA/ATTS domain family; InterPro: IPR000818 Transcriptional enhancer activators are nuclear proteins that contain a TEA/ATTSdomain, a DNA-binding region of 66-68 amino acids Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>smart00343 ZnF_C2HC zinc finger Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query310
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 2e-25
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 5e-20
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 3e-16
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 1e-15
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 3e-13
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 9e-10
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 2e-09
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 3e-08
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 1e-07
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 2e-07
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 6e-07
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 1e-06
2crg_A70 Metastasis associated protein MTA3; transcription 2e-06
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 2e-06
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 4e-06
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 1e-05
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 2e-05
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 4e-04
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 9e-04
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
 Score = 96.0 bits (239), Expect = 2e-25
 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 2/70 (2%)

Query: 84  GRSRERKRGVPWTEDEHRLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLRRF 143
           G S      V WT +E  LF  GL K G+  W  IS+  + +RT  QV S+A++YF  + 
Sbjct: 1   GSSGSSGYSVKWTIEEKELFEQGLAKFGR-RWTKISK-LIGSRTVLQVKSYARQYFKNKV 58

Query: 144 NQNKRRRRSS 153
                +   +
Sbjct: 59  KCGLDKETPN 68
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Length = 70 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Length = 64 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query310
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.66
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.57
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.56
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.56
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.52
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.46
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.43
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.43
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.39
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.38
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.35
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.35
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.31
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 99.24
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 99.24
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.21
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.19
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.82
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 99.18
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 99.18
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.16
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.13
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.12
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.12
2crg_A70 Metastasis associated protein MTA3; transcription 99.1
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.07
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.07
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.06
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.05
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.04
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.03
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 98.98
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 98.97
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 98.97
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.96
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 98.9
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.9
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 98.89
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 98.86
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 98.84
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 98.73
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.72
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 98.67
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.56
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 98.33
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 97.64
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 97.5
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 97.36
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.35
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 97.2
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.04
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 96.74
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 96.58
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 96.55
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 95.66
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 95.45
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 95.37
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 94.11
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 94.43
1dsq_A26 Nucleic acid binding protein P14; CCHC type zinc f 94.32
2hzd_A82 Transcriptional enhancer factor TEF-1; DNA-binding 94.17
1nc8_A29 Nucleocapsid protein; HIV-2, RNA recognition, zinc 88.89
1a6b_B40 Momulv, zinc finger protein NCP10; nucleocapsid pr 87.9
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 83.96
2ihx_A61 Nucleocapsid (NC) protein; protein-RNA complex, vi 83.07
1u6p_A56 GAG polyprotein; MLV, A-minor K-turn, stem loop, b 82.82
2a51_A39 Nucleocapsid protein; sivlhoest, structure, NCP8, 81.96
2bl6_A37 Nucleocapsid protein P11; lentivirus, polyprotein, 81.32
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
Probab=99.66  E-value=1.7e-16  Score=119.36  Aligned_cols=64  Identities=33%  Similarity=0.543  Sum_probs=59.0

Q ss_pred             CCCccCHHHHHHHHHHHHHcCCCCHHhhhhhhcCCCCHHHHHHHHHHHHHHHhcccccCCCCceee
Q 021588           91 RGVPWTEDEHRLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLRRFNQNKRRRRSSLFD  156 (310)
Q Consensus        91 kg~~WTeEEH~lFLeGLekyGkGdWk~IA~~~V~TRT~~QVrSHAQKYf~r~~~~~k~~rR~sL~d  156 (310)
                      +..+||+|||++|++++++||. +|..|| .+|++||..||+.||++||.+..+.+..+++.+|++
T Consensus         8 ~~~~WT~eEd~~l~~~~~~~G~-~W~~Ia-~~~~~Rt~~q~k~r~~~~l~~~~~~g~~~~~~si~s   71 (72)
T 2cu7_A            8 YSVKWTIEEKELFEQGLAKFGR-RWTKIS-KLIGSRTVLQVKSYARQYFKNKVKCGLDKETPNQKT   71 (72)
T ss_dssp             CCCCCCHHHHHHHHHHHHHTCS-CHHHHH-HHHSSSCHHHHHHHHHHHHHHHSCSCTTCCCSCCCC
T ss_pred             CCCCCCHHHHHHHHHHHHHHCc-CHHHHH-HHcCCCCHHHHHHHHHHHHHHHHhcCCCCCcccccc
Confidence            4457999999999999999998 999999 699999999999999999999988888888888875
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>1dsq_A Nucleic acid binding protein P14; CCHC type zinc finger, virus/viral protein; NMR {Mouse mammary tumor virus} SCOP: g.40.1.1 Back     alignment and structure
>2hzd_A Transcriptional enhancer factor TEF-1; DNA-binding, helix-turn-helix, gene regulation; NMR {Homo sapiens} Back     alignment and structure
>1nc8_A Nucleocapsid protein; HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus 2} SCOP: g.40.1.1 PDB: 2di2_A Back     alignment and structure
>1a6b_B Momulv, zinc finger protein NCP10; nucleocapsid protein, intercalation, nucleic acid, retrovirus, viral protein/DNA complex; HET: DNA; NMR {Synthetic} SCOP: g.40.1.1 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} Back     alignment and structure
>1u6p_A GAG polyprotein; MLV, A-minor K-turn, stem loop, bulge, G-U mismatch, G-A MIS U mismatch, A-C mismatch, zinc finger, NC, viral protein-RN; HET: AP7; NMR {Moloney murine leukemia virus} SCOP: g.40.1.1 PDB: 1wwd_A 1wwe_A 1wwf_A 1wwg_A Back     alignment and structure
>2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} Back     alignment and structure
>2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 310
d1irza_64 a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis th 7e-18
d2crga157 a.4.1.3 (A:8-64) Metastasis associated protein MTA 5e-17
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 1e-11
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 3e-11
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 2e-09
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 6e-09
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 3e-07
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 9e-07
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 8e-06
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 3e-04
d2cqqa159 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 0.002
d1ofcx152 a.4.1.3 (X:799-850) SANT domain of the nucleosome 0.003
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 0.004
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: GARP response regulators
domain: Arr10-B
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 74.2 bits (182), Expect = 7e-18
 Identities = 17/59 (28%), Positives = 25/59 (42%), Gaps = 3/59 (5%)

Query: 86  SRERKRGVPWTEDEHRLFLLGLQKVGKGDWR--GISRN-FVKTRTPTQVASHAQKYFLR 141
           + ++K  V WT + H  FL  +  +G        I     V   T   VASH QK+ + 
Sbjct: 1   TAQKKPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVA 59
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 52 Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query310
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.64
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 99.58
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.54
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.43
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.4
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.35
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.33
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.32
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 99.3
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.3
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.27
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.27
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.19
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.01
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 98.93
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.47
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.43
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 97.91
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 95.69
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 94.61
d1nc8a_29 HIV nucleocapsid {Human immunodeficiency virus typ 88.96
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 87.79
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 87.3
d2exfa142 HIV nucleocapsid {Human immunodeficiency virus typ 83.58
d2exfa142 HIV nucleocapsid {Human immunodeficiency virus typ 83.44
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Transcriptional adaptor 2-like, TADA2L, isoform b
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.64  E-value=8.3e-17  Score=112.12  Aligned_cols=45  Identities=31%  Similarity=0.636  Sum_probs=43.6

Q ss_pred             ccCHHHHHHHHHHHHHcCCCCHHhhhhhhcCCCCHHHHHHHHHHHH
Q 021588           94 PWTEDEHRLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYF  139 (310)
Q Consensus        94 ~WTeEEH~lFLeGLekyGkGdWk~IA~~~V~TRT~~QVrSHAQKYf  139 (310)
                      .||+||+++|+++|++||.++|..|| ++|++||+.||+.|+++||
T Consensus         3 ~Wt~eEd~~L~~~v~~~G~~nW~~Ia-~~~~~Rt~~Qcr~r~~~~f   47 (47)
T d1x41a1           3 SWTAQEEMALLEAVMDCGFGNWQDVA-NQMCTKTKEECEKHYMKYF   47 (47)
T ss_dssp             SSCHHHHHHHHHHHHHTCTTCHHHHH-HHHTTSCHHHHHHHHHHHT
T ss_pred             CCCHHHHHHHHHHHHHHCCccHHHHH-HHcCCCCHHHHHHHHHHhC
Confidence            49999999999999999999999999 7999999999999999998
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nc8a_ g.40.1.1 (A:) HIV nucleocapsid {Human immunodeficiency virus type 2 [TaxId: 11709]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Back     information, alignment and structure
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Back     information, alignment and structure