Citrus Sinensis ID: 021667
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 309 | ||||||
| 225443980 | 321 | PREDICTED: F-box protein SKIP19 [Vitis v | 0.932 | 0.897 | 0.639 | 8e-97 | |
| 255571310 | 305 | ubiquitin-protein ligase, putative [Rici | 0.880 | 0.891 | 0.597 | 6e-91 | |
| 297813917 | 308 | F-box family protein [Arabidopsis lyrata | 0.883 | 0.886 | 0.576 | 2e-87 | |
| 356546510 | 311 | PREDICTED: F-box protein SKIP19-like [Gl | 0.948 | 0.942 | 0.562 | 7e-86 | |
| 18412947 | 302 | F-box protein SKIP19 [Arabidopsis thalia | 0.915 | 0.937 | 0.565 | 2e-84 | |
| 21593361 | 302 | F-box protein family, AtFBL20 [Arabidops | 0.915 | 0.937 | 0.562 | 6e-84 | |
| 297813919 | 610 | hypothetical protein ARALYDRAFT_911810 [ | 0.844 | 0.427 | 0.569 | 2e-81 | |
| 356555512 | 318 | PREDICTED: F-box protein SKIP19-like [Gl | 0.912 | 0.886 | 0.553 | 1e-79 | |
| 449433680 | 311 | PREDICTED: F-box protein SKIP19-like [Cu | 0.841 | 0.836 | 0.568 | 6e-79 | |
| 297790738 | 296 | hypothetical protein ARALYDRAFT_332995 [ | 0.802 | 0.837 | 0.544 | 4e-75 |
| >gi|225443980|ref|XP_002274093.1| PREDICTED: F-box protein SKIP19 [Vitis vinifera] gi|147853333|emb|CAN82327.1| hypothetical protein VITISV_041807 [Vitis vinifera] gi|297740788|emb|CBI30970.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 359 bits (922), Expect = 8e-97, Method: Compositional matrix adjust.
Identities = 188/294 (63%), Positives = 228/294 (77%), Gaps = 6/294 (2%)
Query: 12 DWTQLPADVTSTILSKIGAIDVLTSAQRVCSSWLRICHDPAMWRNIDMHNLGDLWDMDHD 71
+W +LP DVTS ILSK+ A+++L+SAQ VCS W ++C +P MWRNIDMHNLGDL D+ +D
Sbjct: 19 NWQELPRDVTSMILSKLNAVEILSSAQFVCSFWRKLCREPMMWRNIDMHNLGDLCDLGYD 78
Query: 72 LEKMCRHAVDRSNGQLLSINIEYFGTDELLQYIANRSRNLRNLRLVSCYNISDQGFCEAI 131
LE+M RHAVDRS GQLLSI I+ F TD LL YI +RS ++R+LRLVSCY ISD G E I
Sbjct: 79 LEEMARHAVDRSGGQLLSICIDDFATDNLLNYIIDRSSHIRHLRLVSCYGISDDGLSEGI 138
Query: 132 KGFPLLEELELSYCSLSQEALEAVGSLCPLLRSFKLNNRGHRCPKIECDDDAKAIAENMH 191
K PLL E++L YCS S+E LEA+G CP L+SF+LN +G R P IECD++A AIA+NM
Sbjct: 139 KRLPLLVEIDLCYCSFSKEVLEAIGQCCPRLKSFRLNCQGFRHPHIECDEEALAIAQNMP 198
Query: 192 GLRHLQLFGNELTNVGLQAILDACPHLESLDLRQCFNVNLVGKLGKICAERIRDLRHPND 251
GL+ LQLFGN+LTN GL AILD C HLESLDLRQCFNVNL G L K CAE+I+ LR+PND
Sbjct: 199 GLKSLQLFGNKLTNNGLLAILDGCCHLESLDLRQCFNVNLGGNLAKRCAEQIKILRYPND 258
Query: 252 STHDYEFGADFQDFCWSSVEDYPSGISDIELVSDEDDYYEFSDYDFGYDF-DYD 304
ST DYEF A+ D S E+YPSGISD++L+SD DYY+FSD G DF +YD
Sbjct: 259 STDDYEFDAEIHDDA-SFDEEYPSGISDLDLLSD-GDYYDFSD---GSDFSEYD 307
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255571310|ref|XP_002526604.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223534044|gb|EEF35763.1| ubiquitin-protein ligase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297813917|ref|XP_002874842.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297320679|gb|EFH51101.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356546510|ref|XP_003541669.1| PREDICTED: F-box protein SKIP19-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|18412947|ref|NP_567294.1| F-box protein SKIP19 [Arabidopsis thaliana] gi|75335768|sp|Q9M0U9.1|SKI19_ARATH RecName: Full=F-box protein SKIP19; AltName: Full=F-box/LRR-repeat protein 20; AltName: Full=SKP1-interacting partner 19 gi|7267306|emb|CAB81088.1| N7 like-protein [Arabidopsis thaliana] gi|27765050|gb|AAO23646.1| At4g05460 [Arabidopsis thaliana] gi|110742947|dbj|BAE99368.1| N7 like-protein [Arabidopsis thaliana] gi|332657123|gb|AEE82523.1| F-box protein SKIP19 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|21593361|gb|AAM65310.1| F-box protein family, AtFBL20 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297813919|ref|XP_002874843.1| hypothetical protein ARALYDRAFT_911810 [Arabidopsis lyrata subsp. lyrata] gi|297320680|gb|EFH51102.1| hypothetical protein ARALYDRAFT_911810 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356555512|ref|XP_003546075.1| PREDICTED: F-box protein SKIP19-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449433680|ref|XP_004134625.1| PREDICTED: F-box protein SKIP19-like [Cucumis sativus] gi|449490588|ref|XP_004158648.1| PREDICTED: F-box protein SKIP19-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297790738|ref|XP_002863254.1| hypothetical protein ARALYDRAFT_332995 [Arabidopsis lyrata subsp. lyrata] gi|297309088|gb|EFH39513.1| hypothetical protein ARALYDRAFT_332995 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 309 | ||||||
| TAIR|locus:2115949 | 302 | AT4G05460 "AT4G05460" [Arabido | 0.864 | 0.884 | 0.512 | 8.2e-67 | |
| TAIR|locus:2115979 | 307 | AT4G05490 "AT4G05490" [Arabido | 0.877 | 0.882 | 0.411 | 2e-49 | |
| TAIR|locus:1005716270 | 246 | AT4G05497 "AT4G05497" [Arabido | 0.718 | 0.902 | 0.437 | 5.6e-45 | |
| TAIR|locus:2140715 | 220 | AT4G03630 "AT4G03630" [Arabido | 0.608 | 0.854 | 0.486 | 4.8e-39 | |
| TAIR|locus:2122308 | 317 | FBW2 "AT4G08980" [Arabidopsis | 0.854 | 0.832 | 0.262 | 6.5e-19 | |
| TAIR|locus:2174398 | 300 | SKIP1 "SKP1 interacting partne | 0.521 | 0.536 | 0.25 | 3.4e-07 | |
| TAIR|locus:2139697 | 333 | AT4G11580 [Arabidopsis thalian | 0.288 | 0.267 | 0.31 | 9.8e-07 | |
| UNIPROTKB|D6RDY7 | 444 | FBXL7 "F-box/LRR-repeat protei | 0.401 | 0.279 | 0.276 | 4.3e-05 | |
| TAIR|locus:4010713864 | 88 | AT4G03635 [Arabidopsis thalian | 0.239 | 0.840 | 0.32 | 4.3e-05 | |
| UNIPROTKB|F1N019 | 449 | FBXL7 "Uncharacterized protein | 0.407 | 0.280 | 0.246 | 4.6e-05 |
| TAIR|locus:2115949 AT4G05460 "AT4G05460" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 679 (244.1 bits), Expect = 8.2e-67, P = 8.2e-67
Identities = 141/275 (51%), Positives = 177/275 (64%)
Query: 9 ESCDWTQLPADVTSTILSKIGAIDVLTSAQRVCSSWLRICHDPAMWRNIDMHNLGDLWDM 68
ES +WT+LP ++TS IL ++GAI++L +AQ+VC SW R+C DP+MWR IDMHNLGDL DM
Sbjct: 15 ESTNWTELPPELTSAILHRLGAIEILENAQKVCRSWRRVCKDPSMWRKIDMHNLGDLDDM 74
Query: 69 DHDLEKMCRHAVDRSNGQLLSINIEYFGTDELLQYIAXXXXXXXXXXXVSCYNISDQGFC 128
D++LE MCRHAVDRS G L+ I I YFGT +LL YIA + C I+D GF
Sbjct: 75 DYNLEIMCRHAVDRSQGGLVDIGIWYFGTVDLLNYIAHRSSNLRSLRLIRCSQITDDGFV 134
Query: 129 EAIKGFPXXXXXXXXXXXXXQEALEAVGSLCPLLRSFKLNNRGHRCPKIECDDDAKAIAE 188
EA+ P E+L VG C +++ KLN H P+ E DDDA AIAE
Sbjct: 135 EAVVKLPLEELELSYCSFSV-ESLRVVGQCCLNMKTLKLNK--H--PQKENDDDALAIAE 189
Query: 189 NMHGLRHLQLFGNELTNVGLQAILDACPHLESLDLRQCFNVNLVGKLGKICAERIRDLRH 248
M LRHLQL GN L++ GL AILD C +LE LDLR+CFNVNLVG L K C E ++ +RH
Sbjct: 190 TMPKLRHLQLCGNGLSDTGLNAILDNCSNLEHLDLRRCFNVNLVGDLQKRCFESVKVVRH 249
Query: 249 PNDSTHDYEFGA--DFQDFCWSSVEDYPSGISDIE 281
PNDS HD + G+ D + +S + D SG D E
Sbjct: 250 PNDSIHDIDIGSSEDEDPYDFSDI-DLMSGDDDFE 283
|
|
| TAIR|locus:2115979 AT4G05490 "AT4G05490" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:1005716270 AT4G05497 "AT4G05497" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2140715 AT4G03630 "AT4G03630" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2122308 FBW2 "AT4G08980" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2174398 SKIP1 "SKP1 interacting partner 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2139697 AT4G11580 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D6RDY7 FBXL7 "F-box/LRR-repeat protein 7" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:4010713864 AT4G03635 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N019 FBXL7 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00028376001 | SubName- Full=Putative uncharacterized protein (Chromosome chr10 scaffold_43, whole genome shotgun sequence); (321 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 309 | |||
| pfam12937 | 47 | pfam12937, F-box-like, F-box-like | 2e-06 | |
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 1e-05 |
| >gnl|CDD|221867 pfam12937, F-box-like, F-box-like | Back alignment and domain information |
|---|
Score = 44.0 bits (105), Expect = 2e-06
Identities = 12/48 (25%), Positives = 21/48 (43%), Gaps = 1/48 (2%)
Query: 13 WTQLPADVTSTILSKIGAIDVLTSAQRVCSSWLRICHDPAMWRNIDMH 60
+ LP ++ I S + D L VC W + D ++WR + +
Sbjct: 1 LSDLPDEILLQIFSYLDPRD-LLRLALVCRRWRELASDDSLWRRLCLR 47
|
This is an F-box-like family. Length = 47 |
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 309 | |||
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.95 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.95 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.76 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.46 | |
| PF12937 | 47 | F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B | 99.44 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.43 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.38 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 99.28 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 99.26 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.26 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.22 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 99.02 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.94 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.88 | |
| smart00256 | 41 | FBOX A Receptor for Ubiquitination Targets. | 98.87 | |
| PF00646 | 48 | F-box: F-box domain; InterPro: IPR001810 The F-box | 98.86 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.78 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 98.69 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.69 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 98.61 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.55 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 98.45 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 98.43 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 98.3 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 98.29 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.97 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 97.93 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 97.92 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.91 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 97.72 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.69 | |
| KOG2997 | 366 | consensus F-box protein FBX9 [General function pre | 97.68 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.63 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.54 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 97.49 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 97.49 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 97.44 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 97.44 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 97.34 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 97.32 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.24 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 97.23 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 97.2 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 97.18 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 97.1 | |
| PLN03215 | 373 | ascorbic acid mannose pathway regulator 1; Provisi | 97.09 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 97.07 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 97.07 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.02 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 96.85 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 96.79 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 96.78 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.76 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 96.76 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 96.72 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 96.7 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 96.67 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 96.62 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 96.61 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 96.37 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 96.17 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 96.05 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 96.01 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 95.98 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 95.76 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 95.5 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 95.26 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 95.25 | |
| PF13013 | 109 | F-box-like_2: F-box-like domain | 95.1 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 95.01 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 94.47 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 94.28 | |
| KOG0274 | 537 | consensus Cdc4 and related F-box and WD-40 protein | 94.07 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 93.72 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 93.7 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 93.5 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 93.44 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 93.18 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 93.14 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 92.82 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 92.78 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 92.74 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 92.73 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 91.81 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 91.38 | |
| PF09372 | 97 | PRANC: PRANC domain; InterPro: IPR018272 This pres | 87.91 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 87.84 | |
| PF07723 | 26 | LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le | 87.21 | |
| KOG3735 | 353 | consensus Tropomodulin and leiomodulin [Cytoskelet | 87.14 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 80.46 |
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.95 E-value=6.9e-29 Score=207.43 Aligned_cols=262 Identities=19% Similarity=0.265 Sum_probs=182.2
Q ss_pred CCCCcHHHHHHHhccCChhhhhhhhhhhcHHHHHhccCCCCCceeecCCCCCCcccchhHHHHHHHHHhccCCCceEEec
Q 021667 13 WTQLPADVTSTILSKIGAIDVLTSAQRVCSSWLRICHDPAMWRNIDMHNLGDLWDMDHDLEKMCRHAVDRSNGQLLSINI 92 (309)
Q Consensus 13 ~~~LP~eiL~~If~~L~~~d~~~~~~~Vcr~W~~~~~~~~l~~~i~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~l 92 (309)
.-.||+|++..||++|+.+.+. ++++||+.|+..+.+..-|+++++....-. .....+. ..+.+.++.++++.+
T Consensus 72 ~~~LPpEl~lkvFS~LDtksl~-r~a~~c~~~n~~AlD~~~~q~idL~t~~rD-v~g~VV~----~~~~Rcgg~lk~LSl 145 (483)
T KOG4341|consen 72 SRSLPPELLLKVFSMLDTKSLC-RAAQCCTMWNKLALDGSCWQHIDLFTFQRD-VDGGVVE----NMISRCGGFLKELSL 145 (483)
T ss_pred cccCCHHHHHHHHHHHhHHHHH-HHHHHHHHhhhhhhccccceeeehhcchhc-CCCccee----hHhhhhccccccccc
Confidence 3469999999999999999995 999999999999999999999999875422 2233333 344444677888877
Q ss_pred c--ccCChHHHHHHHhcCCCccEEEeCCCCCCCHHHHHHHHhcCCCcCEEEecCC-CCCHHHHHHHHhcCCCCcEEEecc
Q 021667 93 E--YFGTDELLQYIANRSRNLRNLRLVSCYNISDQGFCEAIKGFPLLEELELSYC-SLSQEALEAVGSLCPLLRSFKLNN 169 (309)
Q Consensus 93 ~--~~~~~~~l~~l~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~L~~~-~~~~~~~~~l~~~~~~L~~L~l~~ 169 (309)
. ..+.++.+..+...||++++|.+.+|..+|+..+..+.+.|++|++|+|..| .+++..++.+++.||+|+.|++++
T Consensus 146 rG~r~v~~sslrt~~~~CpnIehL~l~gc~~iTd~s~~sla~~C~~l~~l~L~~c~~iT~~~Lk~la~gC~kL~~lNlSw 225 (483)
T KOG4341|consen 146 RGCRAVGDSSLRTFASNCPNIEHLALYGCKKITDSSLLSLARYCRKLRHLNLHSCSSITDVSLKYLAEGCRKLKYLNLSW 225 (483)
T ss_pred cccccCCcchhhHHhhhCCchhhhhhhcceeccHHHHHHHHHhcchhhhhhhcccchhHHHHHHHHHHhhhhHHHhhhcc
Confidence 4 3667777788888888888888888888888888888888888888888887 778888888888888888888877
Q ss_pred CCCCCC-C--------------------cccchhHHHHHhcCCCCcEEEecCC-ccChHHHHHHHHhCCCCCeeecCCCC
Q 021667 170 RGHRCP-K--------------------IECDDDAKAIAENMHGLRHLQLFGN-ELTNVGLQAILDACPHLESLDLRQCF 227 (309)
Q Consensus 170 ~~~~~~-~--------------------~~~~~~~~~l~~~~~~L~~L~l~~~-~i~~~~l~~l~~~~~~L~~L~l~~c~ 227 (309)
|.--.. . -...+.+..+...++.+..+++..| .++|.++..+...|.+|+.|+.++|.
T Consensus 226 c~qi~~~gv~~~~rG~~~l~~~~~kGC~e~~le~l~~~~~~~~~i~~lnl~~c~~lTD~~~~~i~~~c~~lq~l~~s~~t 305 (483)
T KOG4341|consen 226 CPQISGNGVQALQRGCKELEKLSLKGCLELELEALLKAAAYCLEILKLNLQHCNQLTDEDLWLIACGCHALQVLCYSSCT 305 (483)
T ss_pred CchhhcCcchHHhccchhhhhhhhcccccccHHHHHHHhccChHhhccchhhhccccchHHHHHhhhhhHhhhhcccCCC
Confidence 321100 0 0012222223334444555555555 57777777777677777777777777
Q ss_pred CcCc--hhHHHHHhHhccCceecCCCC-CCchhhhhhhhhhccCCcCCCCCCCCccccCCC
Q 021667 228 NVNL--VGKLGKICAERIRDLRHPNDS-THDYEFGADFQDFCWSSVEDYPSGISDIELVSD 285 (309)
Q Consensus 228 ~~~~--~~~l~~~~~~~L~~L~l~~~~-~~d~~~~~~~~~~c~~~~~l~~~~~s~~~~~~d 285 (309)
.+++ ..++..+++ +|+.|-+++|. ++|.||+.+. .. ++.|+++|...|..++|
T Consensus 306 ~~~d~~l~aLg~~~~-~L~~l~l~~c~~fsd~~ft~l~-rn---~~~Le~l~~e~~~~~~d 361 (483)
T KOG4341|consen 306 DITDEVLWALGQHCH-NLQVLELSGCQQFSDRGFTMLG-RN---CPHLERLDLEECGLITD 361 (483)
T ss_pred CCchHHHHHHhcCCC-ceEEEeccccchhhhhhhhhhh-cC---Chhhhhhcccccceehh
Confidence 7666 446667777 77777777777 7777777765 22 33444444444444333
|
|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >smart00256 FBOX A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
| >PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG2997 consensus F-box protein FBX9 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03215 ascorbic acid mannose pathway regulator 1; Provisional | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13013 F-box-like_2: F-box-like domain | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PF09372 PRANC: PRANC domain; InterPro: IPR018272 This presumed domain is found at the C terminus of a variety of Pox virus proteins | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG3735 consensus Tropomodulin and leiomodulin [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 309 | |||
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 4e-24 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 3e-16 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 3e-13 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 2e-22 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 5e-18 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-17 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 2e-16 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 7e-16 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 3e-18 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 1e-17 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 1e-16 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 1e-16 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 1e-15 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 5e-15 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 9e-06 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 2e-16 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 1e-12 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 8e-12 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 2e-09 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 4e-08 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 6e-08 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 2e-11 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 5e-11 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 2e-09 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 8e-11 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 1e-07 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 1e-06 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 4e-09 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 2e-08 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 5e-07 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 6e-06 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 1e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-07 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 7e-07 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 1e-06 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 2e-05 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 7e-07 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 1e-05 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 1e-05 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-05 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 2e-05 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 3e-04 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 2e-05 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 6e-04 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 4e-05 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 1e-04 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-04 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 2e-04 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 3e-04 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 4e-04 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 4e-04 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 6e-04 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 6e-04 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 8e-04 |
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
Score = 99.2 bits (247), Expect = 4e-24
Identities = 48/265 (18%), Positives = 87/265 (32%), Gaps = 47/265 (17%)
Query: 6 AEQESCDWTQLPADVTSTILSKIGAIDVLTSAQRVCSSWLRICHDPAMWRNIDMHN---- 61
W LP ++ I S + + L VC W R+ D ++W+ +D+
Sbjct: 2 ENFPGVSWDSLPDELLLGIFSCLCLPE-LLKVSGVCKRWYRLASDESLWQTLDLTGKNLH 60
Query: 62 ---LGDLWDMDHDLEKMCRHAVD------RSNGQLLSINIEY-FGTDELLQYIANRSRNL 111
G L + R +D S ++ +++ L I ++ L
Sbjct: 61 PDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKL 120
Query: 112 RN------------------------LRLVSCYNISDQGFCEAIKGFPLLEELELSYCS- 146
+N L L C S+ + L+EL LS+C
Sbjct: 121 QNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFD 180
Query: 147 LSQEALE-AVGSLCPLLRSFKLNNRGHRCPKIECDDDAKAIAENMHGLRHLQLFG-NELT 204
+++ ++ AV + + L+ K D + L HL L L
Sbjct: 181 FTEKHVQVAVAHVSETITQLNLS----GYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLK 236
Query: 205 NVGLQAILDACPHLESLDLRQCFNV 229
N Q +L+ L L +C+++
Sbjct: 237 NDCFQEFFQ-LNYLQHLSLSRCYDI 260
|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Length = 53 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 309 | |||
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.97 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.92 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.89 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.72 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.69 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.68 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.6 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.58 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.57 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.55 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.55 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.49 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 99.48 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.47 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.42 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.37 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.31 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.22 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 99.19 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 99.17 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 99.16 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.15 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.14 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.12 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.11 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.11 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.1 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.09 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.07 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.04 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.04 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.03 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.02 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.01 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.01 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.01 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.0 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.99 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.98 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.98 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.97 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.97 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.95 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.95 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.94 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.94 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.93 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.93 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.92 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.92 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.92 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.91 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.89 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.89 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.89 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.88 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.88 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.88 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.87 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.87 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.86 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.86 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.85 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.85 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.84 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.83 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.83 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.82 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.81 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.81 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.8 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.8 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.8 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.78 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.78 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.77 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.75 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.74 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.74 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.73 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.73 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 98.73 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.71 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.7 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.7 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.7 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.69 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.69 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.69 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.69 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.67 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.67 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.67 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.67 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.66 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.66 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.66 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.66 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.65 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.65 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.65 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.64 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.62 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.62 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.61 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.6 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.6 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.6 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.59 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.59 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.59 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.57 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.57 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 98.57 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.55 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.55 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.53 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.51 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.51 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.51 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.49 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.47 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.47 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.46 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.42 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.36 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.34 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.34 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 98.31 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 98.3 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 98.28 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 98.27 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.25 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 98.22 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 98.2 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.11 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 98.06 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.04 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 98.03 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.98 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 97.96 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 97.95 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 97.9 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.89 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 97.83 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.82 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 97.82 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 97.78 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 97.71 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.71 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.64 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 97.59 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.59 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 97.43 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.36 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 97.28 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 97.15 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 97.02 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 96.7 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 96.31 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 95.63 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 95.48 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 88.22 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 84.44 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 84.0 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 82.73 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 82.63 |
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
Probab=99.97 E-value=5.4e-30 Score=221.52 Aligned_cols=259 Identities=19% Similarity=0.236 Sum_probs=200.5
Q ss_pred cCCCCCCCCcHHHHHHHhccCChhhhhhhhhhhcHHHHHhccCCCCCceeecCCCCCCcccchhHHHHHHHHHh------
Q 021667 8 QESCDWTQLPADVTSTILSKIGAIDVLTSAQRVCSSWLRICHDPAMWRNIDMHNLGDLWDMDHDLEKMCRHAVD------ 81 (309)
Q Consensus 8 ~~~~~~~~LP~eiL~~If~~L~~~d~~~~~~~Vcr~W~~~~~~~~l~~~i~l~~~~~~~~~~~~~~~~~~~~~~------ 81 (309)
.+...|++||+|+|.+||+||+..|+. +++.|||+|++++.+|.+|++++++... .....+..+....+.
T Consensus 4 ~~~~~~~~LP~eil~~If~~L~~~d~~-~~~~vc~~W~~~~~~~~~~~~l~l~~~~---~~~~~~~~~~~~~l~~L~l~~ 79 (336)
T 2ast_B 4 FPGVSWDSLPDELLLGIFSCLCLPELL-KVSGVCKRWYRLASDESLWQTLDLTGKN---LHPDVTGRLLSQGVIAFRCPR 79 (336)
T ss_dssp ---CCSSSSCHHHHHHHHTTSCHHHHH-HTTSSCHHHHHHHTCSTTSSEEECTTCB---CCHHHHHHHHHTTCSEEECTT
T ss_pred cccCChhhCCHHHHHHHHHhCCHHHHH-HHHHHHHHHHHHhcCchhheeecccccc---CCHHHHHhhhhccceEEEcCC
Confidence 456789999999999999999999995 9999999999999999999999998754 333333332211110
Q ss_pred ----------ccCCCceEEeccc-cCChHHHHHHHhcCCCccEEEeCCCCCCCHHHHHHHHhcCCCcCEEEecCC-CCCH
Q 021667 82 ----------RSNGQLLSINIEY-FGTDELLQYIANRSRNLRNLRLVSCYNISDQGFCEAIKGFPLLEELELSYC-SLSQ 149 (309)
Q Consensus 82 ----------~~~~~l~~l~l~~-~~~~~~l~~l~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~L~~~-~~~~ 149 (309)
...++++.++++. .+++..+..+...+++|++|++.++ .+++.....+. .+++|++|++++| .+++
T Consensus 80 n~l~~~~~~~~~~~~L~~L~L~~~~l~~~~~~~~~~~~~~L~~L~L~~~-~l~~~~~~~l~-~~~~L~~L~L~~~~~l~~ 157 (336)
T 2ast_B 80 SFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGL-RLSDPIVNTLA-KNSNLVRLNLSGCSGFSE 157 (336)
T ss_dssp CEECSCCCSCCCCBCCCEEECTTCEECHHHHHHHHTTBCCCSEEECTTC-BCCHHHHHHHT-TCTTCSEEECTTCBSCCH
T ss_pred ccccccchhhccCCCCCEEEccCCCcCHHHHHHHHhhCCCCCEEeCcCc-ccCHHHHHHHh-cCCCCCEEECCCCCCCCH
Confidence 1136788888854 5666667777788999999999977 67776666554 4999999999999 8998
Q ss_pred HHHHHHHhcCCCCcEEEeccC-CCCCCCcccchhHHHHHhcCC-CCcEEEecCC--ccChHHHHHHHHhCCCCCeeecCC
Q 021667 150 EALEAVGSLCPLLRSFKLNNR-GHRCPKIECDDDAKAIAENMH-GLRHLQLFGN--ELTNVGLQAILDACPHLESLDLRQ 225 (309)
Q Consensus 150 ~~~~~l~~~~~~L~~L~l~~~-~~~~~~~~~~~~~~~l~~~~~-~L~~L~l~~~--~i~~~~l~~l~~~~~~L~~L~l~~ 225 (309)
.++..+...+++|++|++++| .+. +..+......++ +|++|++++| .+++.++..++..+++|++|++++
T Consensus 158 ~~l~~~~~~~~~L~~L~l~~~~~l~------~~~~~~~~~~l~~~L~~L~l~~~~~~~~~~~l~~~~~~~~~L~~L~l~~ 231 (336)
T 2ast_B 158 FALQTLLSSCSRLDELNLSWCFDFT------EKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSD 231 (336)
T ss_dssp HHHHHHHHHCTTCCEEECCCCTTCC------HHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTT
T ss_pred HHHHHHHhcCCCCCEEcCCCCCCcC------hHHHHHHHHhcccCCCEEEeCCCcccCCHHHHHHHHhhCCCCCEEeCCC
Confidence 888888888999999999875 332 444555556899 9999999999 788888888888999999999999
Q ss_pred CCCcCc-hhHHHHHhHhccCceecCCCC-CCchhhhhhhhhhccCCcCCCCCCCCccccCCCC
Q 021667 226 CFNVNL-VGKLGKICAERIRDLRHPNDS-THDYEFGADFQDFCWSSVEDYPSGISDIELVSDE 286 (309)
Q Consensus 226 c~~~~~-~~~l~~~~~~~L~~L~l~~~~-~~d~~~~~~~~~~c~~~~~l~~~~~s~~~~~~d~ 286 (309)
|..+++ .......++ +|++|++++|. +++.++..+. ..+.|+.+++++| +++.
T Consensus 232 ~~~l~~~~~~~l~~l~-~L~~L~l~~~~~~~~~~~~~l~-----~~~~L~~L~l~~~--i~~~ 286 (336)
T 2ast_B 232 SVMLKNDCFQEFFQLN-YLQHLSLSRCYDIIPETLLELG-----EIPTLKTLQVFGI--VPDG 286 (336)
T ss_dssp CTTCCGGGGGGGGGCT-TCCEEECTTCTTCCGGGGGGGG-----GCTTCCEEECTTS--SCTT
T ss_pred CCcCCHHHHHHHhCCC-CCCEeeCCCCCCCCHHHHHHHh-----cCCCCCEEeccCc--cCHH
Confidence 986654 222334567 99999999995 7888887775 5678888999988 5553
|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 309 | ||||
| d1koha1 | 162 | c.10.2.3 (A:201-362) mRNA export factor tap {Human | 1e-05 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 1e-05 | |
| d1fs1a1 | 41 | a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ | 4e-05 | |
| d1io0a_ | 166 | c.10.1.1 (A:) Tropomodulin C-terminal domain {Chic | 1e-04 | |
| d1pgva_ | 167 | c.10.1.1 (A:) Tropomodulin C-terminal domain {nema | 1e-04 | |
| d1p22a1 | 118 | a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (b | 6e-04 | |
| d2ovrb1 | 102 | a.158.1.1 (B:2263-2364) F-box/WD repeat-containing | 0.002 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 0.004 |
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: mRNA export factor tap domain: mRNA export factor tap species: Human (Homo sapiens) [TaxId: 9606]
Score = 42.5 bits (99), Expect = 1e-05
Identities = 30/163 (18%), Positives = 56/163 (34%), Gaps = 23/163 (14%)
Query: 71 DLEKMCRHAVDRSNGQLLSINIEYFGTDELLQYIAN-RSRNLRNLRLVSCYNISDQGFCE 129
+E++ R +G +++++ +D L N R+ + I +
Sbjct: 8 QVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSSMAATLRIIEEN---- 63
Query: 130 AIKGFPLLEELELSYCSLS-QEALEAVGSLCPLLRSFKLNNRGHRCPKIECDDDAKAIAE 188
P L L LS L + + ++ P L+ L+ E + +
Sbjct: 64 ----IPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGN-------ELKSERELDKI 112
Query: 189 NMHGLRHLQLFGNELTNV------GLQAILDACPHLESLDLRQ 225
L L L GN L++ + AI + P L LD +
Sbjct: 113 KGLKLEELWLDGNSLSDTFRDQSTYISAIRERFPKLLRLDGHE 155
|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 166 | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 167 | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 309 | |||
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.9 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.83 | |
| d1fs1a1 | 41 | Skp2 {Human (Homo sapiens) [TaxId: 9606]} | 99.53 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.35 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.27 | |
| d1nexb1 | 100 | Cdc4 F-box and linker domains {Baker's yeast (Sacc | 99.15 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.13 | |
| d2ovrb1 | 102 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 99.09 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.07 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 98.98 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 98.97 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 98.88 | |
| d1p22a1 | 118 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 98.82 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 98.78 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.77 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.76 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.7 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.68 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.66 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.61 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.53 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.52 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.48 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.47 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.43 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.41 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.41 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 98.34 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.3 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 98.25 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 98.2 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.07 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.04 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.0 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 97.92 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.76 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 97.73 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.62 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 97.32 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 97.21 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 97.13 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 97.11 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 96.87 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 96.59 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 95.95 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 93.39 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.90 E-value=2.2e-22 Score=167.59 Aligned_cols=216 Identities=19% Similarity=0.163 Sum_probs=170.4
Q ss_pred CCceeecCCCCCCcccchhHHHHHHHHHh----------------ccCCCceEEeccc-cCChHHHHHHHhcCCCccEEE
Q 021667 53 MWRNIDMHNLGDLWDMDHDLEKMCRHAVD----------------RSNGQLLSINIEY-FGTDELLQYIANRSRNLRNLR 115 (309)
Q Consensus 53 l~~~i~l~~~~~~~~~~~~~~~~~~~~~~----------------~~~~~l~~l~l~~-~~~~~~l~~l~~~~~~L~~L~ 115 (309)
+|+++++.... ..+..+..++..... .....++++++++ .+++..+..+..+|++|++|.
T Consensus 1 LW~~lDLs~~~---l~~~~l~~l~~~~~~~lrl~~~~~~~~~~~~~~~~~L~~LdLs~~~i~~~~l~~l~~~c~~L~~L~ 77 (284)
T d2astb2 1 LWQTLDLTGKN---LHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLS 77 (284)
T ss_dssp TSSEEECTTCB---CCHHHHHHHHHTTCSEEECTTCEECSCCCSCCCCBCCCEEECTTCEECHHHHHHHHTTBCCCSEEE
T ss_pred CcCEEECCCCC---CCchHHHHHHhccceEeeccccccccchhhhccCCCCCEEECCCCccCHHHHHHHHHhCCCccccc
Confidence 68899988654 344444444443211 1234678888864 678888899999999999999
Q ss_pred eCCCCCCCHHHHHHHHhcCCCcCEEEecCC-CCCHHHHHHHHhcCCCCcEEEeccCCCCCCCcccchhH-HHHHhcCCCC
Q 021667 116 LVSCYNISDQGFCEAIKGFPLLEELELSYC-SLSQEALEAVGSLCPLLRSFKLNNRGHRCPKIECDDDA-KAIAENMHGL 193 (309)
Q Consensus 116 l~~~~~~~~~~~~~~~~~~~~L~~L~L~~~-~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~~~~~~-~~l~~~~~~L 193 (309)
+.+| .+++..+..+. .+++|++|++++| .+++.++..++.+||+|++|++++| ..+. +..+ ..+...+++|
T Consensus 78 L~~~-~l~~~~~~~l~-~~~~L~~L~Ls~c~~itd~~l~~l~~~~~~L~~L~ls~c----~~~~-~~~~~~~~~~~~~~L 150 (284)
T d2astb2 78 LEGL-RLSDPIVNTLA-KNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWC----FDFT-EKHVQVAVAHVSETI 150 (284)
T ss_dssp CTTC-BCCHHHHHHHT-TCTTCSEEECTTCBSCCHHHHHHHHHHCTTCCEEECCCC----TTCC-HHHHHHHHHHSCTTC
T ss_pred cccc-CCCcHHHHHHh-cCCCCcCccccccccccccccchhhHHHHhccccccccc----cccc-cccchhhhccccccc
Confidence 9988 78888887765 5899999999998 8999999999999999999999873 2223 4444 4556567899
Q ss_pred cEEEecCC--ccChHHHHHHHHhCCCCCeeecCCCCCcCchh-HHHHHhHhccCceecCCCC-CCchhhhhhhhhhccCC
Q 021667 194 RHLQLFGN--ELTNVGLQAILDACPHLESLDLRQCFNVNLVG-KLGKICAERIRDLRHPNDS-THDYEFGADFQDFCWSS 269 (309)
Q Consensus 194 ~~L~l~~~--~i~~~~l~~l~~~~~~L~~L~l~~c~~~~~~~-~l~~~~~~~L~~L~l~~~~-~~d~~~~~~~~~~c~~~ 269 (309)
+.|++.++ .+++.++..++..||+|++|++++|..+++.. .....++ +|++|++++|. ++|.++..+. ..
T Consensus 151 ~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l~~~~-~L~~L~L~~C~~i~~~~l~~L~-----~~ 224 (284)
T d2astb2 151 TQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLN-YLQHLSLSRCYDIIPETLLELG-----EI 224 (284)
T ss_dssp CEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGGGGCT-TCCEEECTTCTTCCGGGGGGGG-----GC
T ss_pred chhhhcccccccccccccccccccccccccccccccCCCchhhhhhcccC-cCCEEECCCCCCCChHHHHHHh-----cC
Confidence 99999987 68999999999999999999999999888632 2334678 99999999986 9999998886 56
Q ss_pred cCCCCCCCCccccCCCC
Q 021667 270 VEDYPSGISDIELVSDE 286 (309)
Q Consensus 270 ~~l~~~~~s~~~~~~d~ 286 (309)
+.++.+++++| ++|.
T Consensus 225 ~~L~~L~l~~~--~~d~ 239 (284)
T d2astb2 225 PTLKTLQVFGI--VPDG 239 (284)
T ss_dssp TTCCEEECTTS--SCTT
T ss_pred CCCCEEeeeCC--CCHH
Confidence 78999999988 5554
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|