Citrus Sinensis ID: 021692

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
MGKFQERFVSFFNNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKQIARLGVAKDLGDSVGFLAGSLCEVLPIWGALLVGALQNFIGYGWVWLIVTGRAPVLPLWAMCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAILTQVYTMIHAPDHANLIFMVAVGPAMVVIALMFIIRPVGGHRQVRPSDSSSFTFIYSVCLLLAAYLMGVMLVEDLVDLNHTVIIIFTVILFVLLFIPIVIPIILSFFLERTDPAEEALLSKPENMEPGKSNQETDEVILSEGQEEEGTT
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHcHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHccccccccccccccccccccccccccccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHcHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHEEEEHHHEHHccccHHHHHHHHHHHHcccccccccEEEEEHcHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccEEEEEEEHcccccccccccccccccccccccccccccccccHHHHcccccc
MGKFQERFVSFFNNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKQIARLGVAKDLGDSVGFLAGSLCEVLPIWGALLVGALQNFIGYGWVWLIVTGRAPVLPLWAMCILIFVgnngetyfNTAALVSCVqnfpksrgpvvGILKGFAGLGGAILTQVYTMIHAPDHANLIFMVAVGPAMVVIALMFIIrpvgghrqvrpsdsssfTFIYSVCLLLAAYLMGVMLVEDLVDLNHTVIIIFTVILFVLLFIPIVIPIILSfflertdpaeeallskpenmepgksnqetdEVILsegqeeegtt
MGKFQERFVSFFNNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKQIARLGVAKDLGDSVGFLAGSLCEVLPIWGALLVGALQNFIGYGWVWLIVTGRAPVLPLWAMCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAILTQVYTMIHAPDHANLIFMVAVGPAMVVIALMFIIRPVGGHRQVRPSDSSSFTFIYSVCLLLAAYLMGVMLVEDLVDLNHTVIIIFTVILFVLLFIPIVIPIILSFFLERTDPAEEALlskpenmepgksnqetdevilsegqeeegtt
MGKFQERFVSFFNNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKQIARLGVAKDLGDSVGFLAGSLCEVLPIWGALLVGALQNFIGYGWVWLIVTGRAPVLPLWAMCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAILTQVYTMIHAPDHANLIFMVAVGPAMVVIALMFIIRPVGGHRQVRPSDSSSFTFIYSVCLLLAAYLMGVMLVEDLVDLNHtviiiftvilfvllfipivipiilsfflERTDPAEEALLSKPENMEPGKSNQETDEVILSEGQEEEGTT
*****ERFVSFFNNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKQIARLGVAKDLGDSVGFLAGSLCEVLPIWGALLVGALQNFIGYGWVWLIVTGRAPVLPLWAMCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAILTQVYTMIHAPDHANLIFMVAVGPAMVVIALMFIIRPVGGHRQVR***SSSFTFIYSVCLLLAAYLMGVMLVEDLVDLNHTVIIIFTVILFVLLFIPIVIPIILSFFLER***************************************
***********FNNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKQIARLGVAKDLGDSVGFLAGSLCEVLPIWGALLVGALQNFIGYGWVWLIVTGRAPVLPLWAMCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAILTQVYTMIHAPDHANLIFMVAVGPAMVVIALMFIIRPVGGHRQVRPSDSSSFTFIYSVCLLLAAYLMGVMLVEDLVDLNHTVIIIFTVILFVLLFIPIVIPIILSF*******************************************
MGKFQERFVSFFNNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKQIARLGVAKDLGDSVGFLAGSLCEVLPIWGALLVGALQNFIGYGWVWLIVTGRAPVLPLWAMCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAILTQVYTMIHAPDHANLIFMVAVGPAMVVIALMFIIRPVGGHRQVRPSDSSSFTFIYSVCLLLAAYLMGVMLVEDLVDLNHTVIIIFTVILFVLLFIPIVIPIILSFFLERTDPAEEALLSKPEN**********DEVILSEGQEEEGTT
*GKFQERFVSFFNNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKQIARLGVAKDLGDSVGFLAGSLCEVLPIWGALLVGALQNFIGYGWVWLIVTGRAPVLPLWAMCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAILTQVYTMIHAPDHANLIFMVAVGPAMVVIALMFIIRPVGGHRQVRPSDSSSFTFIYSVCLLLAAYLMGVMLVEDLVDLNHTVIIIFTVILFVLLFIPIVIPIILSFFLE****************************************
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKFQERFVSFFNNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKQIARLGVAKDLGDSVGFLAGSLCEVLPIWGALLVGALQNFIGYGWVWLIVTGRAPVLPLWAMCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAILTQVYTMIHAPDHANLIFMVAVGPAMVVIALMFIIRPVGGHRQVRPSDSSSFTFIYSVCLLLAAYLMGVMLVEDLVDLNHTVIIIFTVILFVLLFIPIVIPIILSFFLERTDPAEEALLSKPENMEPGKSNQETDEVILSEGQEEEGTT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query309
224060265 422 predicted protein [Populus trichocarpa] 0.990 0.725 0.830 1e-148
255536871 589 conserved hypothetical protein [Ricinus 0.990 0.519 0.823 1e-141
225451469 591 PREDICTED: uncharacterized protein LOC10 0.990 0.517 0.774 1e-138
225451471 591 PREDICTED: uncharacterized protein LOC10 0.990 0.517 0.771 1e-138
147853498 591 hypothetical protein VITISV_016786 [Viti 0.990 0.517 0.771 1e-137
226505910 595 uncharacterized protein LOC100279749 [Ze 0.990 0.514 0.717 1e-128
226495681 596 nodulin-like protein [Zea mays] gi|19565 0.990 0.513 0.707 1e-128
413921652 595 nodulin-like protein [Zea mays] 0.990 0.514 0.714 1e-127
242082081 595 hypothetical protein SORBIDRAFT_07g02614 0.974 0.505 0.719 1e-127
326502436 587 predicted protein [Hordeum vulgare subsp 0.990 0.521 0.719 1e-127
>gi|224060265|ref|XP_002300113.1| predicted protein [Populus trichocarpa] gi|222847371|gb|EEE84918.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  530 bits (1365), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 254/306 (83%), Positives = 278/306 (90%)

Query: 1   MGKFQERFVSFFNNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKQIARLGVAK 60
           MGK  ERF  F NNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQ+Q+A LGVAK
Sbjct: 1   MGKLHERFAGFINNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQRQLASLGVAK 60

Query: 61  DLGDSVGFLAGSLCEVLPIWGALLVGALQNFIGYGWVWLIVTGRAPVLPLWAMCILIFVG 120
           DLGDSVGFLAGSL E+LP+WGALLVGA+QN +GYGWVWL+VTGRAPVLPLWAMCILIF+G
Sbjct: 61  DLGDSVGFLAGSLSEILPLWGALLVGAVQNLVGYGWVWLVVTGRAPVLPLWAMCILIFIG 120

Query: 121 NNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAILTQVYTMIHAPDHANLIFMV 180
           NNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGL GAILTQ+Y  IH+PDHA+LIFMV
Sbjct: 121 NNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYATIHSPDHASLIFMV 180

Query: 181 AVGPAMVVIALMFIIRPVGGHRQVRPSDSSSFTFIYSVCLLLAAYLMGVMLVEDLVDLNH 240
           AVGPAMVVIALMFI+RPVGGHRQVRPSD +SFTF+Y VCLLLAAYLMGVML+EDLVDL+H
Sbjct: 181 AVGPAMVVIALMFIVRPVGGHRQVRPSDGTSFTFVYGVCLLLAAYLMGVMLLEDLVDLSH 240

Query: 241 TVIIIFTVILFVLLFIPIVIPIILSFFLERTDPAEEALLSKPENMEPGKSNQETDEVILS 300
           TV+IIFTV+LFVLL IPIVIP+ LSFFL+  DP EE LL +    EPGKS QET EVI S
Sbjct: 241 TVVIIFTVVLFVLLLIPIVIPVSLSFFLDPRDPVEEPLLPETPKQEPGKSGQETPEVIFS 300

Query: 301 EGQEEE 306
           E ++E+
Sbjct: 301 EVEDEK 306

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255536871|ref|XP_002509502.1| conserved hypothetical protein [Ricinus communis] gi|223549401|gb|EEF50889.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|225451469|ref|XP_002270737.1| PREDICTED: uncharacterized protein LOC100244537 [Vitis vinifera] gi|296082334|emb|CBI21339.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225451471|ref|XP_002270809.1| PREDICTED: uncharacterized protein LOC100266857 [Vitis vinifera] gi|296082332|emb|CBI21337.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147853498|emb|CAN82292.1| hypothetical protein VITISV_016786 [Vitis vinifera] Back     alignment and taxonomy information
>gi|226505910|ref|NP_001146179.1| uncharacterized protein LOC100279749 [Zea mays] gi|219886079|gb|ACL53414.1| unknown [Zea mays] Back     alignment and taxonomy information
>gi|226495681|ref|NP_001152103.1| nodulin-like protein [Zea mays] gi|195652627|gb|ACG45781.1| nodulin-like protein [Zea mays] Back     alignment and taxonomy information
>gi|413921652|gb|AFW61584.1| nodulin-like protein [Zea mays] Back     alignment and taxonomy information
>gi|242082081|ref|XP_002445809.1| hypothetical protein SORBIDRAFT_07g026140 [Sorghum bicolor] gi|241942159|gb|EES15304.1| hypothetical protein SORBIDRAFT_07g026140 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|326502436|dbj|BAJ95281.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326504364|dbj|BAJ91014.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query309
TAIR|locus:2078643 584 AT3G01930 [Arabidopsis thalian 0.977 0.517 0.690 3.8e-110
TAIR|locus:2174683 579 AT5G14120 [Arabidopsis thalian 0.967 0.516 0.681 3.4e-109
TAIR|locus:2159752 540 AT5G50520 [Arabidopsis thalian 0.721 0.412 0.619 1.7e-73
TAIR|locus:2832385 540 AT5G50630 [Arabidopsis thalian 0.721 0.412 0.619 1.7e-73
TAIR|locus:2046238 577 AT2G28120 [Arabidopsis thalian 0.737 0.395 0.437 7.7e-48
TAIR|locus:2056103 601 AT2G39210 "AT2G39210" [Arabido 0.750 0.386 0.423 1e-43
TAIR|locus:2059829 546 AT2G16660 [Arabidopsis thalian 0.747 0.423 0.380 1.2e-40
TAIR|locus:2198938 561 AT1G80530 "AT1G80530" [Arabido 0.711 0.392 0.363 1.1e-37
TAIR|locus:2116855 567 AT4G34950 [Arabidopsis thalian 0.705 0.384 0.35 3e-37
TAIR|locus:2040809 525 AT2G34350 [Arabidopsis thalian 0.737 0.434 0.345 3.9e-37
TAIR|locus:2078643 AT3G01930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1088 (388.1 bits), Expect = 3.8e-110, P = 3.8e-110
 Identities = 212/307 (69%), Positives = 242/307 (78%)

Query:     5 QERFVSFFNNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKQIARLGVAKDLGD 64
             +ER  SF NNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKQ++RLGVAKDLGD
Sbjct:     6 RERVKSFINNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKQLSRLGVAKDLGD 65

Query:    65 SVGFLAGSLCEVLPIWGALLVGALQNFIGYGWVWLIVTGRAPVLPLWAMCILIFVGNNGE 124
             SVGFLAG+L E+LP+W ALLVG++QN +GYGWVWLIVTGRAP+LPLWAMCILIFVGNNGE
Sbjct:    66 SVGFLAGTLSEILPLWAALLVGSVQNLVGYGWVWLIVTGRAPILPLWAMCILIFVGNNGE 125

Query:   125 TYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAILTQVYTMIHAPDHANLIFMVAVGP 184
             TYFNTAALVS VQNFPKSRGPVVGILKGFAGLGGAIL+QVYTMIH+ D A+LIFMVAV P
Sbjct:   126 TYFNTAALVSGVQNFPKSRGPVVGILKGFAGLGGAILSQVYTMIHSSDRASLIFMVAVAP 185

Query:   185 AMVVIALMFIIRPVGGHRQVRPSDSSSFTFIYSVCLLLAAYLMGVMLVEDLVDLNHXXXX 244
             ++VV+ LMF IRPVGGHRQ+R SD++SFT IY+VC+LLAAYLM VMLVED +DL+H    
Sbjct:   186 SVVVVPLMFFIRPVGGHRQIRSSDATSFTVIYAVCILLAAYLMAVMLVEDFIDLSHSIII 245

Query:   245 XXXXXXXXXXXXXXXXXXXXXXXXERTDPA---EEALLSKPENMEPGKSN--QETDEVIL 299
                                       TDP    EE LL   +  +PG+S       E+I 
Sbjct:   246 AFTVVLFAILLVPIFIPIATSCFTASTDPCDTLEEPLLGDQQGQDPGQSTTPDHGPELIF 305

Query:   300 SEGQEEE 306
             SE ++E+
Sbjct:   306 SEVEDEK 312
GO:0005886 "plasma membrane" evidence=ISM
TAIR|locus:2174683 AT5G14120 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2159752 AT5G50520 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2832385 AT5G50630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046238 AT2G28120 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2056103 AT2G39210 "AT2G39210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2059829 AT2G16660 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2198938 AT1G80530 "AT1G80530" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116855 AT4G34950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040809 AT2G34350 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_LG_I3108
hypothetical protein (422 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query309
pfam06813248 pfam06813, Nodulin-like, Nodulin-like 1e-109
PTZ00207 591 PTZ00207, PTZ00207, hypothetical protein; Provisio 8e-04
>gnl|CDD|219187 pfam06813, Nodulin-like, Nodulin-like Back     alignment and domain information 
 Score =  317 bits (815), Expect = e-109
 Identities = 111/248 (44%), Positives = 155/248 (62%)

Query: 15  RWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKQIARLGVAKDLGDSVGFLAGSLC 74
           RWL  VAA+WIQS AG  Y F   S  +KSSL Y+Q Q+  LGVAKDLG + G+L+G   
Sbjct: 1   RWLGLVAAIWIQSFAGANYDFSLYSSALKSSLGYSQVQLNLLGVAKDLGKNFGWLSGLAA 60

Query: 75  EVLPIWGALLVGALQNFIGYGWVWLIVTGRAPVLPLWAMCILIFVGNNGETYFNTAALVS 134
           E LP W  LLVGA   F+GYG  WL VTG+ P LP W +C+ I +  N   +FNTA+LV+
Sbjct: 61  EYLPPWVVLLVGAAMGFVGYGVQWLAVTGKIPGLPYWLLCLAICLAGNSICWFNTASLVT 120

Query: 135 CVQNFPKSRGPVVGILKGFAGLGGAILTQVYTMIHAPDHANLIFMVAVGPAMVVIALMFI 194
           C++NFP+SRG V+GILKG+AGL  AI TQ+YT I   D ++L+ + A+ P +V +  ++ 
Sbjct: 121 CIRNFPESRGVVLGILKGYAGLSAAIYTQLYTAIFGNDASSLLLLNALVPLVVSLVALYF 180

Query: 195 IRPVGGHRQVRPSDSSSFTFIYSVCLLLAAYLMGVMLVEDLVDLNHTVIIIFTVILFVLL 254
           IRP  G    + S+S  F     + + LA YL+ + ++    DL+         I+ +LL
Sbjct: 181 IRPCPGKVGEQRSESVVFLVFNVLSVALAVYLVAMSILSKSFDLSSAEYYALGAIMVLLL 240

Query: 255 FIPIVIPI 262
            +P+ +PI
Sbjct: 241 LVPLAVPI 248

This family represents a conserved region within plant nodulin-like proteins. Length = 248
>gnl|CDD|140234 PTZ00207, PTZ00207, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 309
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 100.0
PTZ00207 591 hypothetical protein; Provisional 100.0
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 99.78
KOG2504 509 consensus Monocarboxylate transporter [Carbohydrat 99.64
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 99.63
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 99.63
TIGR00891 405 2A0112 putative sialic acid transporter. 99.63
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 99.62
PRK03545390 putative arabinose transporter; Provisional 99.61
PRK09705393 cynX putative cyanate transporter; Provisional 99.61
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 99.58
PRK11663 434 regulatory protein UhpC; Provisional 99.57
PRK03699394 putative transporter; Provisional 99.56
PRK10213394 nepI ribonucleoside transporter; Reviewed 99.55
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.55
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 99.55
TIGR00892 455 2A0113 monocarboxylate transporter 1. 99.55
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 99.53
TIGR00895398 2A0115 benzoate transport. 99.53
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.52
PRK12307 426 putative sialic acid transporter; Provisional 99.52
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 99.51
PRK14995 495 methyl viologen resistance protein SmvA; Provision 99.51
TIGR00881379 2A0104 phosphoglycerate transporter family protein 99.49
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 99.48
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 99.48
PRK03893 496 putative sialic acid transporter; Provisional 99.48
TIGR00893 399 2A0114 d-galactonate transporter. 99.47
PRK10473392 multidrug efflux system protein MdtL; Provisional 99.47
PLN00028 476 nitrate transmembrane transporter; Provisional 99.47
PRK11646 400 multidrug resistance protein MdtH; Provisional 99.46
PRK10091382 MFS transport protein AraJ; Provisional 99.45
PRK05122399 major facilitator superfamily transporter; Provisi 99.45
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.45
PRK10054395 putative transporter; Provisional 99.44
PRK15403 413 multidrug efflux system protein MdtM; Provisional 99.42
PRK12382392 putative transporter; Provisional 99.42
TIGR00897402 2A0118 polyol permease family. This family of prot 99.41
PRK11652394 emrD multidrug resistance protein D; Provisional 99.41
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.4
TIGR00900365 2A0121 H+ Antiporter protein. 99.4
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 99.4
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.39
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 99.39
TIGR00896355 CynX cyanate transporter. This family of proteins 99.39
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 99.39
PRK10406 432 alpha-ketoglutarate transporter; Provisional 99.37
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 99.36
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 99.36
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 99.35
PRK11043 401 putative transporter; Provisional 99.35
PRK10207 489 dipeptide/tripeptide permease B; Provisional 99.35
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 99.33
PRK10133 438 L-fucose transporter; Provisional 99.33
PRK10504 471 putative transporter; Provisional 99.33
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 99.32
PRK10077 479 xylE D-xylose transporter XylE; Provisional 99.32
PRK09874 408 drug efflux system protein MdtG; Provisional 99.31
PRK03633381 putative MFS family transporter protein; Provision 99.31
PRK10642 490 proline/glycine betaine transporter; Provisional 99.3
PRK10642490 proline/glycine betaine transporter; Provisional 99.28
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 99.28
PRK15462 493 dipeptide/tripeptide permease D; Provisional 99.27
PRK10489 417 enterobactin exporter EntS; Provisional 99.27
PRK09584 500 tppB putative tripeptide transporter permease; Rev 99.24
PRK11195 393 lysophospholipid transporter LplT; Provisional 99.24
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 99.24
TIGR00898 505 2A0119 cation transport protein. 99.22
PRK09952 438 shikimate transporter; Provisional 99.2
PRK15075 434 citrate-proton symporter; Provisional 99.19
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 99.18
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.18
PRK10406432 alpha-ketoglutarate transporter; Provisional 99.15
TIGR00901356 2A0125 AmpG-related permease. 99.15
KOG2532 466 consensus Permease of the major facilitator superf 99.14
PRK15011393 sugar efflux transporter B; Provisional 99.13
PRK15011393 sugar efflux transporter B; Provisional 99.11
PRK09528 420 lacY galactoside permease; Reviewed 99.11
PRK11902 402 ampG muropeptide transporter; Reviewed 99.08
PRK09528420 lacY galactoside permease; Reviewed 99.08
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 99.08
TIGR00889418 2A0110 nucleoside transporter. This family of prot 99.07
PRK03545390 putative arabinose transporter; Provisional 99.07
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.07
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 99.05
PRK11010 491 ampG muropeptide transporter; Validated 99.05
PRK10489417 enterobactin exporter EntS; Provisional 99.05
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 99.05
TIGR00897402 2A0118 polyol permease family. This family of prot 99.05
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.04
PRK09952438 shikimate transporter; Provisional 99.03
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 99.03
PRK15402406 multidrug efflux system translocase MdfA; Provisio 99.01
KOG1330 493 consensus Sugar transporter/spinster transmembrane 99.01
COG0738 422 FucP Fucose permease [Carbohydrate transport and m 98.99
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 98.99
PRK11010491 ampG muropeptide transporter; Validated 98.98
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 98.98
TIGR00902382 2A0127 phenyl proprionate permease family protein. 98.96
TIGR00805 633 oat sodium-independent organic anion transporter. 98.96
KOG3764 464 consensus Vesicular amine transporter [Intracellul 98.96
PRK15075434 citrate-proton symporter; Provisional 98.94
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 98.94
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 98.94
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 98.93
PRK05122399 major facilitator superfamily transporter; Provisi 98.91
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 98.9
PRK12307426 putative sialic acid transporter; Provisional 98.9
PRK03893496 putative sialic acid transporter; Provisional 98.89
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 98.89
TIGR00880141 2_A_01_02 Multidrug resistance protein. 98.88
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 98.88
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 98.87
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 98.87
PRK14995495 methyl viologen resistance protein SmvA; Provision 98.85
TIGR00902382 2A0127 phenyl proprionate permease family protein. 98.84
TIGR00711485 efflux_EmrB drug resistance transporter, EmrB/QacA 98.84
PRK11043401 putative transporter; Provisional 98.84
PRK10504471 putative transporter; Provisional 98.83
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 98.82
PRK10077479 xylE D-xylose transporter XylE; Provisional 98.82
TIGR00893399 2A0114 d-galactonate transporter. 98.82
PRK03699394 putative transporter; Provisional 98.81
PLN00028476 nitrate transmembrane transporter; Provisional 98.78
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 98.76
TIGR00900365 2A0121 H+ Antiporter protein. 98.76
PRK09874408 drug efflux system protein MdtG; Provisional 98.76
PRK12382392 putative transporter; Provisional 98.75
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 98.73
PRK11902402 ampG muropeptide transporter; Reviewed 98.73
TIGR00889 418 2A0110 nucleoside transporter. This family of prot 98.73
KOG0255 521 consensus Synaptic vesicle transporter SVOP and re 98.72
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 98.71
TIGR00901356 2A0125 AmpG-related permease. 98.71
KOG0569 485 consensus Permease of the major facilitator superf 98.7
KOG2563 480 consensus Permease of the major facilitator superf 98.7
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 98.7
PRK11663434 regulatory protein UhpC; Provisional 98.69
PRK10213394 nepI ribonucleoside transporter; Reviewed 98.69
PRK10473392 multidrug efflux system protein MdtL; Provisional 98.68
PRK09669 444 putative symporter YagG; Provisional 98.68
PRK09705393 cynX putative cyanate transporter; Provisional 98.67
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 98.67
PRK11652394 emrD multidrug resistance protein D; Provisional 98.67
TIGR00891405 2A0112 putative sialic acid transporter. 98.66
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 98.66
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 98.66
TIGR00895398 2A0115 benzoate transport. 98.65
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 98.63
PRK10091382 MFS transport protein AraJ; Provisional 98.63
PRK03633381 putative MFS family transporter protein; Provision 98.6
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 98.55
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 98.55
PRK11195393 lysophospholipid transporter LplT; Provisional 98.54
KOG0254 513 consensus Predicted transporter (major facilitator 98.54
PRK10133438 L-fucose transporter; Provisional 98.52
TIGR00892455 2A0113 monocarboxylate transporter 1. 98.52
PF05977524 MFS_3: Transmembrane secretion effector; InterPro: 98.52
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 98.52
PF13347 428 MFS_2: MFS/sugar transport protein 98.51
COG2807395 CynX Cyanate permease [Inorganic ion transport and 98.49
KOG2533 495 consensus Permease of the major facilitator superf 98.49
TIGR01272310 gluP glucose/galactose transporter. Disruption of 98.49
TIGR00898505 2A0119 cation transport protein. 98.48
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 98.48
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 98.48
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 98.47
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 98.45
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 98.45
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 98.44
PRK09848448 glucuronide transporter; Provisional 98.44
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 98.44
PRK10054395 putative transporter; Provisional 98.42
PRK11646400 multidrug resistance protein MdtH; Provisional 98.41
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 98.39
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 98.39
PRK10429 473 melibiose:sodium symporter; Provisional 98.37
KOG2615 451 consensus Permease of the major facilitator superf 98.36
COG2270438 Permeases of the major facilitator superfamily [Ge 98.33
PRK15403413 multidrug efflux system protein MdtM; Provisional 98.32
KOG0569485 consensus Permease of the major facilitator superf 98.32
PRK09848 448 glucuronide transporter; Provisional 98.31
TIGR00881379 2A0104 phosphoglycerate transporter family protein 98.31
TIGR00788 468 fbt folate/biopterin transporter. The only functio 98.3
COG3104 498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 98.28
KOG0252 538 consensus Inorganic phosphate transporter [Inorgan 98.27
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 98.23
TIGR00896355 CynX cyanate transporter. This family of proteins 98.23
PF13347428 MFS_2: MFS/sugar transport protein 98.17
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 98.11
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 98.11
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 98.07
KOG2504509 consensus Monocarboxylate transporter [Carbohydrat 98.05
PRK10207489 dipeptide/tripeptide permease B; Provisional 97.9
PRK11462 460 putative transporter; Provisional 97.9
PF05631354 DUF791: Protein of unknown function (DUF791); Inte 97.89
PRK10429473 melibiose:sodium symporter; Provisional 97.81
PRK09669444 putative symporter YagG; Provisional 97.79
COG2211 467 MelB Na+/melibiose symporter and related transport 97.74
KOG0253 528 consensus Synaptic vesicle transporter SV2 (major 97.73
KOG0254513 consensus Predicted transporter (major facilitator 97.71
TIGR00788468 fbt folate/biopterin transporter. The only functio 97.68
PRK09584500 tppB putative tripeptide transporter permease; Rev 97.68
TIGR00885410 fucP L-fucose:H+ symporter permease. This family d 97.67
KOG4686459 consensus Predicted sugar transporter [Carbohydrat 97.65
PF11700 477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 97.62
PF03092 433 BT1: BT1 family; InterPro: IPR004324 Members of th 97.61
KOG2325 488 consensus Predicted transporter/transmembrane prot 97.49
KOG2533495 consensus Permease of the major facilitator superf 97.46
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 97.39
PRK11462460 putative transporter; Provisional 97.25
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 97.25
COG2211467 MelB Na+/melibiose symporter and related transport 97.24
PF03825 400 Nuc_H_symport: Nucleoside H+ symporter 97.2
COG0738422 FucP Fucose permease [Carbohydrate transport and m 97.18
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 97.18
PF06609599 TRI12: Fungal trichothecene efflux pump (TRI12); I 97.11
COG2270 438 Permeases of the major facilitator superfamily [Ge 96.96
KOG0252538 consensus Inorganic phosphate transporter [Inorgan 96.94
PF01306 412 LacY_symp: LacY proton/sugar symporter; InterPro: 96.92
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 96.9
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 96.9
COG0477338 ProP Permeases of the major facilitator superfamil 96.88
KOG2532466 consensus Permease of the major facilitator superf 96.83
KOG3098461 consensus Uncharacterized conserved protein [Funct 96.76
KOG0253528 consensus Synaptic vesicle transporter SV2 (major 96.7
KOG0255521 consensus Synaptic vesicle transporter SVOP and re 96.62
KOG4686 459 consensus Predicted sugar transporter [Carbohydrat 96.51
PF1283277 MFS_1_like: MFS_1 like family 96.18
PF0677985 DUF1228: Protein of unknown function (DUF1228); In 96.11
TIGR01272310 gluP glucose/galactose transporter. Disruption of 96.1
COG2807395 CynX Cyanate permease [Inorganic ion transport and 95.78
PF05978156 UNC-93: Ion channel regulatory protein UNC-93; Int 95.65
PRK03612 521 spermidine synthase; Provisional 95.53
KOG3764464 consensus Vesicular amine transporter [Intracellul 95.15
TIGR01301477 GPH_sucrose GPH family sucrose/H+ symporter. This 95.12
KOG2816 463 consensus Predicted transporter ADD1 (major facili 95.07
KOG2816463 consensus Predicted transporter ADD1 (major facili 95.04
PF01770 412 Folate_carrier: Reduced folate carrier; InterPro: 94.98
TIGR00805633 oat sodium-independent organic anion transporter. 94.9
KOG3762618 consensus Predicted transporter [General function 94.0
TIGR00769 472 AAA ADP/ATP carrier protein family. These proteins 93.81
PRK15462493 dipeptide/tripeptide permease D; Provisional 92.64
KOG3098 461 consensus Uncharacterized conserved protein [Funct 91.97
PTZ00207591 hypothetical protein; Provisional 91.93
PF03137 539 OATP: Organic Anion Transporter Polypeptide (OATP) 91.12
PF06963432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 91.06
PF02487402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 90.84
KOG2563480 consensus Permease of the major facilitator superf 90.66
TIGR00806511 rfc RFC reduced folate carrier. Proteins of the RF 89.55
PRK13387317 1,4-dihydroxy-2-naphthoate octaprenyltransferase; 87.81
PF06027334 DUF914: Eukaryotic protein of unknown function (DU 86.83
PF10225249 DUF2215: Uncharacterized conserved protein (DUF221 86.44
KOG2615451 consensus Permease of the major facilitator superf 86.34
PF01770412 Folate_carrier: Reduced folate carrier; InterPro: 85.37
KOG3626735 consensus Organic anion transporter [Secondary met 81.92
PRK07419304 1,4-dihydroxy-2-naphthoate octaprenyltransferase; 81.32
KOG3762 618 consensus Predicted transporter [General function 80.76
PF03219 491 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 80.14
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information 
Probab=100.00  E-value=4.7e-53  Score=384.54  Aligned_cols=248  Identities=46%  Similarity=0.937  Sum_probs=239.4

Q ss_pred             hHHHHHHHHHHHHHhhhhhhHHhhHHHHHHhhCCCHHHHHHHHHHHHHHhhhhhhhhhhccccchHHHHHHHHHHHHHHH
Q 021692           15 RWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKQIARLGVAKDLGDSVGFLAGSLCEVLPIWGALLVGALQNFIGY   94 (309)
Q Consensus        15 rw~~l~~~~l~~~~~g~~Y~fsvys~~l~~~lg~s~~~~~~i~~~~~vg~~~~~~~G~L~Dr~Gpr~vllig~~l~~~gy   94 (309)
                      ||..+++++|+|.++|+.|.|++|+|++|+++|+||+|++++++++++|.++|+++|.++||+|||.++++|+++.++||
T Consensus         1 rW~~l~a~~~v~~~~Gt~Y~Fs~yS~~Lk~~l~~sq~~l~~l~~~~~~G~~~G~~~G~l~d~~gp~~~l~iG~~~~~~GY   80 (250)
T PF06813_consen    1 RWLSLVASIWVQLCSGTTYTFSAYSPQLKSRLGYSQSQLNTLSTAGDIGSYFGILAGLLYDRFGPWVVLLIGAVLGFVGY   80 (250)
T ss_pred             ChhhHHHHHHHHHhcCcccchhhhhHHHHHHhCCCHHHHHHHHHHHHHHhhccHHHHHHHHhcchHHHHHHHHHHHHHHH
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhCCCCChhHHHHHHHHHHHHhchhhhhhhHHHHHhhhcCCCCCcchhhhhhhhhhhHHHHHHHHHHHccCChH
Q 021692           95 GWVWLIVTGRAPVLPLWAMCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAILTQVYTMIHAPDHA  174 (309)
Q Consensus        95 ~l~~l~~~~~i~~~s~~~l~~~~~l~g~g~~~~~~~~~~~~~~~FP~~RG~avGi~~~~~GLg~ai~~~i~~~~~~~~~~  174 (309)
                      .++|++++++++++++|++|++.+++++|++++|++++++++||||++||+++|++|++.|||++++++++.+++++|.+
T Consensus        81 ~~~~l~~~~~i~~~~~~~~~~~~~l~~~s~~~~~ta~lvt~~~NFP~~RG~vvgilk~~~GLSaai~t~i~~~~f~~~~~  160 (250)
T PF06813_consen   81 GLLWLAVSGRIPSLPVWLMCLFLFLGGNSSCWFNTASLVTCVRNFPRSRGTVVGILKGFFGLSAAIFTQIYSAFFGDDPS  160 (250)
T ss_pred             HHHHHHHhCccCccchHHHHHHHHHHcccHHHhhhHHHHHHHHhCccccCceehhhhHHHHhHHHHHHHHHHHHcCCChH
Confidence            99999999999767899999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHhhcccCCCC--CCCCCCCCcchhHHHHHHHHHHHHHHHHHhhhhhccCchhHHHHHHHHHHH
Q 021692          175 NLIFMVAVGPAMVVIALMFIIRPVGGH--RQVRPSDSSSFTFIYSVCLLLAAYLMGVMLVEDLVDLNHTVIIIFTVILFV  252 (309)
Q Consensus       175 ~~~l~la~~~~~v~l~~~~~ir~~p~~--~~~~~~~~~~f~~~~~~~~~l~~yl~~~~~~~~~~~~~~~~~~~~~~~~~~  252 (309)
                      .|++++++.+.++++++++++|++|++  ++++++|+++|...+++++++++|++++++++++.+++++.++.+++++++
T Consensus       161 ~fll~la~~~~~v~l~~~~~vr~~~~~~~~~~~~~~~~~F~~~~~i~l~la~yLl~~~i~~~~~~~s~~~~~~~~~il~l  240 (250)
T PF06813_consen  161 SFLLFLAVLPAVVCLVAMFFVRPVPPSPSRTRQPSESKRFLFFFAIALALAIYLLVISILQNFVKLSRAARVIFAVILLL  240 (250)
T ss_pred             HHHHHHHHHHHHHHHHHhhheeccCCccccccCcchhHHHHHHHHHHHHHHHHHHHHHHHhcccCCCHHHHHHHHHHHHH
Confidence            999999999999999999999998863  455678889999999999999999999999999999999999999999999


Q ss_pred             HHHHhHHHhh
Q 021692          253 LLFIPIVIPI  262 (309)
Q Consensus       253 ll~~~~~v~~  262 (309)
                      ++++|++||+
T Consensus       241 lL~~Pl~i~~  250 (250)
T PF06813_consen  241 LLLLPLAIPV  250 (250)
T ss_pred             HHHhhhhccC
Confidence            9999999985

>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>KOG2504 consensus Monocarboxylate transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>KOG2532 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>KOG1330 consensus Sugar transporter/spinster transmembrane protein [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>KOG3764 consensus Vesicular amine transporter [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>KOG0255 consensus Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>KOG0569 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2563 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>KOG0254 consensus Predicted transporter (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2533 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>KOG2615 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>KOG0569 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0252 consensus Inorganic phosphate transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>KOG2504 consensus Monocarboxylate transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>PF05631 DUF791: Protein of unknown function (DUF791); InterPro: IPR008509 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0253 consensus Synaptic vesicle transporter SV2 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>KOG0254 consensus Predicted transporter (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>KOG4686 consensus Predicted sugar transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>KOG2325 consensus Predicted transporter/transmembrane protein [General function prediction only] Back     alignment and domain information
>KOG2533 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>KOG0252 consensus Inorganic phosphate transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>COG0477 ProP Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG2532 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3098 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0253 consensus Synaptic vesicle transporter SV2 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>KOG0255 consensus Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>KOG4686 consensus Predicted sugar transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF12832 MFS_1_like: MFS_1 like family Back     alignment and domain information
>PF06779 DUF1228: Protein of unknown function (DUF1228); InterPro: IPR010645 This entry represents the N terminus of several putative bacterial membrane proteins, which may be sugar transporters Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF05978 UNC-93: Ion channel regulatory protein UNC-93; InterPro: IPR010291 The proteins in this family are represented by UNC-93 from Caenorhabditis elegans Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>KOG3764 consensus Vesicular amine transporter [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>KOG2816 consensus Predicted transporter ADD1 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>KOG2816 consensus Predicted transporter ADD1 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>KOG3762 consensus Predicted transporter [General function prediction only] Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>KOG3098 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>KOG2563 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>PRK13387 1,4-dihydroxy-2-naphthoate octaprenyltransferase; Provisional Back     alignment and domain information
>PF06027 DUF914: Eukaryotic protein of unknown function (DUF914); InterPro: IPR009262 This family consists of several hypothetical proteins of unknown function Back     alignment and domain information
>PF10225 DUF2215: Uncharacterized conserved protein (DUF2215); InterPro: IPR024233 This entry represents a domain that is found in a number of different proteins, including a family of transmembrane proteins Back     alignment and domain information
>KOG2615 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>KOG3626 consensus Organic anion transporter [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07419 1,4-dihydroxy-2-naphthoate octaprenyltransferase; Provisional Back     alignment and domain information
>KOG3762 consensus Predicted transporter [General function prediction only] Back     alignment and domain information
>PF03219 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 These proteins are members of the ATP:ADP Antiporter (AAA) family, which consists of nucleotide transporters that have 12 GES predicted transmembrane regions Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query309
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 99.67
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 99.55
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 99.52
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 99.44
2xut_A 524 Proton/peptide symporter family protein; transport 99.32
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 99.19
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 99.07
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 98.93
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 98.93
2cfq_A 417 Lactose permease; transport, transport mechanism, 98.85
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 98.84
2cfq_A417 Lactose permease; transport, transport mechanism, 98.79
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 98.32
2xut_A524 Proton/peptide symporter family protein; transport 97.83
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
Probab=99.67  E-value=2.5e-14  Score=135.46  Aligned_cols=154  Identities=15%  Similarity=0.113  Sum_probs=125.1

Q ss_pred             ccchHHHHHHHHHHHHHhhh-hhhHHhhHHHHHHhhCCCHHHHHHHHHHHHHHhhh-hhhhhhhccccchHHHHHHHHHH
Q 021692           12 FNNRWLVFVAAMWIQSCAGI-GYLFGSISPVIKSSLNYNQKQIARLGVAKDLGDSV-GFLAGSLCEVLPIWGALLVGALQ   89 (309)
Q Consensus        12 ~~~rw~~l~~~~l~~~~~g~-~Y~fsvys~~l~~~lg~s~~~~~~i~~~~~vg~~~-~~~~G~L~Dr~Gpr~vllig~~l   89 (309)
                      .+++|..+.....+....+. .+.++.+.|.+++++|+|..+.+.+.+...++..+ .++.|++.||+|+|++++++.++
T Consensus        21 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~s~~~~g~~~~~~~~~~~i~~~~~G~l~dr~g~r~~l~~~~~~  100 (438)
T 3o7q_A           21 SRSYIIPFALLCSLFFLWAVANNLNDILLPQFQQAFTLTNFQAGLIQSAFYFGYFIIPIPAGILMKKLSYKAGIITGLFL  100 (438)
T ss_dssp             -CTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCCCSHHHHHHHHHHHHHHHTTHHHHHHHHHHSCHHHHHHHHHHH
T ss_pred             hhHhHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHHHHhHHHHHHHhcchHHHHHHHHH
Confidence            34556655554444444443 46777888999999999999999998888888876 66999999999999999999999


Q ss_pred             HHHHHHHHHHHHhCCCCChhHHHHHHHHHHHHhchhhhhhhHHHHHhhhcC-CCCCcchhhhhhhhhhhHHHHHHHHHHH
Q 021692           90 NFIGYGWVWLIVTGRAPVLPLWAMCILIFVGNNGETYFNTAALVSCVQNFP-KSRGPVVGILKGFAGLGGAILTQVYTMI  168 (309)
Q Consensus        90 ~~~gy~l~~l~~~~~i~~~s~~~l~~~~~l~g~g~~~~~~~~~~~~~~~FP-~~RG~avGi~~~~~GLg~ai~~~i~~~~  168 (309)
                      ..++..+.+.....    +++|.+.+...+.|.|.+..+++....+.+++| ++|+.+.|+..+..++|..+.+.+...+
T Consensus       101 ~~~~~~~~~~~~~~----~~~~~l~~~~~l~G~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~g~~~g~~~~~~l  176 (438)
T 3o7q_A          101 YALGAALFWPAAEI----MNYTLFLVGLFIIAAGLGCLETAANPFVTVLGPESSGHFRLNLAQTFNSFGAIIAVVFGQSL  176 (438)
T ss_dssp             HHHHHHHHHHHHHT----TCHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSCSTTHHHHHHHHHHHHHHHHHHHHHHTTHH
T ss_pred             HHHHHHHHHhcccc----ccHHHHHHHHHHHHhhHHHhhhhHHHHHHHHcCchhHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99888777443221    368888888889999999999999999999999 6799999999999999999888776655


Q ss_pred             c
Q 021692          169 H  169 (309)
Q Consensus       169 ~  169 (309)
                      .
T Consensus       177 ~  177 (438)
T 3o7q_A          177 I  177 (438)
T ss_dssp             H
T ss_pred             H
Confidence            4
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query309
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 99.64
d1pv7a_ 417 Lactose permease {Escherichia coli [TaxId: 562]} 99.2
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 99.01
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 98.88
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]

Probab=99.64  E-value=2.3e-16  Score=146.46  Aligned_cols=186  Identities=14%  Similarity=0.159  Sum_probs=135.7

Q ss_pred             ccchHHHHHHHHHHHHHhh-hhhhHHhhHHHHHHhhCCCHHHHHHHHHHHHHHhhh-hhhhhhhccccchHHHHHHHHHH
Q 021692           12 FNNRWLVFVAAMWIQSCAG-IGYLFGSISPVIKSSLNYNQKQIARLGVAKDLGDSV-GFLAGSLCEVLPIWGALLVGALQ   89 (309)
Q Consensus        12 ~~~rw~~l~~~~l~~~~~g-~~Y~fsvys~~l~~~lg~s~~~~~~i~~~~~vg~~~-~~~~G~L~Dr~Gpr~vllig~~l   89 (309)
                      .+.||.++...++...... ....+++..|.++ ++|+|.+|.+++.+...++..+ .++.|++.||+|+|+++.++.++
T Consensus        20 ~~~~w~i~~~~~~~~~~~~~~~~~~~~~~p~~~-~~g~s~~~~g~~~s~~~~~~~~~~~~~G~l~Dr~g~r~~~~~~~~~   98 (447)
T d1pw4a_          20 RRLRWQIFLGIFFGYAAYYLVRKNFALAMPYLV-EQGFSRGDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLIL   98 (447)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHTSHHHHHHHTT-SSTTCSSCHHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHHH
T ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HhCcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCchHHHHHHHHH
Confidence            4557887766655544333 3456777777776 5899999999998888888877 66999999999999999999999


Q ss_pred             HHHHHHHHHHHHhCCCCChhHHHHHHHHHHHHhchhhhhhhHHHHHhhhcC-CCCCcchhhhhhhhhhhHHHHHHHHHHH
Q 021692           90 NFIGYGWVWLIVTGRAPVLPLWAMCILIFVGNNGETYFNTAALVSCVQNFP-KSRGPVVGILKGFAGLGGAILTQVYTMI  168 (309)
Q Consensus        90 ~~~gy~l~~l~~~~~i~~~s~~~l~~~~~l~g~g~~~~~~~~~~~~~~~FP-~~RG~avGi~~~~~GLg~ai~~~i~~~~  168 (309)
                      ..++..+........   .+++.+.+...+.|.+.+..+.+....+.+|+| ++||.+.|+...+.++|+.+.+.+....
T Consensus        99 ~~~~~~~~~~~~~~~---~~~~~~~~~~~~~g~~~~~~~~~~~~~i~~~~~~~~r~~~~~~~~~~~~~g~~i~~~~~~~~  175 (447)
T d1pw4a_          99 AAAVMLFMGFVPWAT---SSIAVMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLG  175 (447)
T ss_dssp             HHHHHHHHHHCHHHH---SSSSHHHHHHHHHHHHHHHTHHHHHHHHHTTCTTTHHHHHHHHHHHHHHHHHTSHHHHHHHH
T ss_pred             HHHHHhhccccchhh---hhHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHhhcccccccccccccchhhhhhhhhhhhH
Confidence            888877765432110   146667777778888888888888899999999 5599999999998888888776654433


Q ss_pred             c--cCChHHHHHHHHHHHHHHHHHHHhhcccCCCC
Q 021692          169 H--APDHANLIFMVAVGPAMVVIALMFIIRPVGGH  201 (309)
Q Consensus       169 ~--~~~~~~~~l~la~~~~~v~l~~~~~ir~~p~~  201 (309)
                      .  .++++..+...++...++.++...++|++|.+
T Consensus       176 ~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~  210 (447)
T d1pw4a_         176 MAWFNDWHAALYMPAFCAILVALFAFAMMRDTPQS  210 (447)
T ss_dssp             HHHTCCSTTCTHHHHHHHHHHHHHHHHHCCCSSTT
T ss_pred             hhhhhcccccchhhhhhHHHHHHHHHHhcccchhh
Confidence            3  22333333345555556666777788877643
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure