Citrus Sinensis ID: 021698


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
MAENADAAAPHPLKIIAGADSFGAELKDALVSHLRSLNIDVEDLGTSDYYSIGAEVGRRVSSSDSSETTTRGLVACGTGVGVAIFANKNPGVFATTCLTPADALNTRSINNCNVLAVSGMSTSKESAVEILDTWLKTPFKAPCPASGLKPWDEKLSCFFDKSMTEMPLIGKNDKLDSDSSGSTCSICCLVKNRELNPVEMIPGGSMKIIRESPTSAIVRFKAGSVEPAHHHTFGHDLVVLEGKKSVWNLTKGERFDLTVGDYLFTPAGDVHRVKYYEETEFFIKWDGRWDMFFDEDLETAKKAVEKETA
cccccccccccccEEEEEcccccHHHHHHHHHHHHHccccEEEccccccccccHHHHHHHHHccccccccEEEEEEccHHHHHHHHcccccEEEEccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccEEEEEEcccHHHHHHcccccccccccccccccEEEEEccEEEEEEEccccccccccEEEEEccccEEEEEEEEccccEEEEcccccccccHHHHHHHHHHHHHcc
ccHcHHHccccccEEEEEcccccHHHHHHHHHHHHHcccEEEEccccccccccHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHccccccEEEcccHHHHHHHHHHHcccEEEEEcccEcHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcHHHHHHccccccccccccccccEEEEEccccccccccEcccccEEEEEEcccEEEEEEEcccccccccccccccEEEEEccEEEEEcccccEEEcccccEEEccccccEEEEEEEccEEEEEEccccEEEEcHHHHHHHHHHHHHcc
maenadaaaphplkIIAGADSFGAELKDALVSHLRSlnidvedlgtsdyysigaevgrrvsssdssetttrgLVACGTGVGVAIfanknpgvfattcltpadalntrsinNCNVLAVSGMSTSKESAVEILDTWlktpfkapcpasglkpwdeklscffdksmtempligkndkldsdssgstcsicclvknrelnpvemipggsmkiiresPTSAIVRfkagsvepahhhtfghdLVVLEGKKSvwnltkgerfdltvgdylftpagdvhrvkyYEETEFfikwdgrwdmfFDEDLETAKKAVEKETA
maenadaaaphplKIIAGADSFGAELKDALVSHLRSlnidvedlgtsDYYSIGAevgrrvsssdssetttRGLVACGTGVGVAIFANKNPGVFATTCLTPADALNTRSINNCNVLAVSGMSTSKESAVEILDTWLKTPFKAPCPASGLKPWDEKLSCFFDKSMTEMPLIGkndkldsdssgSTCSICClvknrelnpvemIPGGSMKIIRESPTSAIVRFKAGSVEPAHhhtfghdlvvlEGKKSVWNLTKGERFDLTVGDYLFTPAGDVHRVKYYEETEFFIKWDGRWDMFFDEDLETAKKAVEKETA
MAENADAAAPHPLKIIAGADSFGAELKDALVSHLRSLNIDVEDLGTSDYYSIGAEVGRRVSSSDSSETTTRGLVACGTGVGVAIFANKNPGVFATTCLTPADALNTRSINNCNVLAVSGMSTSKESAVEILDTWLKTPFKAPCPASGLKPWDEKLSCFFDKSMTEMPLIGKNDKLDSDSSGSTCSICCLVKNRELNPVEMIPGGSMKIIRESPTSAIVRFKAGSVEPAHHHTFGHDLVVLEGKKSVWNLTKGERFDLTVGDYLFTPAGDVHRVKYYEETEFFIKWDGRWDMFFDEDLETAKKAVEKETA
************LKIIAGADSFGAELKDALVSHLRSLNIDVEDLGTSDYYSIGAEV*************TRGLVACGTGVGVAIFANKNPGVFATTCLTPADALNTRSINNCNVLAVSGMSTSKESAVEILDTWLKTPFKAPCPASGLKPWDEKLSCFFDKSMT******************TCSICCLVKNRELNPVEMIPGGSMKIIRESPTSAIVRFKAGSVEPAHHHTFGHDLVVLEGKKSVWNLTKGERFDLTVGDYLFTPAGDVHRVKYYEETEFFIKWDGRWDMFFDED*************
*************KIIAGADSFGAELKDALVSHLRSLNIDVEDLGTSDYYSIGAEVGRRVSSSDSSETTTRGLVACGTGVGVAIFANKNPGVFATTCLTPADALNTRSINNCNVLAVSGMSTSKESAVEILDTWLKTPFKAPC**SGL*PWDEKLSC***************************SICCLVKNRELNPVEMIPGGSMKIIRESPTSAIVRFKAGSVEPAHHHTFGHDLVVLEGKKSVWNLTKGERFDLTVGDYLFTPAGDVHRVKYYEETEFFIKWDGRWDMFFDEDLET**********
*********PHPLKIIAGADSFGAELKDALVSHLRSLNIDVEDLGTSDYYSIGAEV**************RGLVACGTGVGVAIFANKNPGVFATTCLTPADALNTRSINNCNVLAVSGMSTSKESAVEILDTWLKTPFKAPCPASGLKPWDEKLSCFFDKSMTEMPLIGKND*********TCSICCLVKNRELNPVEMIPGGSMKIIRESPTSAIVRFKAGSVEPAHHHTFGHDLVVLEGKKSVWNLTKGERFDLTVGDYLFTPAGDVHRVKYYEETEFFIKWDGRWDMFFDEDLETA*********
**********HPLKIIAGADSFGAELKDALVSHLRSLNIDVEDLGTSDYYSIGAEVGRRVSSSDSSETTTRGLVACGTGVGVAIFANKNPGVFATTCLTPADALNTRSINNCNVLAVSGMSTSKESAVEILDTWLKTPFKAPCPASGLKPWDEKLSCFFDKSMTEMPLIG*********SGSTCSICCLVKNRELNPVEMIPGGSMKIIRESPTSAIVRFKAGSVEPAHHHTFGHDLVVLEGKKSVWNLTKGERFDLTVGDYLFTPAGDVHRVKYYEETEFFIKWDGRWDMFFDEDLETAKKAVE*E**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAENADAAAPHPLKIIAGADSFGAELKDALVSHLRSLNIDVEDLGTSDYYSIGAEVGRRVSSSDSSETTTRGLVACGTGVGVAIFANKNPGVFATTCLTPADALNTRSINNCNVLAVSGMSTSKESAVEILDTWLKTPFKAPCPASGLKPWDEKLSCFFDKSMTEMPLIGKNDKLDSDSSGSTCSICCLVKNRELNPVEMIPGGSMKIIRESPTSAIVRFKAGSVEPAHHHTFGHDLVVLEGKKSVWNLTKGERFDLTVGDYLFTPAGDVHRVKYYEETEFFIKWDGRWDMFFDEDLETAKKAVEKETA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query309 2.2.26 [Sep-21-2011]
Q05212310 DNA-damage-repair/tolerat yes no 0.974 0.970 0.698 1e-126
P37351149 Ribose-5-phosphate isomer N/A no 0.398 0.825 0.348 8e-12
P26424171 Galactose-6-phosphate iso yes no 0.414 0.748 0.317 3e-10
P53527152 Probable ribose-5-phospha yes no 0.414 0.842 0.287 1e-09
P47636152 Probable ribose-5-phospha yes no 0.404 0.822 0.305 3e-09
Q4L873171 Galactose-6-phosphate iso yes no 0.401 0.725 0.315 3e-09
Q8CRJ3171 Galactose-6-phosphate iso yes no 0.401 0.725 0.315 5e-09
Q5HM36171 Galactose-6-phosphate iso yes no 0.401 0.725 0.315 5e-09
Q8NZV7171 Galactose-6-phosphate iso N/A no 0.414 0.748 0.302 3e-08
Q48RC3171 Galactose-6-phosphate iso N/A no 0.440 0.795 0.317 3e-08
>sp|Q05212|DR102_ARATH DNA-damage-repair/toleration protein DRT102 OS=Arabidopsis thaliana GN=DRT102 PE=2 SV=2 Back     alignment and function desciption
 Score =  451 bits (1160), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 215/308 (69%), Positives = 251/308 (81%), Gaps = 7/308 (2%)

Query: 5   ADAAAPHPLKIIAGADSFGAELKDALVSHLRSLNIDVEDLGTSDYYSIGAEVGRRVSSSD 64
           A +A   PLKII GAD FGA LKDA+V+HLRSL IDVED G S YYS G+EVGRRVS+S 
Sbjct: 4   AVSAVDQPLKIITGADDFGASLKDAMVTHLRSLGIDVEDTGVSSYYSAGSEVGRRVSASS 63

Query: 65  SSETTTRGLVACGTGVGVAIFANKNPGVFATTCLTPADALNTRSINNCNVLAVSGMSTSK 124
           SSE   RGLV CGTGVGVA+FANK PGV+A TCL+  DA+N RSI+NCNVLA SG+ TS 
Sbjct: 64  SSEV--RGLVCCGTGVGVAMFANKFPGVYAATCLSVEDAVNARSISNCNVLAFSGIKTSP 121

Query: 125 ESAVEILDTWLKTPFKAPCPASGLKPWDEKLSCFFDKSMTEMPLIGKNDKLDS-----DS 179
           E+A+EI D W+KTPFK+PCPASG +PW   +S F D S++EM  IGK+   DS     D 
Sbjct: 122 ETALEIFDAWIKTPFKSPCPASGSEPWSSVISSFLDNSLSEMSQIGKSTAGDSTTKKIDE 181

Query: 180 SGSTCSICCLVKNRELNPVEMIPGGSMKIIRESPTSAIVRFKAGSVEPAHHHTFGHDLVV 239
           + ++C ICCL KNRE  PV+++PGGSMKI+RE+PTSAIVRFKAGSVEPAHHHTFGHDLVV
Sbjct: 182 TTASCVICCLAKNREFTPVDIMPGGSMKIVRETPTSAIVRFKAGSVEPAHHHTFGHDLVV 241

Query: 240 LEGKKSVWNLTKGERFDLTVGDYLFTPAGDVHRVKYYEETEFFIKWDGRWDMFFDEDLET 299
           ++GKKSVWNL+K ER DL  GDYLFTPAGDVHRVKY+E+TEFFI WDG WD+F DEDLET
Sbjct: 242 IKGKKSVWNLSKKERADLVDGDYLFTPAGDVHRVKYHEDTEFFITWDGHWDIFLDEDLET 301

Query: 300 AKKAVEKE 307
           AKKA+E+E
Sbjct: 302 AKKAIEEE 309





Arabidopsis thaliana (taxid: 3702)
>sp|P37351|RPIB_ECOLI Ribose-5-phosphate isomerase B OS=Escherichia coli (strain K12) GN=rpiB PE=1 SV=2 Back     alignment and function description
>sp|P26424|LACB_STRMU Galactose-6-phosphate isomerase subunit LacB OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=lacB PE=3 SV=2 Back     alignment and function description
>sp|P53527|RPIB_MYCPN Probable ribose-5-phosphate isomerase B OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=rpiB PE=1 SV=1 Back     alignment and function description
>sp|P47636|RPIB_MYCGE Probable ribose-5-phosphate isomerase B OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=rpiB PE=3 SV=1 Back     alignment and function description
>sp|Q4L873|LACB_STAHJ Galactose-6-phosphate isomerase subunit LacB OS=Staphylococcus haemolyticus (strain JCSC1435) GN=lacB PE=3 SV=1 Back     alignment and function description
>sp|Q8CRJ3|LACB_STAES Galactose-6-phosphate isomerase subunit LacB OS=Staphylococcus epidermidis (strain ATCC 12228) GN=lacB PE=3 SV=1 Back     alignment and function description
>sp|Q5HM36|LACB_STAEQ Galactose-6-phosphate isomerase subunit LacB OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=lacB PE=3 SV=1 Back     alignment and function description
>sp|Q8NZV7|LACB1_STRP8 Galactose-6-phosphate isomerase subunit LacB 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=lacB1 PE=3 SV=1 Back     alignment and function description
>sp|Q48RC3|LACB2_STRPM Galactose-6-phosphate isomerase subunit LacB 2 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=lacB2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query309
359487816312 PREDICTED: DNA-damage-repair/toleration 0.964 0.955 0.743 1e-131
147812118316 hypothetical protein VITISV_010562 [Viti 0.964 0.943 0.743 1e-131
225451267300 PREDICTED: DNA-damage-repair/toleration 0.964 0.993 0.743 1e-131
84468444302 putative DNA-damage-repair/toleration pr 0.935 0.956 0.756 1e-127
356573087300 PREDICTED: DNA-damage-repair/toleration 0.948 0.976 0.725 1e-127
255542356318 DNA-damage-repair/toleration protein DRT 0.974 0.946 0.703 1e-127
255639307300 unknown [Glycine max] 0.948 0.976 0.725 1e-126
357512241304 DNA-damage-repair/toleration protein DRT 0.941 0.957 0.75 1e-125
18397039310 DNA-damage-repair/toleration protein DRT 0.974 0.970 0.698 1e-124
224131318333 predicted protein [Populus trichocarpa] 0.951 0.882 0.689 1e-123
>gi|359487816|ref|XP_003633653.1| PREDICTED: DNA-damage-repair/toleration protein DRT102-like isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  475 bits (1223), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 229/308 (74%), Positives = 260/308 (84%), Gaps = 10/308 (3%)

Query: 1   MAENADAAAPHPLKIIAGADSFGAELKDALVSHLRSLNIDVEDLGTSDYYSIGAEVGRRV 60
           MAE+ +   PH  KI+ GADSFG  LK+ALVSHL+SLNI+VED+GT  YYS+ AE+GRRV
Sbjct: 1   MAEDGE---PHRFKIVTGADSFGCSLKEALVSHLKSLNIEVEDVGTDSYYSVAAEIGRRV 57

Query: 61  SSSDSSETTTRGLVACGTGVGVAIFANKNPGVFATTCLTPADALNTRSINNCNVLAVSGM 120
           SSS      TRGL+ACGTGVGVA+FANK PGVFA TCL+ ADALN RSINN NVLAVSGM
Sbjct: 58  SSSPED---TRGLLACGTGVGVAMFANKFPGVFAATCLSAADALNARSINNSNVLAVSGM 114

Query: 121 STSKESAVEILDTWLKTPFKAPCPASGLKPWDEKLSCFFDKSMTEMPLIGKNDKLDSDSS 180
           ST+ ESAVEILDTWLKTPFK+PCPAS  KPW +++  F D S++EM  IG      SDS 
Sbjct: 115 STAPESAVEILDTWLKTPFKSPCPASEFKPWPKEIESFLDNSVSEMSKIGSEKTKTSDS- 173

Query: 181 GSTCSICCLVKNRELNPVEMIPGGSMKIIRESPTSAIVRFKAGSVEPAHHHTFGHDLVVL 240
              CSICCLVKNRELNP+++IPGGSMKI+RESPTSA+VRF+AGSVEPAHHHTFGHDLVV+
Sbjct: 174 ---CSICCLVKNRELNPIDIIPGGSMKILRESPTSAVVRFEAGSVEPAHHHTFGHDLVVM 230

Query: 241 EGKKSVWNLTKGERFDLTVGDYLFTPAGDVHRVKYYEETEFFIKWDGRWDMFFDEDLETA 300
           +GKKSVWNLTK ERFDL VGDYL+TPAGDVHRVKYYE+TEFFIKWDG WDMFFDEDL TA
Sbjct: 231 KGKKSVWNLTKKERFDLIVGDYLYTPAGDVHRVKYYEDTEFFIKWDGHWDMFFDEDLATA 290

Query: 301 KKAVEKET 308
           K+A EKE+
Sbjct: 291 KEAAEKES 298




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147812118|emb|CAN65782.1| hypothetical protein VITISV_010562 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225451267|ref|XP_002277284.1| PREDICTED: DNA-damage-repair/toleration protein DRT102-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|84468444|dbj|BAE71305.1| putative DNA-damage-repair/toleration protein DRT102 [Trifolium pratense] Back     alignment and taxonomy information
>gi|356573087|ref|XP_003554696.1| PREDICTED: DNA-damage-repair/toleration protein DRT102-like [Glycine max] Back     alignment and taxonomy information
>gi|255542356|ref|XP_002512241.1| DNA-damage-repair/toleration protein DRT102, putative [Ricinus communis] gi|223548202|gb|EEF49693.1| DNA-damage-repair/toleration protein DRT102, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255639307|gb|ACU19951.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|357512241|ref|XP_003626409.1| DNA-damage-repair/toleration protein DRT102 [Medicago truncatula] gi|355501424|gb|AES82627.1| DNA-damage-repair/toleration protein DRT102 [Medicago truncatula] Back     alignment and taxonomy information
>gi|18397039|ref|NP_566241.1| DNA-damage-repair/toleration protein DRT102 [Arabidopsis thaliana] gi|148872800|sp|Q05212.2|DR102_ARATH RecName: Full=DNA-damage-repair/toleration protein DRT102 gi|15529165|gb|AAK97677.1| AT3g04880/T9J14_17 [Arabidopsis thaliana] gi|23505883|gb|AAN28801.1| At3g04880/T9J14_17 [Arabidopsis thaliana] gi|332640629|gb|AEE74150.1| DNA-damage-repair/toleration protein DRT102 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224131318|ref|XP_002328509.1| predicted protein [Populus trichocarpa] gi|222838224|gb|EEE76589.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query309
TAIR|locus:2114890310 DRT102 "DNA-DAMAGE-REPAIR/TOLE 0.974 0.970 0.698 9.1e-116
TIGR_CMR|CHY_2558159 CHY_2558 "ribose 5-phosphate i 0.414 0.805 0.356 3.7e-15
UNIPROTKB|P37351149 rpiB [Escherichia coli K-12 (t 0.398 0.825 0.348 3.5e-13
TIGR_CMR|GSU_1606148 GSU_1606 "ribose 5-phosphate i 0.378 0.790 0.349 1.3e-12
TIGR_CMR|CJE_1003145 CJE_1003 "ribose 5-phosphate i 0.407 0.868 0.299 1.7e-11
TIGR_CMR|BA_5560147 BA_5560 "sugar-phosphate isome 0.401 0.843 0.305 5e-10
TIGR_CMR|SPO_3180149 SPO_3180 "ribose 5-phosphate i 0.398 0.825 0.280 1.4e-09
TIGR_CMR|DET_0643152 DET_0643 "ribose-5-phosphate i 0.398 0.809 0.338 2.3e-09
TIGR_CMR|DET_0677152 DET_0677 "ribose-5-phosphate i 0.398 0.809 0.338 2.3e-09
TIGR_CMR|APH_0642143 APH_0642 "ribose 5-phosphate i 0.388 0.839 0.303 3.8e-09
TAIR|locus:2114890 DRT102 "DNA-DAMAGE-REPAIR/TOLERATION 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1141 (406.7 bits), Expect = 9.1e-116, P = 9.1e-116
 Identities = 215/308 (69%), Positives = 251/308 (81%)

Query:     5 ADAAAPHPLKIIAGADSFGAELKDALVSHLRSLNIDVEDLGTSDYYSIGAEVGRRVSSSD 64
             A +A   PLKII GAD FGA LKDA+V+HLRSL IDVED G S YYS G+EVGRRVS+S 
Sbjct:     4 AVSAVDQPLKIITGADDFGASLKDAMVTHLRSLGIDVEDTGVSSYYSAGSEVGRRVSASS 63

Query:    65 SSETTTRGLVACGTGVGVAIFANKNPGVFATTCLTPADALNTRSINNCNVLAVSGMSTSK 124
             SSE   RGLV CGTGVGVA+FANK PGV+A TCL+  DA+N RSI+NCNVLA SG+ TS 
Sbjct:    64 SSEV--RGLVCCGTGVGVAMFANKFPGVYAATCLSVEDAVNARSISNCNVLAFSGIKTSP 121

Query:   125 ESAVEILDTWLKTPFKAPCPASGLKPWDEKLSCFFDKSMTEMPLIGKNDKLDS-----DS 179
             E+A+EI D W+KTPFK+PCPASG +PW   +S F D S++EM  IGK+   DS     D 
Sbjct:   122 ETALEIFDAWIKTPFKSPCPASGSEPWSSVISSFLDNSLSEMSQIGKSTAGDSTTKKIDE 181

Query:   180 SGSTCSICCLVKNRELNPVEMIPGGSMKIIRESPTSAIVRFKAGSVEPAHHHTFGHDLVV 239
             + ++C ICCL KNRE  PV+++PGGSMKI+RE+PTSAIVRFKAGSVEPAHHHTFGHDLVV
Sbjct:   182 TTASCVICCLAKNREFTPVDIMPGGSMKIVRETPTSAIVRFKAGSVEPAHHHTFGHDLVV 241

Query:   240 LEGKKSVWNLTKGERFDLTVGDYLFTPAGDVHRVKYYEETEFFIKWDGRWDMFFDEDLET 299
             ++GKKSVWNL+K ER DL  GDYLFTPAGDVHRVKY+E+TEFFI WDG WD+F DEDLET
Sbjct:   242 IKGKKSVWNLSKKERADLVDGDYLFTPAGDVHRVKYHEDTEFFITWDGHWDIFLDEDLET 301

Query:   300 AKKAVEKE 307
             AKKA+E+E
Sbjct:   302 AKKAIEEE 309




GO:0005634 "nucleus" evidence=ISM;IDA
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0009409 "response to cold" evidence=IEP
GO:0005737 "cytoplasm" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0000719 "photoreactive repair" evidence=IGI
GO:0009411 "response to UV" evidence=IGI
TIGR_CMR|CHY_2558 CHY_2558 "ribose 5-phosphate isomerase B" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
UNIPROTKB|P37351 rpiB [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1606 GSU_1606 "ribose 5-phosphate isomerase B, putative" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|CJE_1003 CJE_1003 "ribose 5-phosphate isomerase B" [Campylobacter jejuni RM1221 (taxid:195099)] Back     alignment and assigned GO terms
TIGR_CMR|BA_5560 BA_5560 "sugar-phosphate isomerase, RpiB/LacA/LacB family" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_3180 SPO_3180 "ribose 5-phosphate isomerase B" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0643 DET_0643 "ribose-5-phosphate isomerase, putative" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0677 DET_0677 "ribose-5-phosphate isomerase, putative" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|APH_0642 APH_0642 "ribose 5-phosphate isomerase B" [Anaplasma phagocytophilum HZ (taxid:212042)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q05212DR102_ARATHNo assigned EC number0.69800.97410.9709yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.3.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00031130001
SubName- Full=Chromosome chr14 scaffold_54, whole genome shotgun sequence; (301 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00021387001
SubName- Full=Chromosome chr8 scaffold_23, whole genome shotgun sequence; (227 aa)
       0.526
GSVIVG00032161001
RecName- Full=Serine hydroxymethyltransferase; EC=2.1.2.1;; Interconversion of serine and glyci [...] (428 aa)
       0.523
GSVIVG00027807001
SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (471 aa)
       0.506
GSVIVG00026404001
SubName- Full=Chromosome chr15 scaffold_37, whole genome shotgun sequence; (620 aa)
     0.485
GSVIVG00038435001
SubName- Full=Chromosome chr16 scaffold_94, whole genome shotgun sequence; (620 aa)
     0.484
GSVIVG00007751001
SubName- Full=Chromosome undetermined scaffold_200, whole genome shotgun sequence; (518 aa)
      0.479
GSVIVG00015058001
RecName- Full=Serine hydroxymethyltransferase; EC=2.1.2.1;; Interconversion of serine and glyci [...] (516 aa)
       0.419

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query309
pfam02502140 pfam02502, LacAB_rpiB, Ribose/Galactose Isomerase 3e-41
COG0698151 COG0698, RpiB, Ribose 5-phosphate isomerase RpiB [ 2e-30
PRK05571148 PRK05571, PRK05571, ribose-5-phosphate isomerase B 4e-28
PTZ00215151 PTZ00215, PTZ00215, ribose 5-phosphate isomerase; 1e-22
TIGR00689144 TIGR00689, rpiB_lacA_lacB, sugar-phosphate isomera 1e-21
TIGR01120143 TIGR01120, rpiB, ribose 5-phosphate isomerase B 9e-19
PRK08622171 PRK08622, PRK08622, galactose-6-phosphate isomeras 8e-18
TIGR02133148 TIGR02133, RPI_actino, ribose 5-phosphate isomeras 9e-15
TIGR01119171 TIGR01119, lacB, galactose-6-phosphate isomerase, 6e-12
PRK12615171 PRK12615, PRK12615, galactose-6-phosphate isomeras 5e-09
pfam0788370 pfam07883, Cupin_2, Cupin domain 1e-07
PRK08621142 PRK08621, PRK08621, galactose-6-phosphate isomeras 8e-07
COG1917131 COG1917, COG1917, Uncharacterized conserved protei 1e-06
COG0662127 COG0662, {ManC}, Mannose-6-phosphate isomerase [Ca 4e-06
pfam1297391 pfam12973, Cupin_7, ChrR Cupin-like domain 2e-05
PRK09273211 PRK09273, PRK09273, hypothetical protein; Provisio 3e-05
>gnl|CDD|202262 pfam02502, LacAB_rpiB, Ribose/Galactose Isomerase Back     alignment and domain information
 Score =  139 bits (354), Expect = 3e-41
 Identities = 50/132 (37%), Positives = 72/132 (54%), Gaps = 9/132 (6%)

Query: 14  KIIAGADSFGAELKDALVSHLRSLNIDVEDLGTS-----DYYSIGAEVGRRVSSSDSSET 68
           KI  G+D  G ELK+A+  +L++   +V D+GT      DY     +V   V+S ++   
Sbjct: 1   KIAIGSDHAGFELKEAIKEYLKAKGYEVIDVGTYSGESVDYPDYAIKVAEAVASGEAD-- 58

Query: 69  TTRGLVACGTGVGVAIFANKNPGVFATTCLTPADALNTRSINNCNVLAVSGMSTSKESAV 128
             RG++ CGTG+G++I ANK PG+ A  C  P  A   R  NN NVL +       E A 
Sbjct: 59  --RGILICGTGIGMSIAANKVPGIRAALCHDPFSAELAREHNNANVLCLGARVIGPELAK 116

Query: 129 EILDTWLKTPFK 140
           EI+D +L T F+
Sbjct: 117 EIVDAFLATEFE 128


This family of proteins contains the sugar isomerase enzymes ribose 5-phosphate isomerase B (rpiB), galactose isomerase subunit A (LacA) and galactose isomerase subunit B (LacB). Length = 140

>gnl|CDD|223770 COG0698, RpiB, Ribose 5-phosphate isomerase RpiB [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|235509 PRK05571, PRK05571, ribose-5-phosphate isomerase B; Provisional Back     alignment and domain information
>gnl|CDD|185516 PTZ00215, PTZ00215, ribose 5-phosphate isomerase; Provisional Back     alignment and domain information
>gnl|CDD|129772 TIGR00689, rpiB_lacA_lacB, sugar-phosphate isomerase, RpiB/LacA/LacB family Back     alignment and domain information
>gnl|CDD|130190 TIGR01120, rpiB, ribose 5-phosphate isomerase B Back     alignment and domain information
>gnl|CDD|181506 PRK08622, PRK08622, galactose-6-phosphate isomerase subunit LacB; Reviewed Back     alignment and domain information
>gnl|CDD|211716 TIGR02133, RPI_actino, ribose 5-phosphate isomerase Back     alignment and domain information
>gnl|CDD|130189 TIGR01119, lacB, galactose-6-phosphate isomerase, LacB subunit Back     alignment and domain information
>gnl|CDD|171610 PRK12615, PRK12615, galactose-6-phosphate isomerase subunit LacB; Reviewed Back     alignment and domain information
>gnl|CDD|219618 pfam07883, Cupin_2, Cupin domain Back     alignment and domain information
>gnl|CDD|181505 PRK08621, PRK08621, galactose-6-phosphate isomerase subunit LacA; Reviewed Back     alignment and domain information
>gnl|CDD|224829 COG1917, COG1917, Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>gnl|CDD|223734 COG0662, {ManC}, Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|193446 pfam12973, Cupin_7, ChrR Cupin-like domain Back     alignment and domain information
>gnl|CDD|181746 PRK09273, PRK09273, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 309
PRK12613141 galactose-6-phosphate isomerase subunit LacA; Prov 100.0
TIGR01118141 lacA galactose-6-phosphate isomerase, LacA subunit 100.0
PRK08621142 galactose-6-phosphate isomerase subunit LacA; Revi 100.0
PRK05571148 ribose-5-phosphate isomerase B; Provisional 100.0
PRK08622171 galactose-6-phosphate isomerase subunit LacB; Revi 100.0
PTZ00215151 ribose 5-phosphate isomerase; Provisional 100.0
TIGR01119171 lacB galactose-6-phosphate isomerase, LacB subunit 100.0
TIGR01120143 rpiB ribose 5-phosphate isomerase B. Involved in t 100.0
PRK12615171 galactose-6-phosphate isomerase subunit LacB; Revi 100.0
TIGR02133148 RPI_actino ribose 5-phosphate isomerase. This fami 100.0
TIGR00689144 rpiB_lacA_lacB sugar-phosphate isomerases, RpiB/La 100.0
COG0698151 RpiB Ribose 5-phosphate isomerase RpiB [Carbohydra 100.0
PF02502140 LacAB_rpiB: Ribose/Galactose Isomerase; InterPro: 100.0
PRK09273211 hypothetical protein; Provisional 100.0
PF0788371 Cupin_2: Cupin domain; InterPro: IPR013096 This fa 99.44
PRK09943185 DNA-binding transcriptional repressor PuuR; Provis 99.41
PRK13290125 ectC L-ectoine synthase; Reviewed 99.25
COG0662127 {ManC} Mannose-6-phosphate isomerase [Carbohydrate 99.22
COG1917131 Uncharacterized conserved protein, contains double 99.22
TIGR01479468 GMP_PMI mannose-1-phosphate guanylyltransferase/ma 99.07
PF01050151 MannoseP_isomer: Mannose-6-phosphate isomerase; In 99.07
PRK15460478 cpsB mannose-1-phosphate guanyltransferase; Provis 99.05
PF1297391 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_ 99.02
TIGR03214260 ura-cupin putative allantoin catabolism protein. T 98.97
smart00835146 Cupin_1 Cupin. This family represents the conserve 98.95
PRK11171266 hypothetical protein; Provisional 98.95
TIGR03404367 bicupin_oxalic bicupin, oxalate decarboxylase fami 98.93
COG3837161 Uncharacterized conserved protein, contains double 98.89
PRK11171 266 hypothetical protein; Provisional 98.87
TIGR03214 260 ura-cupin putative allantoin catabolism protein. T 98.86
TIGR03404 367 bicupin_oxalic bicupin, oxalate decarboxylase fami 98.81
TIGR03037159 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase 98.79
PRK13264177 3-hydroxyanthranilate 3,4-dioxygenase; Provisional 98.77
PF00190144 Cupin_1: Cupin; InterPro: IPR006045 This family re 98.72
PF02311136 AraC_binding: AraC-like ligand binding domain; Int 98.72
COG4101142 Predicted mannose-6-phosphate isomerase [Carbohydr 98.71
PRK04190191 glucose-6-phosphate isomerase; Provisional 98.63
PF02041167 Auxin_BP: Auxin binding protein; InterPro: IPR0005 98.55
COG2140209 Thermophilic glucose-6-phosphate isomerase and rel 98.46
PRK15457233 ethanolamine utilization protein EutQ; Provisional 98.46
PRK10371 302 DNA-binding transcriptional regulator MelR; Provis 98.37
TIGR02451215 anti_sig_ChrR anti-sigma factor, putative, ChrR fa 98.36
PRK13501 290 transcriptional activator RhaR; Provisional 98.19
PRK10296 278 DNA-binding transcriptional regulator ChbR; Provis 98.15
PRK13500 312 transcriptional activator RhaR; Provisional 98.1
PRK13502 282 transcriptional activator RhaR; Provisional 98.06
COG3257 264 GlxB Uncharacterized protein, possibly involved in 98.06
PF1169985 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B. 98.03
TIGR02297 287 HpaA 4-hydroxyphenylacetate catabolism regulatory 98.02
PLN00212 493 glutelin; Provisional 97.95
PF14499 251 DUF4437: Domain of unknown function (DUF4437); PDB 97.92
PRK13503 278 transcriptional activator RhaS; Provisional 97.91
TIGR02272 335 gentisate_1_2 gentisate 1,2-dioxygenase. This fami 97.83
PF06052151 3-HAO: 3-hydroxyanthranilic acid dioxygenase; Inte 97.68
PF14499251 DUF4437: Domain of unknown function (DUF4437); PDB 97.65
TIGR02272335 gentisate_1_2 gentisate 1,2-dioxygenase. This fami 97.64
PF03079157 ARD: ARD/ARD' family; InterPro: IPR004313 The two 97.62
PF06249152 EutQ: Ethanolamine utilisation protein EutQ; Inter 97.6
PF05523131 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 97.54
PF06339126 Ectoine_synth: Ectoine synthase; InterPro: IPR0104 97.5
PF0589974 Cupin_3: Protein of unknown function (DUF861); Int 97.42
COG3435 351 Gentisate 1,2-dioxygenase [Secondary metabolites b 97.35
COG4766176 EutQ Ethanolamine utilization protein [Amino acid 97.26
PF06560182 GPI: Glucose-6-phosphate isomerase (GPI); InterPro 97.1
PLN00212493 glutelin; Provisional 97.01
COG1791181 Uncharacterized conserved protein, contains double 96.95
COG3435351 Gentisate 1,2-dioxygenase [Secondary metabolites b 96.8
COG3806216 ChrR Transcriptional activator [Transcription] 96.78
COG3257264 GlxB Uncharacterized protein, possibly involved in 96.52
PF02678107 Pirin: Pirin; InterPro: IPR003829 This entry repre 96.34
COG3822225 ABC-type sugar transport system, auxiliary compone 96.33
COG4297163 Uncharacterized protein containing double-stranded 96.33
PRK10572 290 DNA-binding transcriptional regulator AraC; Provis 96.18
KOG2107179 consensus Uncharacterized conserved protein, conta 96.16
PF05995175 CDO_I: Cysteine dioxygenase type I; InterPro: IPR0 95.95
COG3450116 Predicted enzyme of the cupin superfamily [General 95.94
PF0931382 DUF1971: Domain of unknown function (DUF1971); Int 95.85
PF05726104 Pirin_C: Pirin C-terminal cupin domain; InterPro: 95.81
COG1741 276 Pirin-related protein [General function prediction 95.46
PF08007319 Cupin_4: Cupin superfamily protein; InterPro: IPR0 95.31
PRK09685 302 DNA-binding transcriptional activator FeaR; Provis 94.36
PF12852186 Cupin_6: Cupin 94.25
PF14272115 Gly_rich_SFCGS: Glycine-rich SFCGS 94.23
COG1898173 RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and rela 94.21
PF13621251 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XU 93.89
PF04209 424 HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR 93.75
PRK02261137 methylaspartate mutase subunit S; Provisional 93.61
TIGR01221176 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase. This en 93.39
PF00908176 dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimer 93.11
PF02373114 JmjC: JmjC domain, hydroxylase; InterPro: IPR01312 92.98
PF07385225 DUF1498: Protein of unknown function (DUF1498); In 92.75
PF04962 261 KduI: KduI/IolB family; InterPro: IPR021120 The Kd 92.59
PHA00672152 hypothetical protein 92.58
TIGR03577115 EF_0830 conserved hypothetical protein EF_0830/AHA 91.93
TIGR00218302 manA mannose-6-phosphate isomerase, class I. The n 91.88
PF14525172 AraC_binding_2: AraC-binding-like domain 91.82
PF05118163 Asp_Arg_Hydrox: Aspartyl/Asparaginyl beta-hydroxyl 91.77
KOG3995 279 consensus 3-hydroxyanthranilate oxygenase HAAO [Am 91.2
TIGR01015 429 hmgA homogentisate 1,2-dioxygenase. Missing in hum 91.01
COG2850 383 Uncharacterized conserved protein [Function unknow 89.82
TIGR01501134 MthylAspMutase methylaspartate mutase, S subunit. 89.65
KOG2757411 consensus Mannose-6-phosphate isomerase [Carbohydr 89.26
PRK05341 438 homogentisate 1,2-dioxygenase; Provisional 88.73
PF1114263 DUF2917: Protein of unknown function (DUF2917); In 88.64
PRK12335 287 tellurite resistance protein TehB; Provisional 88.43
PF07847200 DUF1637: Protein of unknown function (DUF1637); In 88.42
COG1482312 ManA Phosphomannose isomerase [Carbohydrate transp 88.18
PRK15131389 mannose-6-phosphate isomerase; Provisional 87.95
PLN02658 435 homogentisate 1,2-dioxygenase 87.33
PLN02288394 mannose-6-phosphate isomerase 86.93
PF0230290 PTS_IIB: PTS system, Lactose/Cellobiose specific I 86.86
cd0556496 PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lic 85.22
TIGR0085395 pts-lac PTS system, lactose/cellobiose family IIB 83.38
PF0686594 DUF1255: Protein of unknown function (DUF1255); In 83.26
PF0369880 UPF0180: Uncharacterised protein family (UPF0180); 83.08
PRK1057994 hypothetical protein; Provisional 83.02
PRK09590104 celB cellobiose phosphotransferase system IIB comp 82.24
PRK00924 276 5-keto-4-deoxyuronate isomerase; Provisional 82.13
cd0556885 PTS_IIB_bgl_like PTS_IIB_bgl_like: the PTS (phosph 81.68
COG3508 427 HmgA Homogentisate 1,2-dioxygenase [Secondary meta 81.64
PF02878137 PGM_PMM_I: Phosphoglucomutase/phosphomannomutase, 81.55
PRK1031094 PTS system galactitol-specific transporter subunit 81.48
TIGR00640132 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal 81.48
cd0556689 PTS_IIB_galactitol PTS_IIB_galactitol: subunit IIB 81.25
TIGR00218302 manA mannose-6-phosphate isomerase, class I. The n 80.71
PF06719155 AraC_N: AraC-type transcriptional regulator N-term 80.66
PRK0309480 hypothetical protein; Provisional 80.64
>PRK12613 galactose-6-phosphate isomerase subunit LacA; Provisional Back     alignment and domain information
Probab=100.00  E-value=9.6e-57  Score=377.77  Aligned_cols=137  Identities=23%  Similarity=0.319  Sum_probs=132.8

Q ss_pred             cEEEEEeCcccHHHHHHHHHHHHhCCCcEEEecCC--CCcchhHHHHHHhhcCCCCCCcceEEEEecCchhhhhhhcCCC
Q 021698           13 LKIIAGADSFGAELKDALVSHLRSLNIDVEDLGTS--DYYSIGAEVGRRVSSSDSSETTTRGLVACGTGVGVAIFANKNP   90 (309)
Q Consensus        13 mkI~ig~D~~g~~lk~~l~~~l~~~g~~v~d~g~~--~y~~~a~~va~~v~~~~~~~~~~~gi~~cgtG~G~~i~aNK~~   90 (309)
                      |||+|||||+||+||+.|++||+++||||+|+|++  |||++|.+||++|.+    ++++|||+|||||+||||+|||+|
T Consensus         1 MkI~igsDhaG~~lK~~l~~~L~~~g~eV~D~G~~~~dypd~a~~va~~V~~----~e~~~GIliCGtGiG~siaANKv~   76 (141)
T PRK12613          1 MAIILGADAHGNALKELIKSFLQEEGYDIIDVTDINSDFIDNTLAVAKAVNE----AEGRLGIMVDAYGAGPFMVATKLK   76 (141)
T ss_pred             CEEEEEeCcchHHHHHHHHHHHHHCCCEEEEcCCCCCChHHHHHHHHHHHHc----CCCceEEEEcCCCHhHhhhhhcCC
Confidence            89999999999999999999999999999999984  799999999999998    999999999999999999999999


Q ss_pred             ceEEEEeCCHHHHHHHHhhcCcceeeecccccCHHHHHHHHHHHhcCCCCCCCCCCCCchhhHHHHh
Q 021698           91 GVFATTCLTPADALNTRSINNCNVLAVSGMSTSKESAVEILDTWLKTPFKAPCPASGLKPWDEKLSC  157 (309)
Q Consensus        91 giraa~~~~~~~A~~~r~hNnaNvl~~g~~~~~~~~a~~i~~~~l~~~f~~~~~~~~~~~~l~~I~~  157 (309)
                      |||||+|+|+++|+|+|+||||||||||+|++|+++|++|+++||+|+|++    ++++++++.|.+
T Consensus        77 GIRaA~~~d~~~A~~ar~hNnaNVl~lG~r~ig~~~a~~iv~~fL~t~f~g----grh~~Rv~~i~~  139 (141)
T PRK12613         77 GMVAAEVSDERSAYMTRGHNNARMITMGAEIVGPELAKNIAKGFVTGPYDG----GRHQIRVDMLNK  139 (141)
T ss_pred             CeEEEEECCHHHHHHHHHHcCCcEEEECccccCHHHHHHHHHHHHcCCCCC----ccHHHHHHHHHh
Confidence            999999999999999999999999999999999999999999999999997    799988888765



>TIGR01118 lacA galactose-6-phosphate isomerase, LacA subunit Back     alignment and domain information
>PRK08621 galactose-6-phosphate isomerase subunit LacA; Reviewed Back     alignment and domain information
>PRK05571 ribose-5-phosphate isomerase B; Provisional Back     alignment and domain information
>PRK08622 galactose-6-phosphate isomerase subunit LacB; Reviewed Back     alignment and domain information
>PTZ00215 ribose 5-phosphate isomerase; Provisional Back     alignment and domain information
>TIGR01119 lacB galactose-6-phosphate isomerase, LacB subunit Back     alignment and domain information
>TIGR01120 rpiB ribose 5-phosphate isomerase B Back     alignment and domain information
>PRK12615 galactose-6-phosphate isomerase subunit LacB; Reviewed Back     alignment and domain information
>TIGR02133 RPI_actino ribose 5-phosphate isomerase Back     alignment and domain information
>TIGR00689 rpiB_lacA_lacB sugar-phosphate isomerases, RpiB/LacA/LacB family Back     alignment and domain information
>COG0698 RpiB Ribose 5-phosphate isomerase RpiB [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02502 LacAB_rpiB: Ribose/Galactose Isomerase; InterPro: IPR003500 This entry represents the sugar isomerase enzymes ribose 5-phosphate isomerase B (rpiB), galactose isomerase subunit A (LacA) and galactose isomerase subunit B (LacB) Back     alignment and domain information
>PRK09273 hypothetical protein; Provisional Back     alignment and domain information
>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) Back     alignment and domain information
>PRK09943 DNA-binding transcriptional repressor PuuR; Provisional Back     alignment and domain information
>PRK13290 ectC L-ectoine synthase; Reviewed Back     alignment and domain information
>COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase Back     alignment and domain information
>PF01050 MannoseP_isomer: Mannose-6-phosphate isomerase; InterPro: IPR001538 Mannose-6-phosphate isomerase or phosphomannose isomerase (5 Back     alignment and domain information
>PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional Back     alignment and domain information
>PF12973 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_F 2Q1Z_B 3EBR_A Back     alignment and domain information
>TIGR03214 ura-cupin putative allantoin catabolism protein Back     alignment and domain information
>smart00835 Cupin_1 Cupin Back     alignment and domain information
>PRK11171 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information
>COG3837 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PRK11171 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03214 ura-cupin putative allantoin catabolism protein Back     alignment and domain information
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information
>TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase Back     alignment and domain information
>PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional Back     alignment and domain information
>PF00190 Cupin_1: Cupin; InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel) Back     alignment and domain information
>PF02311 AraC_binding: AraC-like ligand binding domain; InterPro: IPR003313 This entry defines the arabinose-binding and dimerisation domain of the bacterial gene regulatory protein AraC Back     alignment and domain information
>COG4101 Predicted mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK04190 glucose-6-phosphate isomerase; Provisional Back     alignment and domain information
>PF02041 Auxin_BP: Auxin binding protein; InterPro: IPR000526 Auxin binding protein is located in the lumen of the endoplasmic reticulum (ER) Back     alignment and domain information
>COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK15457 ethanolamine utilization protein EutQ; Provisional Back     alignment and domain information
>PRK10371 DNA-binding transcriptional regulator MelR; Provisional Back     alignment and domain information
>TIGR02451 anti_sig_ChrR anti-sigma factor, putative, ChrR family Back     alignment and domain information
>PRK13501 transcriptional activator RhaR; Provisional Back     alignment and domain information
>PRK10296 DNA-binding transcriptional regulator ChbR; Provisional Back     alignment and domain information
>PRK13500 transcriptional activator RhaR; Provisional Back     alignment and domain information
>PRK13502 transcriptional activator RhaR; Provisional Back     alignment and domain information
>COG3257 GlxB Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only] Back     alignment and domain information
>PF11699 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B Back     alignment and domain information
>TIGR02297 HpaA 4-hydroxyphenylacetate catabolism regulatory protein HpaA Back     alignment and domain information
>PLN00212 glutelin; Provisional Back     alignment and domain information
>PF14499 DUF4437: Domain of unknown function (DUF4437); PDB: 2QDR_A Back     alignment and domain information
>PRK13503 transcriptional activator RhaS; Provisional Back     alignment and domain information
>TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase Back     alignment and domain information
>PF06052 3-HAO: 3-hydroxyanthranilic acid dioxygenase; InterPro: IPR010329 Members of this protein family, from both bacteria and eukaryotes, are the enzyme 3-hydroxyanthranilate 3,4-dioxygenase (1 Back     alignment and domain information
>PF14499 DUF4437: Domain of unknown function (DUF4437); PDB: 2QDR_A Back     alignment and domain information
>TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase Back     alignment and domain information
>PF03079 ARD: ARD/ARD' family; InterPro: IPR004313 The two acireductone dioxygenase enzymes (ARD and ARD', previously known as E-2 and E-2') from Klebsiella pneumoniae share the same amino acid sequence Q9ZFE7 from SWISSPROT, but bind different metal ions: ARD binds Ni2+, ARD' binds Fe2+ [] Back     alignment and domain information
>PF06249 EutQ: Ethanolamine utilisation protein EutQ; InterPro: IPR010424 The eut operon of Salmonella typhimurium encodes proteins involved in the cobalamin-dependent degradation of ethanolamine Back     alignment and domain information
>PF05523 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 This entry includes FdtA (Q6T1W8 from SWISSPROT) from Aneurinibacillus thermoaerophilus, which has been characterised as a dTDP-6-deoxy-3,4-keto-hexulose isomerase [] Back     alignment and domain information
>PF06339 Ectoine_synth: Ectoine synthase; InterPro: IPR010462 This family consists of several bacterial ectoine synthase proteins Back     alignment and domain information
>PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown Back     alignment and domain information
>COG3435 Gentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG4766 EutQ Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>PF06560 GPI: Glucose-6-phosphate isomerase (GPI); InterPro: IPR010551 This entry consists of several bacterial and archaeal glucose-6-phosphate isomerase (GPI) proteins (5 Back     alignment and domain information
>PLN00212 glutelin; Provisional Back     alignment and domain information
>COG1791 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>COG3435 Gentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG3806 ChrR Transcriptional activator [Transcription] Back     alignment and domain information
>COG3257 GlxB Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only] Back     alignment and domain information
>PF02678 Pirin: Pirin; InterPro: IPR003829 This entry represents N-terminal domain of Pirin proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>COG3822 ABC-type sugar transport system, auxiliary component [General function prediction only] Back     alignment and domain information
>COG4297 Uncharacterized protein containing double-stranded beta helix domain [Function unknown] Back     alignment and domain information
>PRK10572 DNA-binding transcriptional regulator AraC; Provisional Back     alignment and domain information
>KOG2107 consensus Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PF05995 CDO_I: Cysteine dioxygenase type I; InterPro: IPR010300 Cysteine dioxygenase type I (1 Back     alignment and domain information
>COG3450 Predicted enzyme of the cupin superfamily [General function prediction only] Back     alignment and domain information
>PF09313 DUF1971: Domain of unknown function (DUF1971); InterPro: IPR015392 This uncharacterised domain is predominantly found in bacterial Tellurite resistance proteins Back     alignment and domain information
>PF05726 Pirin_C: Pirin C-terminal cupin domain; InterPro: IPR008778 This entry represents C-terminal domain of Pirin proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>COG1741 Pirin-related protein [General function prediction only] Back     alignment and domain information
>PF08007 Cupin_4: Cupin superfamily protein; InterPro: IPR022777 This signature represents primarily the cupin fold found in JmjC transcription factors Back     alignment and domain information
>PRK09685 DNA-binding transcriptional activator FeaR; Provisional Back     alignment and domain information
>PF12852 Cupin_6: Cupin Back     alignment and domain information
>PF14272 Gly_rich_SFCGS: Glycine-rich SFCGS Back     alignment and domain information
>COG1898 RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF13621 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XUM_A 2Y0I_A 1MZE_A 3KCY_A 1MZF_A 1YCI_A 2ILM_A 1H2L_A Back     alignment and domain information
>PF04209 HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR005708 Alkaptonuria (AKU), a rare hereditary disorder, was the first disease to be interpreted as an inborn error of metabolism Back     alignment and domain information
>PRK02261 methylaspartate mutase subunit S; Provisional Back     alignment and domain information
>TIGR01221 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase Back     alignment and domain information
>PF00908 dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimerase; InterPro: IPR000888 Deoxythymidine diphosphate (dTDP)-4-keto-6-deoxy-d-hexulose 3, 5-epimerase (RmlC, 5 Back     alignment and domain information
>PF02373 JmjC: JmjC domain, hydroxylase; InterPro: IPR013129 Jumonji protein is required for neural tube formation in mice [] Back     alignment and domain information
>PF07385 DUF1498: Protein of unknown function (DUF1498); InterPro: IPR010864 This family consists of several hypothetical bacterial proteins of around 225 residues in length Back     alignment and domain information
>PF04962 KduI: KduI/IolB family; InterPro: IPR021120 The KduI/IolB family of enzymes includes 5-keto 4-deoxyuronate isomerase (KduI) and 5-deoxy-glucuronate isomerase (IolB) Back     alignment and domain information
>PHA00672 hypothetical protein Back     alignment and domain information
>TIGR03577 EF_0830 conserved hypothetical protein EF_0830/AHA_3911 Back     alignment and domain information
>TIGR00218 manA mannose-6-phosphate isomerase, class I Back     alignment and domain information
>PF14525 AraC_binding_2: AraC-binding-like domain Back     alignment and domain information
>PF05118 Asp_Arg_Hydrox: Aspartyl/Asparaginyl beta-hydroxylase; InterPro: IPR007803 The alpha-ketoglutarate-dependent dioxygenase aspartyl (asparaginyl) beta-hydroxylase (1 Back     alignment and domain information
>KOG3995 consensus 3-hydroxyanthranilate oxygenase HAAO [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01015 hmgA homogentisate 1,2-dioxygenase Back     alignment and domain information
>COG2850 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR01501 MthylAspMutase methylaspartate mutase, S subunit Back     alignment and domain information
>KOG2757 consensus Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05341 homogentisate 1,2-dioxygenase; Provisional Back     alignment and domain information
>PF11142 DUF2917: Protein of unknown function (DUF2917); InterPro: IPR021317 This bacterial family of proteins appears to be restricted to Proteobacteria Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PF07847 DUF1637: Protein of unknown function (DUF1637); InterPro: IPR012864 This entry represents cysteamine dioxygenase, which is a non-heme iron protein that is involved in the biosynthesis of taurine Back     alignment and domain information
>COG1482 ManA Phosphomannose isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15131 mannose-6-phosphate isomerase; Provisional Back     alignment and domain information
>PLN02658 homogentisate 1,2-dioxygenase Back     alignment and domain information
>PLN02288 mannose-6-phosphate isomerase Back     alignment and domain information
>PF02302 PTS_IIB: PTS system, Lactose/Cellobiose specific IIB subunit; InterPro: IPR003501 The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes Back     alignment and domain information
>cd05564 PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Back     alignment and domain information
>TIGR00853 pts-lac PTS system, lactose/cellobiose family IIB component Back     alignment and domain information
>PF06865 DUF1255: Protein of unknown function (DUF1255); InterPro: IPR009664 This family consists of several conserved hypothetical bacterial proteins of around 95 residues in length Back     alignment and domain information
>PF03698 UPF0180: Uncharacterised protein family (UPF0180); InterPro: IPR005370 The members of this family are small uncharacterised proteins Back     alignment and domain information
>PRK10579 hypothetical protein; Provisional Back     alignment and domain information
>PRK09590 celB cellobiose phosphotransferase system IIB component; Reviewed Back     alignment and domain information
>PRK00924 5-keto-4-deoxyuronate isomerase; Provisional Back     alignment and domain information
>cd05568 PTS_IIB_bgl_like PTS_IIB_bgl_like: the PTS (phosphotransferase system) IIB domain of a family of sensory systems composed of a membrane-bound sugar-sensor (similar to BglF) and a transcription antiterminator (similar to BglG) which regulate expression of genes involved in sugar utilization Back     alignment and domain information
>COG3508 HmgA Homogentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF02878 PGM_PMM_I: Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I; InterPro: IPR005844 The alpha-D-phosphohexomutase superfamily is composed of four related enzymes, each of which catalyses a phosphoryl transfer on their sugar substrates: phosphoglucomutase (PGM), phosphoglucomutase/phosphomannomutase (PGM/PMM), phosphoglucosamine mutase (PNGM), and phosphoacetylglucosamine mutase (PAGM) [] Back     alignment and domain information
>PRK10310 PTS system galactitol-specific transporter subunit IIB; Provisional Back     alignment and domain information
>TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain Back     alignment and domain information
>cd05566 PTS_IIB_galactitol PTS_IIB_galactitol: subunit IIB of enzyme II (EII) of the galactitol-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Back     alignment and domain information
>TIGR00218 manA mannose-6-phosphate isomerase, class I Back     alignment and domain information
>PF06719 AraC_N: AraC-type transcriptional regulator N-terminus; InterPro: IPR009594 This entry represents the N terminus of bacterial ARAC-type transcriptional regulators Back     alignment and domain information
>PRK03094 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query309
3he8_A149 Structural Study Of Clostridium Thermocellum Ribose 1e-15
3ph4_A169 Clostridium Thermocellum Ribose-5-Phosphate Isomera 1e-15
1nn4_A162 Structural Genomics, RpibALSB Length = 162 5e-13
2vvr_A149 Crystal Structure Of The H99n Mutant Of Ribose-5-Ph 8e-13
3s5p_A166 Crystal Structure Of Ribose-5-Phosphate Isomerase B 7e-12
1o1x_A155 Crystal Structure Of A Ribose 5-phosphate Isomerase 1e-10
3k7o_A179 Structure Of Type B Ribose 5-phosphate Isomerase Fr 2e-09
4em8_A148 The Structure Of Ribose 5-Phosphate Isomerase B Fro 4e-09
3k7p_A179 Structure Of Mutant Of Ribose 5-phosphate Isomerase 2e-08
3m1p_A153 Structure Of Ribose 5-Phosphate Isomerase Type B Fr 2e-08
2vvo_A162 Crystal Structure Of Mycobacterium Tuberculosis Rib 9e-07
1usl_A170 Structure Of Mycobacterium Tuberculosis Ribose-5-ph 9e-07
2bes_A172 Structure Of Mycobacterium Tuberculosis Ribose-5-Ph 1e-06
3sdw_A184 Crystal Structure Of A Ribose-5-Phosphate Isomerase 2e-05
3qd5_A167 Crystal Structure Of A Putative Ribose-5-Phosphate 3e-04
>pdb|3HE8|A Chain A, Structural Study Of Clostridium Thermocellum Ribose-5-Phosphate Isomerase B Length = 149 Back     alignment and structure

Iteration: 1

Score = 80.5 bits (197), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 47/135 (34%), Positives = 72/135 (53%), Gaps = 1/135 (0%) Query: 13 LKIIAGADSFGAELKDALVSHLRSLNIDVEDLGTSDYYSIGA-EVGRRVSSSDSSETTTR 71 +KI G+D G LK + L+ +V D GT S+ + G +V+ + S R Sbjct: 1 MKIGIGSDHGGYNLKREIADFLKKRGYEVIDFGTHGNESVDYPDFGLKVAEAVKSGECDR 60 Query: 72 GLVACGTGVGVAIFANKNPGVFATTCLTPADALNTRSINNCNVLAVSGMSTSKESAVEIL 131 G+V CGTG+G++I ANK PG+ A C A +R N+ N+LA+ + A++I+ Sbjct: 61 GIVICGTGLGISIAANKVPGIRAAVCTNSYMARMSREHNDANILALGERVVGLDLALDIV 120 Query: 132 DTWLKTPFKAPCPAS 146 DTWLK F+ A+ Sbjct: 121 DTWLKAEFQGGRHAT 135
>pdb|3PH4|A Chain A, Clostridium Thermocellum Ribose-5-Phosphate Isomerase B With D-Allose Length = 169 Back     alignment and structure
>pdb|1NN4|A Chain A, Structural Genomics, RpibALSB Length = 162 Back     alignment and structure
>pdb|2VVR|A Chain A, Crystal Structure Of The H99n Mutant Of Ribose-5-Phosphate Isomerase B From E. Coli Soaked With Ribose 5-Phosphate Length = 149 Back     alignment and structure
>pdb|3S5P|A Chain A, Crystal Structure Of Ribose-5-Phosphate Isomerase B Rpib From Giardia Lamblia Length = 166 Back     alignment and structure
>pdb|1O1X|A Chain A, Crystal Structure Of A Ribose 5-phosphate Isomerase Rpib (tm1080) From Thermotoga Maritima At 1.90 A Resolution Length = 155 Back     alignment and structure
>pdb|3K7O|A Chain A, Structure Of Type B Ribose 5-phosphate Isomerase From Trypanosoma Cruzi Length = 179 Back     alignment and structure
>pdb|4EM8|A Chain A, The Structure Of Ribose 5-Phosphate Isomerase B From Anaplasma Phagocytophilum Length = 148 Back     alignment and structure
>pdb|3K7P|A Chain A, Structure Of Mutant Of Ribose 5-phosphate Isomerase Type B From Trypanosoma Cruzi. Length = 179 Back     alignment and structure
>pdb|3M1P|A Chain A, Structure Of Ribose 5-Phosphate Isomerase Type B From Trypanosoma Cruzi, Soaked With Allose-6-Phosphate Length = 153 Back     alignment and structure
>pdb|2VVO|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Ribose-5- Phosphate Isomerase B In Complex With Alpha D-Allose 6- Phosphate Length = 162 Back     alignment and structure
>pdb|1USL|A Chain A, Structure Of Mycobacterium Tuberculosis Ribose-5-phosphate Isomerase, Rpib, Rv2465c, Complexed With Phosphate. Length = 170 Back     alignment and structure
>pdb|2BES|A Chain A, Structure Of Mycobacterium Tuberculosis Ribose-5-Phosphate Isomerase, Rpib, Rv2465c, In Complex With 4-Phospho-D- Erythronohydroxamic Acid. Length = 172 Back     alignment and structure
>pdb|3SDW|A Chain A, Crystal Structure Of A Ribose-5-Phosphate Isomerase B Rpib From Coccidioides Immitis Bound To Phosphate Length = 184 Back     alignment and structure
>pdb|3QD5|A Chain A, Crystal Structure Of A Putative Ribose-5-Phosphate Isomerase From Coccidioides Immitis Solved By Combined Iodide Ion Sad And Mr Length = 167 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query309
3s5p_A166 Ribose 5-phosphate isomerase; structural genomics, 4e-34
1o1x_A155 Ribose-5-phosphate isomerase RPIB; structural geno 5e-34
2vvr_A149 Ribose-5-phosphate isomerase B; RPIB, carbohydrate 9e-34
3he8_A149 Ribose-5-phosphate isomerase; CTRPI B, isomerizati 9e-34
3ph3_A169 Ribose-5-phosphate isomerase; alpha-beta-alpha san 1e-33
4em8_A148 Ribose 5-phosphate isomerase B; ssgcid, seattle st 2e-32
2vvp_A162 Ribose-5-phosphate isomerase B; RPIB, RV2465C, RAR 3e-32
3sgw_A184 Ribose 5-phosphate isomerase; structural genomics, 3e-32
3k7p_A179 Ribose 5-phosphate isomerase; pentose phosphate pa 1e-30
3c5y_A231 Ribose/galactose isomerase; structural genomics, j 1e-29
3ono_A214 Ribose/galactose isomerase; structural genomics, P 2e-28
2ppw_A216 Conserved domain protein; the putative RPIB, PSI-2 2e-27
2o1q_A145 Putative acetyl/propionyl-COA carboxylase, alpha; 5e-20
3bal_A153 Acetylacetone-cleaving enzyme; jelly roll, tetrame 2e-19
3cjx_A165 Protein of unknown function with A cupin-like FOL; 2e-17
4e2g_A126 Cupin 2 conserved barrel domain protein; MCSG, PSI 2e-10
3ht1_A145 REMF protein; cupin fold, Zn-binding, antibiotic b 7e-09
3ibm_A167 Cupin 2, conserved barrel domain protein; cupin 2 1e-08
1vj2_A126 Novel manganese-containing cupin TM1459; structura 1e-08
2pfw_A116 Cupin 2, conserved barrel domain protein; cupin do 2e-08
1y3t_A 337 Hypothetical protein YXAG; BI cupin, dioxygenase, 7e-08
1y3t_A337 Hypothetical protein YXAG; BI cupin, dioxygenase, 1e-06
3jzv_A166 Uncharacterized protein RRU_A2000; structural geno 1e-07
3kgz_A156 Cupin 2 conserved barrel domain protein; metallopr 1e-07
1v70_A105 Probable antibiotics synthesis protein; structural 4e-07
1yhf_A115 Hypothetical protein SPY1581; structural genomics, 5e-07
3fjs_A114 Uncharacterized protein with RMLC-like cupin fold; 5e-07
2q30_A110 Uncharacterized protein; double-stranded beta-heli 6e-07
3ebr_A159 Uncharacterized RMLC-like cupin; structural genomi 1e-06
4e2q_A266 Ureidoglycine aminohydrolase; BI-cupin, manganese 1e-06
3rns_A227 Cupin 2 conserved barrel domain protein; structura 1e-06
2d40_A 354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 2e-06
2d40_A354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
3nw4_A 368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 3e-06
3nw4_A368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 8e-05
2ozj_A114 Cupin 2, conserved barrel; cupin superfamily prote 3e-06
1lr5_A163 Auxin binding protein 1; beta jellyroll, double st 4e-06
3o14_A223 Anti-ecfsigma factor, CHRR; cupin, structural geno 6e-06
3bu7_A 394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 7e-06
3bu7_A394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 5e-05
1o4t_A133 Putative oxalate decarboxylase; double-stranded be 1e-05
1sq4_A 278 GLXB, glyoxylate-induced protein; structural genom 1e-05
3cew_A125 Uncharacterized cupin protein; all beta-protein, j 1e-05
1rc6_A 261 Hypothetical protein YLBA; structural genomics, NY 1e-05
3h8u_A125 Uncharacterized conserved protein with double-STR 2e-05
1sef_A 274 Conserved hypothetical protein; structural genomic 3e-05
2opk_A112 Hypothetical protein; putative mannose-6-phosphate 7e-05
2qdr_A 303 Uncharacterized protein; double-stranded beta-heli 2e-04
1juh_A350 Quercetin 2,3-dioxygenase; cupin, glycoprotein, be 2e-04
1juh_A 350 Quercetin 2,3-dioxygenase; cupin, glycoprotein, be 7e-04
2fqp_A97 Hypothetical protein BP2299; double-stranded beta- 2e-04
1j58_A 385 YVRK protein; cupin, decarboxyklase, oxalate, mang 4e-04
2vqa_A361 SLL1358 protein, MNCA; periplasmic binding protein 6e-04
3l2h_A162 Putative sugar phosphate isomerase; AFE_0303, stru 7e-04
2gu9_A113 Tetracenomycin polyketide synthesis protein; X-RAY 8e-04
>3s5p_A Ribose 5-phosphate isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.30A {Giardia lamblia} Length = 166 Back     alignment and structure
 Score =  121 bits (306), Expect = 4e-34
 Identities = 45/141 (31%), Positives = 63/141 (44%), Gaps = 9/141 (6%)

Query: 4   NADAAAPHPLKIIAGADSFGAELKDALVSHLRSLNIDVEDLGTS-----DYYSIGAEVGR 58
            A    P  +K+   +D  G +L+  L     +   +V DLGT      DY         
Sbjct: 13  EAQTQGPGSMKVAFASDHGGRDLRMFLQQRASAHGYEVMDLGTESDASVDYPDFAKIGCE 72

Query: 59  RVSSSDSSETTTRGLVACGTGVGVAIFANKNPGVFATTCLTPADALNTRSINNCNVLAVS 118
            V+S  +       ++ CGTG+G++I ANK  G+    C T  DA   R  NN N LA+ 
Sbjct: 73  AVTSGRAD----CCILVCGTGIGISIAANKMKGIRCALCSTEYDAEMARKHNNANALALG 128

Query: 119 GMSTSKESAVEILDTWLKTPF 139
           G +T  E A  IL  +L T F
Sbjct: 129 GRTTGPEVAASILSRFLSTNF 149


>1o1x_A Ribose-5-phosphate isomerase RPIB; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 1.90A {Thermotoga maritima} SCOP: c.121.1.1 Length = 155 Back     alignment and structure
>2vvr_A Ribose-5-phosphate isomerase B; RPIB, carbohydrate metabolism, pentose phosphate pathway; 2.10A {Escherichia coli} PDB: 1nn4_A Length = 149 Back     alignment and structure
>3he8_A Ribose-5-phosphate isomerase; CTRPI B, isomerization; 1.90A {Clostridium thermocellum} PDB: 3hee_A* Length = 149 Back     alignment and structure
>3ph3_A Ribose-5-phosphate isomerase; alpha-beta-alpha sandwich fold; HET: RB5; 2.07A {Clostridium thermocellum} PDB: 3ph4_A* Length = 169 Back     alignment and structure
>4em8_A Ribose 5-phosphate isomerase B; ssgcid, seattle structural genomics center for infectious DI niaid; 1.95A {Anaplasma phagocytophilum} Length = 148 Back     alignment and structure
>2vvp_A Ribose-5-phosphate isomerase B; RPIB, RV2465C, RARE sugar, carbohydrate metabolism, pentose phosphate pathway; HET: R52 5RP; 1.65A {Mycobacterium tuberculosis} SCOP: c.121.1.1 PDB: 2vvo_A* 2vvq_A* 2bes_A* 2bet_A* 1usl_A Length = 162 Back     alignment and structure
>3sgw_A Ribose 5-phosphate isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, valley fever; 1.70A {Coccidioides immitis} PDB: 3sdw_A 3qd5_A* Length = 184 Back     alignment and structure
>3k7p_A Ribose 5-phosphate isomerase; pentose phosphate pathway, type B ribose 5-phosphate isomera (RPIB), R5P; 1.40A {Trypanosoma cruzi} PDB: 3k7s_A* 3k7o_A* 3k8c_A* 3m1p_A Length = 179 Back     alignment and structure
>3c5y_A Ribose/galactose isomerase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.81A {Novosphingobium aromaticivorans} Length = 231 Back     alignment and structure
>3ono_A Ribose/galactose isomerase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.75A {Vibrio parahaemolyticus} Length = 214 Back     alignment and structure
>2ppw_A Conserved domain protein; the putative RPIB, PSI-2, protein initiative, MCSG, structural genomics, midwest center for S genomics; HET: MSE; 2.01A {Streptococcus pneumoniae} Length = 216 Back     alignment and structure
>2o1q_A Putative acetyl/propionyl-COA carboxylase, alpha; putative acetylacetone dioxygenase, structural genomics; HET: MSE PG4; 1.50A {Methylibium petroleiphilum} SCOP: b.82.1.21 Length = 145 Back     alignment and structure
>3bal_A Acetylacetone-cleaving enzyme; jelly roll, tetramer, dioxygenase, iron, metal-binding, oxidoreductase; 1.95A {Acinetobacter johnsonii} Length = 153 Back     alignment and structure
>3cjx_A Protein of unknown function with A cupin-like FOL; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.60A {Ralstonia eutropha} Length = 165 Back     alignment and structure
>4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} Length = 126 Back     alignment and structure
>3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A Length = 145 Back     alignment and structure
>3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} Length = 167 Back     alignment and structure
>1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 Length = 126 Back     alignment and structure
>2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} Length = 116 Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Length = 337 Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Length = 337 Back     alignment and structure
>3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} Length = 166 Back     alignment and structure
>3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} Length = 156 Back     alignment and structure
>1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A Length = 105 Back     alignment and structure
>1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 Length = 115 Back     alignment and structure
>3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} Length = 114 Back     alignment and structure
>2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} Length = 110 Back     alignment and structure
>3ebr_A Uncharacterized RMLC-like cupin; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.60A {Ralstonia eutropha JMP134} Length = 159 Back     alignment and structure
>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A Length = 266 Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Length = 227 Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Length = 354 Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Length = 354 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* Length = 368 Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* Length = 368 Back     alignment and structure
>2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} Length = 114 Back     alignment and structure
>1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* Length = 163 Back     alignment and structure
>3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei} Length = 223 Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Length = 394 Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Length = 394 Back     alignment and structure
>1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 Length = 133 Back     alignment and structure
>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Length = 278 Back     alignment and structure
>3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} Length = 125 Back     alignment and structure
>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 Length = 261 Back     alignment and structure
>3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} Length = 125 Back     alignment and structure
>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 Length = 274 Back     alignment and structure
>2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha} Length = 112 Back     alignment and structure
>2qdr_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE EPE; 2.60A {Nostoc punctiforme} Length = 303 Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Length = 350 Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Length = 350 Back     alignment and structure
>2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} Length = 97 Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Length = 385 Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Length = 361 Back     alignment and structure
>3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} Length = 162 Back     alignment and structure
>2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A Length = 113 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query309
3he8_A149 Ribose-5-phosphate isomerase; CTRPI B, isomerizati 100.0
3ph3_A169 Ribose-5-phosphate isomerase; alpha-beta-alpha san 100.0
3s5p_A166 Ribose 5-phosphate isomerase; structural genomics, 100.0
3sgw_A184 Ribose 5-phosphate isomerase; structural genomics, 100.0
2vvr_A149 Ribose-5-phosphate isomerase B; RPIB, carbohydrate 100.0
1o1x_A155 Ribose-5-phosphate isomerase RPIB; structural geno 100.0
3k7p_A179 Ribose 5-phosphate isomerase; pentose phosphate pa 100.0
2vvp_A162 Ribose-5-phosphate isomerase B; RPIB, RV2465C, RAR 100.0
4em8_A148 Ribose 5-phosphate isomerase B; ssgcid, seattle st 100.0
2ppw_A216 Conserved domain protein; the putative RPIB, PSI-2 100.0
3ono_A214 Ribose/galactose isomerase; structural genomics, P 100.0
3c5y_A231 Ribose/galactose isomerase; structural genomics, j 100.0
2fqp_A97 Hypothetical protein BP2299; double-stranded beta- 99.48
3fjs_A114 Uncharacterized protein with RMLC-like cupin fold; 99.48
2pfw_A116 Cupin 2, conserved barrel domain protein; cupin do 99.46
2bnm_A198 Epoxidase; oxidoreductase, cupin, HTH, cation-depe 99.43
4e2g_A126 Cupin 2 conserved barrel domain protein; MCSG, PSI 99.42
1y9q_A192 Transcriptional regulator, HTH_3 family; transcrip 99.37
1yhf_A115 Hypothetical protein SPY1581; structural genomics, 99.34
2b8m_A117 Hypothetical protein MJ0764; structural genomics, 99.33
3ht1_A145 REMF protein; cupin fold, Zn-binding, antibiotic b 99.32
2o1q_A145 Putative acetyl/propionyl-COA carboxylase, alpha; 99.32
3h8u_A125 Uncharacterized conserved protein with double-STR 99.32
3ibm_A167 Cupin 2, conserved barrel domain protein; cupin 2 99.32
1v70_A105 Probable antibiotics synthesis protein; structural 99.3
4i4a_A128 Similar to unknown protein; structural genomics, P 99.29
2gu9_A113 Tetracenomycin polyketide synthesis protein; X-RAY 99.29
3kgz_A156 Cupin 2 conserved barrel domain protein; metallopr 99.29
3h7j_A 243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 99.27
3jzv_A166 Uncharacterized protein RRU_A2000; structural geno 99.27
2ozj_A114 Cupin 2, conserved barrel; cupin superfamily prote 99.27
1lr5_A163 Auxin binding protein 1; beta jellyroll, double st 99.25
2q30_A110 Uncharacterized protein; double-stranded beta-heli 99.25
3bal_A153 Acetylacetone-cleaving enzyme; jelly roll, tetrame 99.23
3ebr_A159 Uncharacterized RMLC-like cupin; structural genomi 99.22
3l2h_A162 Putative sugar phosphate isomerase; AFE_0303, stru 99.22
3es1_A172 Cupin 2, conserved barrel domain protein; YP_00116 99.21
1o4t_A133 Putative oxalate decarboxylase; double-stranded be 99.2
3h7j_A243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 99.2
1vj2_A126 Novel manganese-containing cupin TM1459; structura 99.19
2vpv_A166 Protein MIF2, MIF2P; nucleus, mitosis, centromere, 99.19
2o8q_A134 Hypothetical protein; cpuin-like fold, structural 99.19
2oa2_A148 BH2720 protein; 10175341, structural genomics, joi 99.17
3i7d_A163 Sugar phosphate isomerase; YP_168127.1, structural 99.17
4h7l_A157 Uncharacterized protein; structural genomics, PSI- 99.16
3rns_A227 Cupin 2 conserved barrel domain protein; structura 99.15
3cew_A125 Uncharacterized cupin protein; all beta-protein, j 99.14
3cjx_A165 Protein of unknown function with A cupin-like FOL; 99.14
2f4p_A147 Hypothetical protein TM1010; double-stranded beta- 99.13
3rns_A227 Cupin 2 conserved barrel domain protein; structura 99.13
2i45_A107 Hypothetical protein; neisseria meningitidis cupin 99.11
3lwc_A119 Uncharacterized protein; structural genomics, unkn 99.11
1sfn_A246 Conserved hypothetical protein; structural genomic 99.1
1sef_A274 Conserved hypothetical protein; structural genomic 99.08
3lag_A98 Uncharacterized protein RPA4178; functionally unkn 99.07
3d82_A102 Cupin 2, conserved barrel domain protein; structur 99.05
1fi2_A201 Oxalate oxidase, germin; beta-jellyroll, oxidoredu 99.03
2ozi_A98 Hypothetical protein RPA4178; APC6210, putative pr 99.02
2xlg_A239 SLL1785 protein, CUCA; metal binding protein, cupi 99.02
1dgw_A178 Canavalin; duplicated swiss-roll beta barrels, loo 99.02
4e2q_A266 Ureidoglycine aminohydrolase; BI-cupin, manganese 99.01
4b29_A217 Dimethylsulfoniopropionate lyase; hydrolase, dimet 99.01
1sq4_A 278 GLXB, glyoxylate-induced protein; structural genom 99.0
4e2q_A 266 Ureidoglycine aminohydrolase; BI-cupin, manganese 98.99
1y3t_A 337 Hypothetical protein YXAG; BI cupin, dioxygenase, 98.98
1x82_A190 Glucose-6-phosphate isomerase; cupin superfamily, 98.98
2opk_A112 Hypothetical protein; putative mannose-6-phosphate 98.98
1rc6_A 261 Hypothetical protein YLBA; structural genomics, NY 98.97
1rc6_A261 Hypothetical protein YLBA; structural genomics, NY 98.96
1o5u_A101 Novel thermotoga maritima enzyme TM1112; cupin, st 98.96
1sq4_A278 GLXB, glyoxylate-induced protein; structural genom 98.9
1sef_A 274 Conserved hypothetical protein; structural genomic 98.9
1j58_A385 YVRK protein; cupin, decarboxyklase, oxalate, mang 98.9
2q1z_B195 Anti-sigma factor CHRR, transcriptional activator; 98.89
2pyt_A133 Ethanolamine utilization protein EUTQ; structural 98.89
1y3t_A337 Hypothetical protein YXAG; BI cupin, dioxygenase, 98.88
2vqa_A 361 SLL1358 protein, MNCA; periplasmic binding protein 98.87
2vqa_A361 SLL1358 protein, MNCA; periplasmic binding protein 98.87
4axo_A151 EUTQ, ethanolamine utilization protein; structural 98.86
2d40_A 354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 98.83
2cav_A 445 Protein (canavalin); vicilin, 7S SEED protein, dom 98.8
1juh_A 350 Quercetin 2,3-dioxygenase; cupin, glycoprotein, be 98.8
1sfn_A 246 Conserved hypothetical protein; structural genomic 98.75
3bu7_A394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 98.74
3bcw_A123 Uncharacterized protein; structural genomics, join 98.74
3o14_A223 Anti-ecfsigma factor, CHRR; cupin, structural geno 98.72
1j58_A 385 YVRK protein; cupin, decarboxyklase, oxalate, mang 98.7
1uij_A 416 Beta subunit of beta conglycinin; double-stranded 98.7
3nw4_A 368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 98.7
2d40_A354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 98.69
2ea7_A 434 7S globulin-1; beta barrel, cupin superfamily, pla 98.66
1fxz_A476 Glycinin G1; proglycinin, legumin, SEED storage pr 98.64
3bu7_A 394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 98.64
3c3v_A510 Arachin ARAH3 isoform; peanut allergen, allergy, g 98.64
1yfu_A174 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid 98.61
2e9q_A 459 11S globulin subunit beta; cucubitin, pumpkin SEED 98.6
1fxz_A 476 Glycinin G1; proglycinin, legumin, SEED storage pr 98.58
3qac_A 465 11S globulin SEED storage protein; 11S SEED storag 98.53
2d5f_A 493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 98.53
1juh_A350 Quercetin 2,3-dioxygenase; cupin, glycoprotein, be 98.53
1vr3_A191 Acireductone dioxygenase; 13543033, structural gen 98.51
2d5f_A493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 98.51
2phl_A 397 Phaseolin; plant SEED storage protein(vicilin); HE 98.46
3c3v_A 510 Arachin ARAH3 isoform; peanut allergen, allergy, g 98.45
1zvf_A176 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b 98.45
3fz3_A531 Prunin; TREE NUT allergen, allergy, amandin, almon 98.43
2e9q_A459 11S globulin subunit beta; cucubitin, pumpkin SEED 98.41
3nw4_A368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 98.4
2arc_A164 ARAC, arabinose operon regulatory protein; transcr 98.39
2y0o_A175 Probable D-lyxose ketol-isomerase; carbohydrate me 98.38
2phl_A397 Phaseolin; plant SEED storage protein(vicilin); HE 98.37
1zrr_A179 E-2/E-2' protein; nickel, cupin, beta helix, methi 98.34
1uij_A416 Beta subunit of beta conglycinin; double-stranded 98.33
2ea7_A434 7S globulin-1; beta barrel, cupin superfamily, pla 98.3
3ksc_A496 LEGA class, prolegumin; PEA prolegumin, 11S SEED s 98.3
3ksc_A 496 LEGA class, prolegumin; PEA prolegumin, 11S SEED s 98.28
3kgl_A466 Cruciferin; 11S SEED globulin, rapeseed, SEED stor 98.28
3kgl_A 466 Cruciferin; 11S SEED globulin, rapeseed, SEED stor 98.11
3qac_A465 11S globulin SEED storage protein; 11S SEED storag 98.1
2cav_A445 Protein (canavalin); vicilin, 7S SEED protein, dom 98.09
3s7i_A 418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 98.07
3d0j_A140 Uncharacterized protein CA_C3497; beta-barrel, str 98.02
3fz3_A 531 Prunin; TREE NUT allergen, allergy, amandin, almon 97.97
3eqe_A171 Putative cystein deoxygenase; YUBC, SR112, NESG, s 97.97
3s7i_A418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 97.88
2qnk_A 286 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol 97.86
2gm6_A208 Cysteine dioxygenase type I; structural genomics, 97.85
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 97.68
3myx_A238 Uncharacterized protein pspto_0244; protein of unk 97.62
3o14_A223 Anti-ecfsigma factor, CHRR; cupin, structural geno 97.56
2pa7_A141 DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysug 97.54
3es4_A116 Uncharacterized protein DUF861 with A RMLC-like C; 97.44
3gbg_A 276 TCP pilus virulence regulatory protein; cupin, hel 97.38
3eln_A200 Cysteine dioxygenase type 1; peroxysulfenate, non- 97.22
2vec_A256 YHAK, pirin-like protein YHAK; ROS, bicupin, sulfe 97.21
3uss_A211 Putative uncharacterized protein; cupin, three his 97.06
3ejk_A174 DTDP sugar isomerase; YP_390184.1, structural geno 97.0
3myx_A238 Uncharacterized protein pspto_0244; protein of unk 96.99
3kmh_A246 D-lyxose isomerase; cupin beta-barrel, structural 96.93
2qnk_A286 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol 96.93
1tq5_A242 Protein YHHW; bicupin, pirin, montreal-kingston ba 96.81
4gjz_A235 Lysine-specific demethylase 8; JMJC, beta barrel, 96.74
1nxm_A197 DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jell 96.41
1vrb_A342 Putative asparaginyl hydroxylase; 2636534, structu 96.36
2qdr_A 303 Uncharacterized protein; double-stranded beta-heli 96.04
3bb6_A127 Uncharacterized protein YEAR; structural genomics, 95.95
3al5_A338 HTYW5, JMJC domain-containing protein C2ORF60; tRN 95.93
1ep0_A185 DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; race 95.9
3ryk_A205 DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat 95.83
2ixk_A184 DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, l 95.81
1wlt_A196 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 95.48
2p17_A 277 Pirin-like protein; GK1651, structural genomics, s 95.47
1yud_A170 Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, p 95.41
1dgw_X79 Canavalin; duplicated swiss-roll beta barrels, loo 95.38
1dzr_A183 DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, 95.21
1oi6_A205 PCZA361.16; epimerase, vancomycin group antibiotic 95.13
1upi_A225 DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat 95.0
2xdv_A 442 MYC-induced nuclear antigen; ribosome biogenesis, 94.98
2c0z_A216 NOVW; isomerase, epimerase, antibiotic biosynthesi 94.91
3dl3_A119 Tellurite resistance protein B; X-RAY NESG VFR98 Q 94.86
1j1l_A 290 Pirin; beta sandwich, cupin, iron, metatl binding 94.43
2qdr_A303 Uncharacterized protein; double-stranded beta-heli 94.34
4hn1_A201 Putative 3-epimerase in D-allose pathway; 3'-monoe 93.98
3d8c_A349 Hypoxia-inducible factor 1 alpha inhibitor; FIH, H 93.72
2qjv_A 270 Uncharacterized IOLB-like protein; structural geno 93.7
3rcq_A197 Aspartyl/asparaginyl beta-hydroxylase; structural 93.67
4diq_A 489 Lysine-specific demethylase NO66; structural genom 93.31
3iwt_A178 178AA long hypothetical molybdenum cofactor biosy 92.69
3k2o_A336 Bifunctional arginine demethylase and lysyl-hydro 91.28
2yu1_A 451 JMJC domain-containing histone demethylation PROT; 90.77
3kv4_A447 PHD finger protein 8; epigenetics, histone CODE, c 90.72
3kv5_D488 JMJC domain-containing histone demethylation prote 90.67
3k3o_A371 PHF8, PHD finger protein 8; histone demethylase, c 90.62
2p17_A277 Pirin-like protein; GK1651, structural genomics, s 90.41
3pua_A392 GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe 90.03
1eyb_A 471 Homogentisate 1,2-dioxygenase; jelly roll, beta sa 89.97
1e5r_A290 Proline oxidase; oxidoreductase, oxygenase, 2-oxog 88.96
3kv9_A397 JMJC domain-containing histone demethylation prote 88.7
1uuy_A167 CNX1, molybdopterin biosynthesis CNX1; chelatase, 88.05
1ywk_A 289 4-deoxy-L-threo-5-hexosulose-uronate ketol- isomer 88.0
2vec_A256 YHAK, pirin-like protein YHAK; ROS, bicupin, sulfe 86.77
2ypd_A392 Probable JMJC domain-containing histone demethyla 86.67
1qwr_A319 Mannose-6-phosphate isomerase; structural genomics 86.33
2oyz_A94 UPF0345 protein VPA0057; unknown function, structu 85.76
1mkz_A172 Molybdenum cofactor biosynthesis protein B; MAD, W 84.65
1tq5_A242 Protein YHHW; bicupin, pirin, montreal-kingston ba 84.09
2l2q_A109 PTS system, cellobiose-specific IIB component (CE; 83.83
3g7d_A443 PHPD; non heme Fe(II) dioxygenase, cupin, biosynth 83.76
1zx5_A300 Mannosephosphate isomerase, putative; STRU genomic 83.38
3hqx_A111 UPF0345 protein aciad0356; DUF1255,PF06865,PSI2,MC 83.24
2qjv_A270 Uncharacterized IOLB-like protein; structural geno 83.18
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 82.32
1qwr_A 319 Mannose-6-phosphate isomerase; structural genomics 82.1
2pbq_A178 Molybdenum cofactor biosynthesis MOG; molybdopteri 81.88
2wfp_A394 Mannose-6-phosphate isomerase; APO-structure, meta 81.8
1j1l_A290 Pirin; beta sandwich, cupin, iron, metatl binding 81.59
1y5e_A169 Molybdenum cofactor biosynthesis protein B; struct 80.59
1e2b_A106 Enzyme IIB-cellobiose; phosphotransferase system, 80.57
>3he8_A Ribose-5-phosphate isomerase; CTRPI B, isomerization; 1.90A {Clostridium thermocellum} PDB: 3hee_A* Back     alignment and structure
Probab=100.00  E-value=1e-57  Score=385.66  Aligned_cols=139  Identities=35%  Similarity=0.545  Sum_probs=134.3

Q ss_pred             cEEEEEeCcccHHHHHHHHHHHHhCCCcEEEecCC-----CCcchhHHHHHHhhcCCCCCCcceEEEEecCchhhhhhhc
Q 021698           13 LKIIAGADSFGAELKDALVSHLRSLNIDVEDLGTS-----DYYSIGAEVGRRVSSSDSSETTTRGLVACGTGVGVAIFAN   87 (309)
Q Consensus        13 mkI~ig~D~~g~~lk~~l~~~l~~~g~~v~d~g~~-----~y~~~a~~va~~v~~~~~~~~~~~gi~~cgtG~G~~i~aN   87 (309)
                      |||+|||||+||+||+.|++||+++||||+|+|++     |||+++.+||++|++    |+++|||||||||+||||+||
T Consensus         1 MkI~igsDhaG~~lK~~i~~~L~~~G~eV~D~G~~~~~~~dYpd~a~~va~~V~~----g~~d~GIliCGTGiG~siaAN   76 (149)
T 3he8_A            1 MKIGIGSDHGGYNLKREIADFLKKRGYEVIDFGTHGNESVDYPDFGLKVAEAVKS----GECDRGIVICGTGLGISIAAN   76 (149)
T ss_dssp             CEEEEEECGGGHHHHHHHHHHHHHTTCEEEECCCCSSSCCCHHHHHHHHHHHHHT----TSSSEEEEEESSSHHHHHHHH
T ss_pred             CEEEEEECchhHHHHHHHHHHHHHCCCEEEEcCCCCCCCCCHHHHHHHHHHHHHc----CCCCEEEEEcCCcHHHHHHhh
Confidence            89999999999999999999999999999999985     599999999999999    999999999999999999999


Q ss_pred             CCCceEEEEeCCHHHHHHHHhhcCcceeeecccccCHHHHHHHHHHHhcCCCCCCCCCCCCchhhHHHHhHh
Q 021698           88 KNPGVFATTCLTPADALNTRSINNCNVLAVSGMSTSKESAVEILDTWLKTPFKAPCPASGLKPWDEKLSCFF  159 (309)
Q Consensus        88 K~~giraa~~~~~~~A~~~r~hNnaNvl~~g~~~~~~~~a~~i~~~~l~~~f~~~~~~~~~~~~l~~I~~~l  159 (309)
                      |+||||||+|+|+++|+|+|+||||||||||+|++|+++|++|+++||+|+|++    ++++++++.|.++-
T Consensus        77 Kv~GIRAAl~~d~~sA~~ar~hNnaNVl~lG~rvig~~~A~~iv~~fL~t~F~g----grh~~Rv~ki~~~e  144 (149)
T 3he8_A           77 KVPGIRAAVCTNSYMARMSREHNDANILALGERVVGLDLALDIVDTWLKAEFQG----GRHATRVGKIGEIE  144 (149)
T ss_dssp             TSTTCCEEECSSHHHHHHHHHTTCCSEEEEETTTSCHHHHHHHHHHHHHCCCCC----THHHHHHHHHHHHH
T ss_pred             cCCCeEEEEeCCHHHHHHHHHhCCCcEEEEcccccCHHHHHHHHHHHHcCCCCC----cchHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999999999997    68999999887654



>3ph3_A Ribose-5-phosphate isomerase; alpha-beta-alpha sandwich fold; HET: RB5; 2.07A {Clostridium thermocellum} SCOP: c.121.1.1 PDB: 3ph4_A* Back     alignment and structure
>3s5p_A Ribose 5-phosphate isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.30A {Giardia lamblia} Back     alignment and structure
>3sgw_A Ribose 5-phosphate isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, valley fever; 1.70A {Coccidioides immitis} PDB: 3sdw_A 3qd5_A* Back     alignment and structure
>2vvr_A Ribose-5-phosphate isomerase B; RPIB, carbohydrate metabolism, pentose phosphate pathway; 2.10A {Escherichia coli} PDB: 1nn4_A Back     alignment and structure
>1o1x_A Ribose-5-phosphate isomerase RPIB; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 1.90A {Thermotoga maritima} SCOP: c.121.1.1 Back     alignment and structure
>3k7p_A Ribose 5-phosphate isomerase; pentose phosphate pathway, type B ribose 5-phosphate isomera (RPIB), R5P; 1.40A {Trypanosoma cruzi} SCOP: c.121.1.0 PDB: 3k7s_A* 3k7o_A* 3k8c_A* 3m1p_A Back     alignment and structure
>2vvp_A Ribose-5-phosphate isomerase B; RPIB, RV2465C, RARE sugar, carbohydrate metabolism, pentose phosphate pathway; HET: R52 5RP; 1.65A {Mycobacterium tuberculosis} SCOP: c.121.1.1 PDB: 2vvo_A* 2vvq_A* 2bes_A* 2bet_A* 1usl_A Back     alignment and structure
>4em8_A Ribose 5-phosphate isomerase B; ssgcid, seattle structural genomics center for infectious DI niaid; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2ppw_A Conserved domain protein; the putative RPIB, PSI-2, protein initiative, MCSG, structural genomics, midwest center for S genomics; HET: MSE; 2.01A {Streptococcus pneumoniae} Back     alignment and structure
>3ono_A Ribose/galactose isomerase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.75A {Vibrio parahaemolyticus} Back     alignment and structure
>3c5y_A Ribose/galactose isomerase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.81A {Novosphingobium aromaticivorans} Back     alignment and structure
>2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} Back     alignment and structure
>3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} Back     alignment and structure
>2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} Back     alignment and structure
>2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A Back     alignment and structure
>4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} Back     alignment and structure
>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 Back     alignment and structure
>1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 Back     alignment and structure
>2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18 Back     alignment and structure
>3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A Back     alignment and structure
>2o1q_A Putative acetyl/propionyl-COA carboxylase, alpha; putative acetylacetone dioxygenase, structural genomics; HET: MSE PG4; 1.50A {Methylibium petroleiphilum} SCOP: b.82.1.21 Back     alignment and structure
>3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} Back     alignment and structure
>1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A Back     alignment and structure
>4i4a_A Similar to unknown protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.35A {Photorhabdus luminescens subsp} Back     alignment and structure
>2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A Back     alignment and structure
>3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} Back     alignment and structure
>1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* Back     alignment and structure
>2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3bal_A Acetylacetone-cleaving enzyme; jelly roll, tetramer, dioxygenase, iron, metal-binding, oxidoreductase; 1.95A {Acinetobacter johnsonii} Back     alignment and structure
>3ebr_A Uncharacterized RMLC-like cupin; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.60A {Ralstonia eutropha JMP134} Back     alignment and structure
>3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} Back     alignment and structure
>3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 Back     alignment and structure
>2vpv_A Protein MIF2, MIF2P; nucleus, mitosis, centromere, cell cycle, DNA-binding, kinetochore, cell division, phosphoprotein, jelly-roll fold; 2.7A {Saccharomyces cerevisiae} Back     alignment and structure
>2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans} Back     alignment and structure
>2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans} Back     alignment and structure
>3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>4h7l_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, cupin, unknown function; 2.45A {Planctomyces limnophilus} Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} Back     alignment and structure
>3cjx_A Protein of unknown function with A cupin-like FOL; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.60A {Ralstonia eutropha} Back     alignment and structure
>2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} Back     alignment and structure
>3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} Back     alignment and structure
>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 Back     alignment and structure
>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 Back     alignment and structure
>3lag_A Uncharacterized protein RPA4178; functionally unknown protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.15A {Rhodopseudomonas palustris} Back     alignment and structure
>3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} Back     alignment and structure
>1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A Back     alignment and structure
>2xlg_A SLL1785 protein, CUCA; metal binding protein, cupin; 1.80A {Synechocystis SP} PDB: 2xl7_A 2xl9_A 2xlf_A* 2xla_A Back     alignment and structure
>1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Back     alignment and structure
>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A Back     alignment and structure
>4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism} Back     alignment and structure
>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Back     alignment and structure
>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Back     alignment and structure
>1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* Back     alignment and structure
>2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha} Back     alignment and structure
>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 Back     alignment and structure
>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 Back     alignment and structure
>1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A Back     alignment and structure
>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Back     alignment and structure
>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Back     alignment and structure
>2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile} Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Back     alignment and structure
>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Back     alignment and structure
>3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} Back     alignment and structure
>3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei} Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Back     alignment and structure
>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Back     alignment and structure
>1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A* Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Back     alignment and structure
>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Back     alignment and structure
>2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Back     alignment and structure
>1vr3_A Acireductone dioxygenase; 13543033, structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.06A {Mus musculus} SCOP: b.82.1.6 Back     alignment and structure
>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Back     alignment and structure
>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Back     alignment and structure
>1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20 Back     alignment and structure
>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A Back     alignment and structure
>2arc_A ARAC, arabinose operon regulatory protein; transcription factor, carbohydrate binding, coiled-coil, jelly roll; HET: ARA; 1.50A {Escherichia coli} SCOP: b.82.4.1 PDB: 2aac_A* 1xja_A 2ara_A Back     alignment and structure
>2y0o_A Probable D-lyxose ketol-isomerase; carbohydrate metabolism, metal-binding, sugar ISO stress response; HET: MSE; 1.23A {Bacillus subtilis subsp} Back     alignment and structure
>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Back     alignment and structure
>1zrr_A E-2/E-2' protein; nickel, cupin, beta helix, methionine salvage, oxidoreductase; NMR {Klebsiella oxytoca} SCOP: b.82.1.6 PDB: 2hji_A Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Back     alignment and structure
>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Back     alignment and structure
>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Back     alignment and structure
>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Back     alignment and structure
>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Back     alignment and structure
>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Back     alignment and structure
>3d0j_A Uncharacterized protein CA_C3497; beta-barrel, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.53A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Back     alignment and structure
>3eqe_A Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis} Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Back     alignment and structure
>2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A Back     alignment and structure
>2gm6_A Cysteine dioxygenase type I; structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; 1.84A {Ralstonia eutropha} SCOP: b.82.1.19 Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} Back     alignment and structure
>3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei} Back     alignment and structure
>2pa7_A DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysugar biosynthesis, S-layer biosynthesis, ketoisomerase; HET: TYD; 1.50A {Aneurinibacillus thermoaerophilus} SCOP: b.82.1.1 PDB: 2pae_A* 2pak_A* 2pam_A* Back     alignment and structure
>3es4_A Uncharacterized protein DUF861 with A RMLC-like C; 17741406, protein of unknown function (DUF861) with A RMLC-L fold; HET: MSE; 1.64A {Agrobacterium tumefaciens str} Back     alignment and structure
>3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, DNA-binding transcription, transcription regulation; HET: PAM; 1.90A {Vibrio cholerae} Back     alignment and structure
>3eln_A Cysteine dioxygenase type 1; peroxysulfenate, non-heme dioxygenases, Fe2+ metalloenzyme, taurine, thioether, iron, metal- binding; 1.42A {Rattus norvegicus} SCOP: b.82.1.19 PDB: 2gh2_A 2b5h_A 2atf_A* 2q4s_A 2ic1_A Back     alignment and structure
>2vec_A YHAK, pirin-like protein YHAK; ROS, bicupin, sulfenic acid, reactive cysteine, cytosolic protein; 1.85A {Escherichia coli} Back     alignment and structure
>3uss_A Putative uncharacterized protein; cupin, three histidine, non-heme iron, cysteine catabolism, oxidoreductase; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.19 Back     alignment and structure
>3ejk_A DTDP sugar isomerase; YP_390184.1, structural genomics, JOIN for structural genomics, JCSG; HET: CIT; 1.95A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} Back     alignment and structure
>3kmh_A D-lyxose isomerase; cupin beta-barrel, structural genomics, montreal-kingston BA structural genomics initiative, BSGI; 1.58A {Escherichia coli O157} PDB: 3mpb_A* Back     alignment and structure
>2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A Back     alignment and structure
>1tq5_A Protein YHHW; bicupin, pirin, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics, unknown function; 1.76A {Escherichia coli} SCOP: b.82.1.12 Back     alignment and structure
>4gjz_A Lysine-specific demethylase 8; JMJC, beta barrel, Fe(II) and 2-oxoglutarate binding, oxidor; HET: AKG BME; 1.05A {Homo sapiens} PDB: 4gjy_A* 4aap_A* 3uyj_A* Back     alignment and structure
>1nxm_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jelly roll-like structure, beta sheet, isomerase; 1.30A {Streptococcus suis} SCOP: b.82.1.1 PDB: 1nyw_A* 1nzc_A* 2ixl_A* Back     alignment and structure
>1vrb_A Putative asparaginyl hydroxylase; 2636534, structural genomi center for structural genomics, JCSG, protein structure INI PSI, oxidoreductase; 2.60A {Bacillus subtilis} SCOP: b.82.2.11 Back     alignment and structure
>2qdr_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE EPE; 2.60A {Nostoc punctiforme} Back     alignment and structure
>3bb6_A Uncharacterized protein YEAR; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Escherichia coli} SCOP: b.82.2.13 Back     alignment and structure
>3al5_A HTYW5, JMJC domain-containing protein C2ORF60; tRNA modification enzyme, unknown function; 2.50A {Homo sapiens} PDB: 3al6_A* Back     alignment and structure
>1ep0_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; racemase, DTDP-4-dehydrorhamnose epimerase, structural genomics, PSI; 1.50A {Methanothermobacterthermautotrophicus} SCOP: b.82.1.1 PDB: 1epz_A* Back     alignment and structure
>3ryk_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, STRU genomics, infectious diseases; HET: TYD; 1.63A {Bacillus anthracis str} Back     alignment and structure
>2ixk_A DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, lipopolysaccharide biosynthesis, epimerise, epimerize; HET: TDO; 1.7A {Pseudomonas aeruginosa} PDB: 2ixi_A* 2ixh_A* 1rtv_A* 2ixj_A* Back     alignment and structure
>1wlt_A 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 5-epimerase; jelly roll-like topology, flattened barrel, isomerase; 1.90A {Sulfolobus tokodaii} SCOP: b.82.1.1 PDB: 2b9u_A Back     alignment and structure
>2p17_A Pirin-like protein; GK1651, structural genomics, south collaboratory for structural genomics, protein structure in secsg; 1.52A {Geobacillus kaustophilus} Back     alignment and structure
>1yud_A Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.70A {Shewanella oneidensis} SCOP: b.82.1.16 Back     alignment and structure
>1dgw_X Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_X Back     alignment and structure
>1dzr_A DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, 3\,5-hexulose epimerase; 2.17A {Salmonella typhimurium} SCOP: b.82.1.1 PDB: 1dzt_A* Back     alignment and structure
>1oi6_A PCZA361.16; epimerase, vancomycin group antibiotic, EVAD, isomerase; HET: TMP; 1.4A {Amycolatopsis orientalis} SCOP: b.82.1.1 PDB: 1ofn_A* 1wa4_A Back     alignment and structure
>1upi_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, PSI, protein structure initiative, TB structural genomics consortium, TB; HET: CME; 1.7A {Mycobacterium tuberculosis} SCOP: b.82.1.1 PDB: 2ixc_A* 1pm7_A* Back     alignment and structure
>2xdv_A MYC-induced nuclear antigen; ribosome biogenesis, nuclear protein; HET: OGA; 2.57A {Homo sapiens} Back     alignment and structure
>2c0z_A NOVW; isomerase, epimerase, antibiotic biosynthesis, RMLC-like cupin; 1.60A {Streptomyces sphaeroides} SCOP: b.82.1.1 Back     alignment and structure
>3dl3_A Tellurite resistance protein B; X-RAY NESG VFR98 Q5E3X2_VIBF1, structural genomics, PSI-2, protein structure initiative; 2.30A {Vibrio fischeri ES114} SCOP: b.82.2.13 Back     alignment and structure
>1j1l_A Pirin; beta sandwich, cupin, iron, metatl binding protein; 2.10A {Homo sapiens} SCOP: b.82.1.12 PDB: 3acl_A* Back     alignment and structure
>2qdr_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE EPE; 2.60A {Nostoc punctiforme} Back     alignment and structure
>4hn1_A Putative 3-epimerase in D-allose pathway; 3'-monoepimerase, natural product, deoxysugar, chalcomycin, mycinose, cupin fold; HET: TYD THM; 1.60A {Streptomyces bikiniensis} PDB: 4hmz_A* 4hn0_A Back     alignment and structure
>3d8c_A Hypoxia-inducible factor 1 alpha inhibitor; FIH, HIF, DSBH, oxygenase, transcription, inhibitor oxoglutarate, asparaginyl hydroxylase; HET: AKG; 2.10A {Homo sapiens} PDB: 2ilm_A* 2w0x_A* 1h2l_A* 1h2m_A* 1h2n_A* 1yci_A* 2cgn_A 2cgo_A* 1h2k_A* 2wa3_A* 2wa4_A* 3od4_A* 3p3n_A* 3p3p_A* 2yc0_A* 2y0i_A* 2yde_A* 1mze_A* 1mzf_A* 2xum_A* ... Back     alignment and structure
>2qjv_A Uncharacterized IOLB-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MLY MSE; 1.90A {Salmonella typhimurium LT2} Back     alignment and structure
>3rcq_A Aspartyl/asparaginyl beta-hydroxylase; structural genomics, structural genomics consortium, SGC, oxidoreductase, human; HET: OGA; 2.05A {Homo sapiens} Back     alignment and structure
>4diq_A Lysine-specific demethylase NO66; structural genomics, structural genomics consortium, SGC, HI demethylase, oxidoreductase; HET: PD2; 2.40A {Homo sapiens} Back     alignment and structure
>3iwt_A 178AA long hypothetical molybdenum cofactor biosy protein B; biosynthesis, structural genomics, UNKN function, NPPSFA; HET: PEG; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3k2o_A Bifunctional arginine demethylase and lysyl-hydro JMJD6; structural genomics consortium, SGC, chromatin regulator, developmental protein; 1.75A {Homo sapiens} PDB: 3ld8_A 3ldb_A* Back     alignment and structure
>2yu1_A JMJC domain-containing histone demethylation PROT; JMJC-domain-containing histone demethylases, oxidoreductase; HET: AKG; 2.70A {Homo sapiens} PDB: 2yu2_A Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>3k3o_A PHF8, PHD finger protein 8; histone demethylase, chromatin modification, methylated H3K9, mental retardation, metal-BI phosphoprotein, zinc-finger; HET: AKG; 2.10A {Homo sapiens} PDB: 3k3n_A* 4do0_A* 2wwu_A* Back     alignment and structure
>2p17_A Pirin-like protein; GK1651, structural genomics, south collaboratory for structural genomics, protein structure in secsg; 1.52A {Geobacillus kaustophilus} Back     alignment and structure
>3pua_A GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe2+ dependent dioxygenases, histone TAI protein, protein binding; HET: OGA; 1.89A {Homo sapiens} PDB: 3pu3_A* 3ptr_B* 3pu8_B* 3pus_A* Back     alignment and structure
>1eyb_A Homogentisate 1,2-dioxygenase; jelly roll, beta sandwich, oxidoreductase; 1.90A {Homo sapiens} SCOP: b.82.1.4 PDB: 1ey2_A Back     alignment and structure
>1e5r_A Proline oxidase; oxidoreductase, oxygenase, 2-oxoglutarate dependent oxygenase; 2.30A {Streptomyces SP} SCOP: b.82.2.4 PDB: 1e5s_A Back     alignment and structure
>3kv9_A JMJC domain-containing histone demethylation protein 1D; jumonji domain lysine demethylase, metal-binding, zinc, zinc-finger; 2.29A {Homo sapiens} PDB: 3kva_A* 3kvb_A* 3u78_A* Back     alignment and structure
>1uuy_A CNX1, molybdopterin biosynthesis CNX1; chelatase, molybdenum cofactor biosynthesis; HET: MTE AMP; 1.45A {Arabidopsis thaliana} SCOP: c.57.1.1 PDB: 1o8q_A 1o8n_A 1o8o_A 1uux_A* 1eav_A Back     alignment and structure
>1ywk_A 4-deoxy-L-threo-5-hexosulose-uronate ketol- isomerase 1; structural genomics, nysgxrc target T1814, PSI, protein structure initiative; 2.95A {Enterococcus faecalis} SCOP: b.82.1.13 Back     alignment and structure
>2vec_A YHAK, pirin-like protein YHAK; ROS, bicupin, sulfenic acid, reactive cysteine, cytosolic protein; 1.85A {Escherichia coli} Back     alignment and structure
>2ypd_A Probable JMJC domain-containing histone demethyla PROT EIN 2C; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>1qwr_A Mannose-6-phosphate isomerase; structural genomics, D-mannose 6-phosphate, PSI, protein structure initiative; 1.80A {Bacillus subtilis} SCOP: b.82.1.3 Back     alignment and structure
>2oyz_A UPF0345 protein VPA0057; unknown function, structural genomi 2, protein structure initiative, midwest center for structu genomics, MCSG; 1.71A {Vibrio parahaemolyticus} SCOP: b.82.1.22 Back     alignment and structure
>1mkz_A Molybdenum cofactor biosynthesis protein B; MAD, WEAK anomalous signal, molybdopterin synthesis, structural genomics, PSI; HET: MSE; 1.60A {Escherichia coli} SCOP: c.57.1.1 PDB: 1r2k_B Back     alignment and structure
>1tq5_A Protein YHHW; bicupin, pirin, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics, unknown function; 1.76A {Escherichia coli} SCOP: b.82.1.12 Back     alignment and structure
>2l2q_A PTS system, cellobiose-specific IIB component (CE; cellobiose-specific phosphotransferase IIB component, struct genomics; NMR {Borrelia burgdorferi} Back     alignment and structure
>3g7d_A PHPD; non heme Fe(II) dioxygenase, cupin, biosynthetic protein; 1.80A {Streptomyces viridochromogenes} PDB: 3gbf_A 3rzz_A Back     alignment and structure
>1zx5_A Mannosephosphate isomerase, putative; STRU genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; HET: LFR; 2.30A {Archaeoglobus fulgidus} SCOP: b.82.1.3 Back     alignment and structure
>3hqx_A UPF0345 protein aciad0356; DUF1255,PF06865,PSI2,MCSG, structural genomics, protein STRU initiative, midwest center for structural genomics; 1.66A {Acinetobacter SP} SCOP: b.82.1.0 Back     alignment and structure
>2qjv_A Uncharacterized IOLB-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MLY MSE; 1.90A {Salmonella typhimurium LT2} Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>1qwr_A Mannose-6-phosphate isomerase; structural genomics, D-mannose 6-phosphate, PSI, protein structure initiative; 1.80A {Bacillus subtilis} SCOP: b.82.1.3 Back     alignment and structure
>2pbq_A Molybdenum cofactor biosynthesis MOG; molybdopterin, MPT, structural genomics, NPPSFA, national PR protein structural and functional analyses; 1.70A {Aquifex aeolicus} PDB: 2qq1_A 3mci_A 3mcj_A 3k6a_A* 2f7w_A 2f7y_A 2fuw_A Back     alignment and structure
>2wfp_A Mannose-6-phosphate isomerase; APO-structure, metal-binding; 1.67A {Salmonella typhimurium} PDB: 3h1w_A 3h1m_A 3h1y_A* Back     alignment and structure
>1j1l_A Pirin; beta sandwich, cupin, iron, metatl binding protein; 2.10A {Homo sapiens} SCOP: b.82.1.12 PDB: 3acl_A* Back     alignment and structure
>1y5e_A Molybdenum cofactor biosynthesis protein B; structural genomics, protein structure initiative, PSI, MCSG, midwest center for structural genomics; 1.90A {Bacillus cereus} SCOP: c.57.1.1 Back     alignment and structure
>1e2b_A Enzyme IIB-cellobiose; phosphotransferase system, transferas transport, phosphorylation; NMR {Escherichia coli} SCOP: c.44.2.1 PDB: 1iib_A 1h9c_A* 2wwv_D 2wy2_D Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 309
d1o1xa_145 c.121.1.1 (A:) Putative sugar-phosphate isomerase 3e-27
d2vvpa1156 c.121.1.1 (A:3-158) Alternate ribose 5-phosphate i 5e-27
d1nn4a_159 c.121.1.1 (A:) Alternate ribose 5-phosphate isomer 6e-27
d2o1qa1144 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA 2e-15
d2d40a1 308 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Es 6e-08
d2d40a1308 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Es 6e-06
d3bu7a1 355 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Si 6e-07
d3bu7a1355 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Si 2e-05
d2phda1 351 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Ps 1e-06
d2phda1351 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Ps 2e-05
d1y3ta1 330 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Baci 1e-06
d1y3ta1330 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Baci 1e-05
d1yhfa1112 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {S 4e-06
d1sefa_250 b.82.1.11 (A:) Hypothetical protein EF2996 {Entero 3e-05
d1sefa_ 250 b.82.1.11 (A:) Hypothetical protein EF2996 {Entero 0.001
d1juha_348 b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergill 3e-05
d1juha_ 348 b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergill 2e-04
d1sq4a_273 b.82.1.11 (A:) Glyoxylate-induced protein PA1140 { 8e-05
d1sq4a_ 273 b.82.1.11 (A:) Glyoxylate-induced protein PA1140 { 2e-04
d1j58a_ 372 b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {B 2e-04
d1sfna_ 245 b.82.1.11 (A:) Hypothetical protein DR1152 {Deinoc 3e-04
d1sfna_245 b.82.1.11 (A:) Hypothetical protein DR1152 {Deinoc 3e-04
d1rc6a_253 b.82.1.11 (A:) Hypothetical protein YlbA {Escheric 3e-04
d1rc6a_ 253 b.82.1.11 (A:) Hypothetical protein YlbA {Escheric 6e-04
d1uija1170 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybea 5e-04
d2f4pa1134 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Th 0.001
d1uika1203 b.82.1.2 (A:148-350) Seed storage 7S protein {Soyb 0.002
d1vj2a_114 b.82.1.10 (A:) Hypothetical protein TM1459 {Thermo 0.002
d2bnma2122 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid 0.004
>d1o1xa_ c.121.1.1 (A:) Putative sugar-phosphate isomerase {Thermotoga maritima [TaxId: 2336]} Length = 145 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribose/Galactose isomerase RpiB/AlsB
superfamily: Ribose/Galactose isomerase RpiB/AlsB
family: Ribose/Galactose isomerase RpiB/AlsB
domain: Putative sugar-phosphate isomerase
species: Thermotoga maritima [TaxId: 2336]
 Score =  101 bits (254), Expect = 3e-27
 Identities = 49/134 (36%), Positives = 73/134 (54%), Gaps = 9/134 (6%)

Query: 11  HPLKIIAGADSFGAELKDALVSHLRSLNIDVEDLGT-----SDYYSIGAEVGRRVSSSDS 65
           H +KI   +D    ELK+ + ++L    I+VED GT      DY     +V + + S+++
Sbjct: 1   HHVKIAIASDHAAFELKEKVKNYLLGKGIEVEDHGTYSEESVDYPDYAKKVVQSILSNEA 60

Query: 66  SETTTRGLVACGTGVGVAIFANKNPGVFATTCLTPADALNTRSINNCNVLAVSGMSTSKE 125
                 G++ CGTG+G++I AN+  G+ A  CL P  A   RS NN N+L + G     E
Sbjct: 61  D----FGILLCGTGLGMSIAANRYRGIRAALCLFPDMARLARSHNNANILVLPGRLIGAE 116

Query: 126 SAVEILDTWLKTPF 139
            A  I+DT+L TPF
Sbjct: 117 LAFWIVDTFLSTPF 130


>d2vvpa1 c.121.1.1 (A:3-158) Alternate ribose 5-phosphate isomerase B, RpiB {Mycobacterium tuberculosis [TaxId: 1773]} Length = 156 Back     information, alignment and structure
>d1nn4a_ c.121.1.1 (A:) Alternate ribose 5-phosphate isomerase B, RpiB {Escherichia coli [TaxId: 562]} Length = 159 Back     information, alignment and structure
>d2o1qa1 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 {Rubrivivax gelatinosus [TaxId: 28068]} Length = 144 Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Length = 308 Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Length = 308 Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Length = 355 Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Length = 355 Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Length = 351 Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Length = 351 Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Length = 330 Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Length = 330 Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Length = 112 Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Length = 250 Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Length = 250 Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Length = 348 Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Length = 348 Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Length = 273 Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Length = 273 Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Length = 372 Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Length = 245 Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Length = 245 Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Length = 253 Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Length = 253 Back     information, alignment and structure
>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Length = 170 Back     information, alignment and structure
>d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} Length = 134 Back     information, alignment and structure
>d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 203 Back     information, alignment and structure
>d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} Length = 114 Back     information, alignment and structure
>d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} Length = 122 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query309
d1o1xa_145 Putative sugar-phosphate isomerase {Thermotoga mar 100.0
d1nn4a_159 Alternate ribose 5-phosphate isomerase B, RpiB {Es 100.0
d2vvpa1156 Alternate ribose 5-phosphate isomerase B, RpiB {My 100.0
d1vj2a_114 Hypothetical protein TM1459 {Thermotoga maritima [ 99.47
d2b8ma1108 Hypothetical protein MJ0764 {Archaeon Methanococcu 99.44
d1yhfa1112 Hypothetical protein SPy1581 {Streptococcus pyogen 99.38
d1o4ta_115 Hypothetical protein TM1287 {Thermotoga maritima [ 99.36
d1y9qa299 Probable transcriptional regulator VC1968, C-termi 99.35
d1v70a_105 Hypothetical protein TTHA0104 {Thermus thermophilu 99.34
d1lr5a_160 Auxin binding protein {Maize (Zea mays) [TaxId: 45 99.25
d2f4pa1134 Hypothetical protein TM1010 {Thermotoga maritima [ 99.2
d1sefa_250 Hypothetical protein EF2996 {Enterococcus faecalis 99.1
d1sfna_245 Hypothetical protein DR1152 {Deinococcus radiodura 99.09
d2bnma2122 Hydroxypropylphosphonic acid epoxidase Fom4, C-ter 99.08
d2pyta1128 Ethanolamine utilization protein EutQ {Salmonella 99.06
d2o1qa1144 Putative acetyl/propionyl-CoA carboxylase subunit 99.06
d1rc6a_253 Hypothetical protein YlbA {Escherichia coli [TaxId 99.02
d1sq4a_273 Glyoxylate-induced protein PA1140 {Pseudomonas aer 99.0
d1y3ta1 330 Hypothetical protein YxaG {Bacillus subtilis [TaxI 98.97
d1sefa_ 250 Hypothetical protein EF2996 {Enterococcus faecalis 98.96
d1sq4a_ 273 Glyoxylate-induced protein PA1140 {Pseudomonas aer 98.9
d2d40a1 308 Gentisate 1,2-dioxygenase {Escherichia coli [TaxId 98.88
d1y3ta1330 Hypothetical protein YxaG {Bacillus subtilis [TaxI 98.86
d1rc6a_ 253 Hypothetical protein YlbA {Escherichia coli [TaxId 98.86
d1juha_ 348 Quercetin 2,3-dioxygenase {Aspergillus japonicus [ 98.83
d1j58a_372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 98.83
d2et1a1201 Germin {Barley (Hordeum vulgare) [TaxId: 4513]} 98.8
d1sfna_ 245 Hypothetical protein DR1152 {Deinococcus radiodura 98.76
d1x82a_190 Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc 98.72
d1j58a_ 372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 98.71
g1dgw.1168 Seed storage 7S protein {Jack bean (Canavalia ensi 98.7
d1fxza2174 Seed storage 7S protein {Soybean (Glycine max), pr 98.67
d1uija1170 Seed storage 7S protein {Soybean (Glycine max), be 98.67
d2phda1 351 Gentisate 1,2-dioxygenase {Pseudaminobacter salicy 98.65
d2d40a1308 Gentisate 1,2-dioxygenase {Escherichia coli [TaxId 98.63
d1dgwa_178 Seed storage 7S protein {Jack bean (Canavalia ensi 98.6
d3bu7a1355 Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ 98.59
d1od5a2173 Seed storage 7S protein {Soybean (Glycine max), gl 98.58
d2phla2162 Seed storage 7S protein {French bean (Phaseolus vu 98.55
d1uika1203 Seed storage 7S protein {Soybean (Glycine max), be 98.54
d2phda1351 Gentisate 1,2-dioxygenase {Pseudaminobacter salicy 98.48
d1uika2185 Seed storage 7S protein {Soybean (Glycine max), be 98.47
d3bu7a1 355 Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ 98.46
d1juha_348 Quercetin 2,3-dioxygenase {Aspergillus japonicus [ 98.42
d2phla1200 Seed storage 7S protein {French bean (Phaseolus vu 98.16
d2arca_161 Regulatory protein AraC {Escherichia coli [TaxId: 98.05
d1zrra1179 Acireductone dioxygenase {Klebsiella pneumoniae [T 98.0
d1vr3a1179 Acireductone dioxygenase {Mouse (Mus musculus) [Ta 97.79
d1od5a1245 Seed storage 7S protein {Soybean (Glycine max), gl 97.78
d1fxza1239 Seed storage 7S protein {Soybean (Glycine max), pr 97.77
d2pa7a1135 dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Ane 97.58
d1yfua1174 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia m 97.51
d1zvfa1175 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yea 97.43
d1o5ua_88 Hypothetical protein TM1112 {Thermotoga maritima [ 97.13
d1vrba1319 Putative asparaginyl hydroxylase YxbC {Bacillus su 97.08
d1tq5a1231 Hypothetical protein YhhW {Escherichia coli [TaxId 96.78
d2gm6a1192 Cysteine dioxygenase type I {Ralstonia eutropha [T 96.58
d3elna1186 Cysteine dioxygenase type I {Rattus norvegicus [Ta 96.16
d1wlta1176 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo 95.24
d3dl3a196 Tellurite resistance protein B, TehB {Vibrio fisch 95.12
d3bb6a1109 Uncharacterized protein YeaR {Escherichia coli [Ta 95.05
d1dzra_183 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmone 94.92
d2ixca1198 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobac 94.92
d1h2ka_335 Hypoxia-inducible factor HIF ihhibitor (FIH1) {Hum 94.75
d2c0za1190 Novobiocin biosynthesis protein NovW {Streptomyces 94.66
d1j1la_ 288 Pirin {Human (Homo sapiens) [TaxId: 9606]} 94.44
d1nxma_194 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Strepto 94.42
d1eyba_ 439 Homogentisate dioxygenase {Human (Homo sapiens) [T 94.38
d1ep0a_183 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo 94.24
d1qwra_315 Mannose-6-phosphate isomerase ManA {Bacillus subti 93.44
d2ixha1184 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudom 93.3
d1oi6a_202 dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amyc 93.13
d1mkza_170 MoaB {Escherichia coli [TaxId: 562]} 92.32
d1y5ea1155 MoaB {Bacillus cereus [TaxId: 1396]} 91.31
d1e5ra_290 Type II Proline 3-hydroxylase (proline oxidase) {S 90.5
d1ccwa_137 Glutamate mutase, small subunit {Clostridium cochl 90.37
d1ft9a2132 CO-sensing protein CooA, N-terminal domain {Rhodos 83.84
d1cx4a2147 Regulatory subunit of Protein kinase A {Rat (Rattu 83.68
d1zx5a1299 Putative mannosephosphate isomerase AF0035 {Archae 83.3
d1ywka1 260 5-keto-4-deoxyuronate isomerase KduI {Enterococcus 83.05
d1p5dx1146 Phosphomannomutase/phosphoglucomutase {Pseudomonas 82.5
d1qwra_ 315 Mannose-6-phosphate isomerase ManA {Bacillus subti 82.48
d1v7ra_186 XTP pyrophosphatase {Archaeon Pyrococcus horikoshi 82.12
d1zx5a1299 Putative mannosephosphate isomerase AF0035 {Archae 82.06
d1tq5a1231 Hypothetical protein YhhW {Escherichia coli [TaxId 81.14
d1pmia_ 440 Phosphomannose isomerase {Yeast (Candida albicans) 80.88
>d1o1xa_ c.121.1.1 (A:) Putative sugar-phosphate isomerase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribose/Galactose isomerase RpiB/AlsB
superfamily: Ribose/Galactose isomerase RpiB/AlsB
family: Ribose/Galactose isomerase RpiB/AlsB
domain: Putative sugar-phosphate isomerase
species: Thermotoga maritima [TaxId: 2336]
Probab=100.00  E-value=5.7e-55  Score=367.17  Aligned_cols=139  Identities=36%  Similarity=0.497  Sum_probs=132.8

Q ss_pred             CCcEEEEEeCcccHHHHHHHHHHHHhCCCcEEEecCC-----CCcchhHHHHHHhhcCCCCCCcceEEEEecCchhhhhh
Q 021698           11 HPLKIIAGADSFGAELKDALVSHLRSLNIDVEDLGTS-----DYYSIGAEVGRRVSSSDSSETTTRGLVACGTGVGVAIF   85 (309)
Q Consensus        11 ~~mkI~ig~D~~g~~lk~~l~~~l~~~g~~v~d~g~~-----~y~~~a~~va~~v~~~~~~~~~~~gi~~cgtG~G~~i~   85 (309)
                      +.|||+|||||+||+||++|++||+++||+|+|+|++     |||+++.+||+.|++    +++++||++||||+||+|+
T Consensus         1 ~~mkI~igsDh~G~~lK~~l~~~L~~~g~~v~D~G~~~~~~~dYpd~a~~va~~v~~----~~~~~GIliCGtG~G~sia   76 (145)
T d1o1xa_           1 HHVKIAIASDHAAFELKEKVKNYLLGKGIEVEDHGTYSEESVDYPDYAKKVVQSILS----NEADFGILLCGTGLGMSIA   76 (145)
T ss_dssp             CCCEEEEEECSTTHHHHHHHHHHHHHTTCEEEECCCCSSSCCCHHHHHHHHHHHHHT----TSCSEEEEEESSSHHHHHH
T ss_pred             CCcEEEEEeCChHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCccHHHHHHHHHHhc----CcccEEEEecCCcHHHHHH
Confidence            4699999999999999999999999999999999985     699999999999999    8999999999999999999


Q ss_pred             hcCCCceEEEEeCCHHHHHHHHhhcCcceeeecccccCHHHHHHHHHHHhcCCCCCCCCCCCCchhhHHHHh
Q 021698           86 ANKNPGVFATTCLTPADALNTRSINNCNVLAVSGMSTSKESAVEILDTWLKTPFKAPCPASGLKPWDEKLSC  157 (309)
Q Consensus        86 aNK~~giraa~~~~~~~A~~~r~hNnaNvl~~g~~~~~~~~a~~i~~~~l~~~f~~~~~~~~~~~~l~~I~~  157 (309)
                      ||||||||||+|+|+++|+|+|+||||||||||+|+++++.|++|+++||+|+|++    +++++++++|.+
T Consensus        77 ANK~~GIRAa~~~d~~~A~~ar~hNnaNvL~lGa~~~~~~~a~~iv~~~l~t~F~g----gRh~~Rv~ki~~  144 (145)
T d1o1xa_          77 ANRYRGIRAALCLFPDMARLARSHNNANILVLPGRLIGAELAFWIVDTFLSTPFDG----GRHERRIRKIDE  144 (145)
T ss_dssp             HTTSTTCCEEECSSHHHHHHHHHTTCCSEEEEETTTSCHHHHHHHHHHHHHCCCCC----TTHHHHHHHHTC
T ss_pred             HHcCCCCeeeeecCHHHHHHHHHhcCceEEEEccEecCHHHHHHHHHHHHCCCCCC----CcHHHHHHHHHc
Confidence            99999999999999999999999999999999999999999999999999999986    688888777653



>d1nn4a_ c.121.1.1 (A:) Alternate ribose 5-phosphate isomerase B, RpiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vvpa1 c.121.1.1 (A:3-158) Alternate ribose 5-phosphate isomerase B, RpiB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} Back     information, alignment and structure
>d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2o1qa1 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 {Rubrivivax gelatinosus [TaxId: 28068]} Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure
>d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Back     information, alignment and structure
>d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Back     information, alignment and structure
>d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d2arca_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure
>d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
>d2pa7a1 b.82.1.1 (A:2-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]} Back     information, alignment and structure
>d1yfua1 b.82.1.20 (A:1-174) 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia metallidurans [TaxId: 119219]} Back     information, alignment and structure
>d1zvfa1 b.82.1.20 (A:1-175) 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tq5a1 b.82.1.12 (A:1-231) Hypothetical protein YhhW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gm6a1 b.82.1.19 (A:11-202) Cysteine dioxygenase type I {Ralstonia eutropha [TaxId: 106590]} Back     information, alignment and structure
>d3elna1 b.82.1.19 (A:5-190) Cysteine dioxygenase type I {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1wlta1 b.82.1.1 (A:1-176) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d3dl3a1 b.82.2.13 (A:5-100) Tellurite resistance protein B, TehB {Vibrio fischeri [TaxId: 668]} Back     information, alignment and structure
>d3bb6a1 b.82.2.13 (A:1-109) Uncharacterized protein YeaR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dzra_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ixca1 b.82.1.1 (A:1-198) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1h2ka_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c0za1 b.82.1.1 (A:1-190) Novobiocin biosynthesis protein NovW {Streptomyces caeruleus [TaxId: 195949]} Back     information, alignment and structure
>d1j1la_ b.82.1.12 (A:) Pirin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nxma_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcus suis [TaxId: 1307]} Back     information, alignment and structure
>d1eyba_ b.82.1.4 (A:) Homogentisate dioxygenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ep0a_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ixha1 b.82.1.1 (A:1-184) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1oi6a_ b.82.1.1 (A:) dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1mkza_ c.57.1.1 (A:) MoaB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y5ea1 c.57.1.1 (A:12-166) MoaB {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1e5ra_ b.82.2.4 (A:) Type II Proline 3-hydroxylase (proline oxidase) {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} Back     information, alignment and structure
>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zx5a1 b.82.1.3 (A:1-299) Putative mannosephosphate isomerase AF0035 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ywka1 b.82.1.13 (A:1001-1260) 5-keto-4-deoxyuronate isomerase KduI {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1p5dx1 c.84.1.1 (X:9-154) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1v7ra_ c.51.4.1 (A:) XTP pyrophosphatase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1zx5a1 b.82.1.3 (A:1-299) Putative mannosephosphate isomerase AF0035 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1tq5a1 b.82.1.12 (A:1-231) Hypothetical protein YhhW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pmia_ b.82.1.3 (A:) Phosphomannose isomerase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure