Citrus Sinensis ID: 021746

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
MAANALTRQLSSTSTLWPPLKKPTFSKPRFAKPTPVSAFAMASFTTTQVAPAAIVGGGRVGTALKEMGKGQDLLVKRGELVPLDFEGPIFVCTRNDDLEAVLEAAPRSRWNDLVFFQNGMIEPWLESKGLKDANQVLAYFAVSKLGERPIDGKTDTNPEGLTAAYGKWASVVAERLSVGGLSCKVLDKEAFQKQMLEKLIWISAFMLVGARHTGATVGVVEKEYRSEVSALIAELALAAAAEKGITFDPAMEDRLCAYSRAVANFPTAVKEFKWRNGWFYSLSEKASAEGKPDPCPLHTAWLKEIKVV
cccccHHHHHcccccccccccccccccccccccccccEEEcccccccccccEEEEccccHHHHHHHccccccEEEcccccccccccccEEEEcccccHHHHHHHccccccccEEEEEccccHHHHHHcccccccEEEEEEEEEcccccccccccccccccccEEccccHHHHHHHHHcccccEEEccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccc
cHHHHHHHHHcccccccccccccccccHHccccccHHHHHHHHHHccccccEEEEcccHHHHHHHHccccccEEEEccccccccccccEEEEEcccHHHHHHHHccHHHHHHHHHEcccccHHHHHHcccccccEEEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHcccEEEEccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccEEEEccccccHHcHHHHHHHccccccccHHHHHHHHcccc
MAANALTRqlsststlwpplkkptfskprfakptpvsafaMASFTttqvapaaivgggrVGTALKEMGKGQDllvkrgelvpldfegpifvctrndDLEAVLEaaprsrwndlvffqngmiepwleskglkdaNQVLAYFAVSklgerpidgktdtnpegltaAYGKWASVVAERLSvgglsckvLDKEAFQKQMLEKLIWISAFMLVGARHTGATVGVVEKEYRSEVSALIAELALAAAAEkgitfdpaMEDRLCAYSRAVAnfptavkefkwrngwfyslsekasaegkpdpcplhtAWLKEIKVV
maanaltrqlsststlwpplkkptfskprfaKPTPVSAFAMASFTTTQVAPAAIVGGGRVGTALKEMGKGQDLLVKRGELVPLDFEGPIFVCTRNDDLEAVLEAAPRSRWNDLVFFQNGMIEPWLESKGLKDANQVLAYFAVsklgerpidgktdtnPEGLTAAYGKWASVVAERLSVGGLSCKVLDKEAFQKQMLEKLIWISAFMLVGARHTGATVGVVEKEYRSEVSALIAELALAAAAEKGITFDPAMEDRLCAYSRAVANFPTAVKEFKWRNGWFYSLSEkasaegkpdpcplhtawlkeikvv
MAANALTRQLSSTSTLWPPLKKPTFSKPRFAKPTPVSAFAMASFTTTQVAPAAIVGGGRVGTALKEMGKGQDLLVKRGELVPLDFEGPIFVCTRNDDLEAVLEAAPRSRWNDLVFFQNGMIEPWLESKGLKDANQVLAYFAVSKLGERPIDGKTDTNPEGLTAAYGKWASVVAERLSVGGLSCKVLDKEAFQKQMLEKLIWISAFMLVGARHTGATVGVVEKEYRSEVSaliaelalaaaaeKGITFDPAMEDRLCAYSRAVANFPTAVKEFKWRNGWFYSLSEKASAEGKPDPCPLHTAWLKEIKVV
***********************************VSAFAMASFTTTQVAPAAIVGGGRVGTALKEMGKGQDLLVKRGELVPLDFEGPIFVCTRNDDLEAVLEAAPRSRWNDLVFFQNGMIEPWLESKGLKDANQVLAYFAVSKLGERPID******PEGLTAAYGKWASVVAERLSVGGLSCKVLDKEAFQKQMLEKLIWISAFMLVGARHTGATVGVVEKEYRSEVSALIAELALAAAAEKGITFDPAMEDRLCAYSRAVANFPTAVKEFKWRNGWFYSLS*************LHTAWL******
************************************************VAPAAIVGGGRVGTALKEMGKGQDLLVKRGELVPLDFEGPIFVCTRNDDLEAVLEAAPRSRWNDLVFFQNGMIEPWLESKGLKDANQVLAYFAVSKLG**********NPEGLTAAYGKWASVVAERLSVGGLSCKVLDKEAFQKQMLEKLIWISAFMLVGARHTGATVGVVEKEYRSEVSALIAELALAAAAEKGITFDPAMEDRLCAYSRAVANFPTAVKEFKWRNGWFYSLSEKASAEGKPDPCPLHTAWLKEIKVV
************TSTLWPPLKKPTFSKPRFAKPTPVSAFAMASFTTTQVAPAAIVGGGRVGTALKEMGKGQDLLVKRGELVPLDFEGPIFVCTRNDDLEAVLEAAPRSRWNDLVFFQNGMIEPWLESKGLKDANQVLAYFAVSKLGERPIDGKTDTNPEGLTAAYGKWASVVAERLSVGGLSCKVLDKEAFQKQMLEKLIWISAFMLVGARHTGATVGVVEKEYRSEVSALIAELALAAAAEKGITFDPAMEDRLCAYSRAVANFPTAVKEFKWRNGWFYSLSE********DPCPLHTAWLKEIKVV
**********SSTSTLWPPLKK*TF****F****P***********TQVAPAAIVGGGRVGTALKEMGKGQDLLVKRGELVPLDFEGPIFVCTRNDDLEAVLEAAPRSRWNDLVFFQNGMIEPWLESKGLKDANQVLAYFAVSKLGERPIDGKTDTNPEGLTAAYGKWASVVAERLSVGGLSCKVLDKEAFQKQMLEKLIWISAFMLVGARHTGATVGVVEKEYRSEVSALIAELALAAAAEKGITFDPAMEDRLCAYSRAVANFPTAVKEFKWRNGWFYSLSEKASAEGKPDPCPLHTAWLKEIKVV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAANALTRQLSSTSTLWPPLKKPTFSKPRFAKPTPVSAFAMASFTTTQVAPAAIVGGGRVGTALKEMGKGQDLLVKRGELVPLDFEGPIFVCTRNDDLEAVLEAAPRSRWNDLVFFQNGMIEPWLESKGLKDANQVLAYFAVSKLGERPIDGKTDTNPEGLTAAYGKWASVVAERLSVGGLSCKVLDKEAFQKQMLEKLIWISAFMLVGARHTGATVGVVEKEYRSEVSALIAELALAAAAEKGITFDPAMEDRLCAYSRAVANFPTAVKEFKWRNGWFYSLSEKASAEGKPDPCPLHTAWLKEIKVV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query308
225443239301 PREDICTED: uncharacterized protein LOC10 0.902 0.923 0.799 1e-129
356526300294 PREDICTED: uncharacterized protein LOC10 0.918 0.962 0.751 1e-127
224115808269 predicted protein [Populus trichocarpa] 0.847 0.970 0.831 1e-126
118484329309 unknown [Populus trichocarpa] 1.0 0.996 0.750 1e-125
356523119298 PREDICTED: uncharacterized protein LOC10 0.853 0.882 0.799 1e-124
224108611269 predicted protein [Populus trichocarpa] 0.857 0.981 0.848 1e-124
224072767269 predicted protein [Populus trichocarpa] 0.857 0.981 0.840 1e-123
449436211300 PREDICTED: uncharacterized protein LOC10 0.925 0.95 0.774 1e-122
297844530313 hypothetical protein ARALYDRAFT_471810 [ 0.837 0.824 0.829 1e-122
18394322313 uncharacterized protein [Arabidopsis tha 0.925 0.910 0.777 1e-122
>gi|225443239|ref|XP_002271931.1| PREDICTED: uncharacterized protein LOC100263834 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  467 bits (1202), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 227/284 (79%), Positives = 245/284 (86%), Gaps = 6/284 (2%)

Query: 31  AKPTPVSAFAM------ASFTTTQVAPAAIVGGGRVGTALKEMGKGQDLLVKRGELVPLD 84
           +KPTP   F        +S   TQVAPA IVGGGRVG AL+ MG G DLLVKRG+ VPLD
Sbjct: 18  SKPTPPIKFRFRFRVRASSAMATQVAPAVIVGGGRVGRALQGMGSGDDLLVKRGDSVPLD 77

Query: 85  FEGPIFVCTRNDDLEAVLEAAPRSRWNDLVFFQNGMIEPWLESKGLKDANQVLAYFAVSK 144
           F GPI VCTRNDDL+AVLE+ P+SRW+DLVFFQNGM+EPWL+SKGL DA+QVLAYFAVSK
Sbjct: 78  FAGPILVCTRNDDLDAVLESTPKSRWSDLVFFQNGMLEPWLQSKGLSDADQVLAYFAVSK 137

Query: 145 LGERPIDGKTDTNPEGLTAAYGKWASVVAERLSVGGLSCKVLDKEAFQKQMLEKLIWISA 204
           LGE PIDGKTDTNPEGLTAAYGKWAS VA RL  GGLSCKVLDKEAFQKQMLEKLIWISA
Sbjct: 138 LGEPPIDGKTDTNPEGLTAAYGKWASAVAGRLHAGGLSCKVLDKEAFQKQMLEKLIWISA 197

Query: 205 FMLVGARHTGATVGVVEKEYRSEVSALIAELALAAAAEKGITFDPAMEDRLCAYSRAVAN 264
           FMLVGARH GATVGVVEKE+RSEVS+LI ELA AAA EKGI FD  MEDRLCAYSRAV++
Sbjct: 198 FMLVGARHPGATVGVVEKEFRSEVSSLIGELASAAAVEKGIVFDEGMEDRLCAYSRAVSH 257

Query: 265 FPTAVKEFKWRNGWFYSLSEKASAEGKPDPCPLHTAWLKEIKVV 308
           FPTA KEFKWRNGWFYSLS+KA AEGKPDPCPLHT WLKE+K+V
Sbjct: 258 FPTAAKEFKWRNGWFYSLSQKAIAEGKPDPCPLHTEWLKELKIV 301

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356526300|ref|XP_003531756.1| PREDICTED: uncharacterized protein LOC100810662 [Glycine max] Back     alignment and taxonomy information
>gi|224115808|ref|XP_002332062.1| predicted protein [Populus trichocarpa] gi|222831948|gb|EEE70425.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|118484329|gb|ABK94042.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356523119|ref|XP_003530189.1| PREDICTED: uncharacterized protein LOC100795565 [Glycine max] Back     alignment and taxonomy information
>gi|224108611|ref|XP_002333371.1| predicted protein [Populus trichocarpa] gi|222836353|gb|EEE74760.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224072767|ref|XP_002303871.1| predicted protein [Populus trichocarpa] gi|222841303|gb|EEE78850.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449436211|ref|XP_004135887.1| PREDICTED: uncharacterized protein LOC101216543 [Cucumis sativus] gi|449509154|ref|XP_004163511.1| PREDICTED: uncharacterized protein LOC101231909 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297844530|ref|XP_002890146.1| hypothetical protein ARALYDRAFT_471810 [Arabidopsis lyrata subsp. lyrata] gi|297335988|gb|EFH66405.1| hypothetical protein ARALYDRAFT_471810 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18394322|ref|NP_563991.1| uncharacterized protein [Arabidopsis thaliana] gi|6587814|gb|AAF18505.1|AC010924_18 ESTs gb|AI992412, gb|AI994629 come from this gene [Arabidopsis thaliana] gi|12083328|gb|AAG48823.1|AF332460_1 unknown protein [Arabidopsis thaliana] gi|18176355|gb|AAL60029.1| unknown protein [Arabidopsis thaliana] gi|332191287|gb|AEE29408.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query308
TAIR|locus:2200517313 AT1G16080 [Arabidopsis thalian 0.925 0.910 0.745 8.2e-115
TAIR|locus:2200517 AT1G16080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1132 (403.5 bits), Expect = 8.2e-115, P = 8.2e-115
 Identities = 214/287 (74%), Positives = 239/287 (83%)

Query:    22 KPTFSKPRFAKPTPVSAFAMASFTTTQVAPAAIVGGGRVGTALKEMGKGQDLLVKRGELV 81
             KP+ S+ RFA P  ++A + A  T  ++APA IVGGGRVG AL+EMG G+DLLVKRGE V
Sbjct:    29 KPSVSRARFAVPMAMAAASAA--TAKKLAPAVIVGGGRVGRALQEMGNGEDLLVKRGEAV 86

Query:    82 PLDFEGPIFVCTRNDDLEAVLEAAPRSRWNDLVFFQNGMIEPWLESKGLKDANQVLAYFA 141
             P+DFEGPI VCTRNDDL+AVLEA P+SRW DLVFFQNGM+EPW ESKGL D +QVLAYFA
Sbjct:    87 PVDFEGPILVCTRNDDLDAVLEATPQSRWKDLVFFQNGMMEPWFESKGLGDTDQVLAYFA 146

Query:   142 VSKLGERPIDGKTDTNPEGLTAAYGKWASVVAERLSVGGLSCKVLDKEAFQKQMLEKLIW 201
             VSKLGE P+DGKTDTNPEGLTAAYGKWAS +A RL  GGLSCKVLDKEAFQKQMLEKLIW
Sbjct:   147 VSKLGEPPVDGKTDTNPEGLTAAYGKWASEIAARLQSGGLSCKVLDKEAFQKQMLEKLIW 206

Query:   202 ISAFMLVGARHTGATVGVVEKEYRSEVSXXXXXXXXXXXXXKGITFDPAMEDRLCAYSRA 261
             I AFMLVGARH GA+VG VEKEYR EVS             KG+TF+  M +RLCAYSRA
Sbjct:   207 ICAFMLVGARHPGASVGTVEKEYRDEVSRLIQELAAAAAAEKGLTFEENMVERLCAYSRA 266

Query:   262 VANFPTAVKEFKWRNGWFYSLSEKASAEGKPDPCPLHTAWLKEIKVV 308
             V++FPTAVKEFKWRNGWFYSLSEKA AEG+PDPCPLHT WLKE+KV+
Sbjct:   267 VSHFPTAVKEFKWRNGWFYSLSEKAIAEGQPDPCPLHTEWLKELKVI 313


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.318   0.133   0.404    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      308       295   0.00092  115 3  11 22  0.40    34
                                                     33  0.44    37


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  621 (66 KB)
  Total size of DFA:  217 KB (2119 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  22.34u 0.09s 22.43t   Elapsed:  00:00:02
  Total cpu time:  22.34u 0.09s 22.43t   Elapsed:  00:00:02
  Start:  Fri May 10 10:01:54 2013   End:  Fri May 10 10:01:56 2013
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0048046 "apoplast" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0009965 "leaf morphogenesis" evidence=RCA
GO:0010027 "thylakoid membrane organization" evidence=RCA
GO:0016117 "carotenoid biosynthetic process" evidence=RCA
GO:0030154 "cell differentiation" evidence=RCA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 308
PRK05708305 2-dehydropantoate 2-reductase; Provisional 100.0
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 100.0
PRK06249313 2-dehydropantoate 2-reductase; Provisional 100.0
PRK12921305 2-dehydropantoate 2-reductase; Provisional 100.0
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 100.0
TIGR00745293 apbA_panE 2-dehydropantoate 2-reductase. This mode 100.0
PRK08229341 2-dehydropantoate 2-reductase; Provisional 99.95
PF08546125 ApbA_C: Ketopantoate reductase PanE/ApbA C termina 99.88
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.86
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.48
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 99.47
PRK02318381 mannitol-1-phosphate 5-dehydrogenase; Provisional 99.26
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 99.25
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.16
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 98.91
PTZ00431260 pyrroline carboxylate reductase; Provisional 98.05
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 97.56
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 97.54
PRK07680273 late competence protein ComER; Validated 97.25
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 97.08
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 96.93
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 96.93
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 96.82
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 96.78
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 96.75
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 96.7
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.45
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 96.44
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 96.38
PLN02688266 pyrroline-5-carboxylate reductase 96.3
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 96.22
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 96.17
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 96.03
PTZ00345365 glycerol-3-phosphate dehydrogenase; Provisional 96.02
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 96.01
PRK15059292 tartronate semialdehyde reductase; Provisional 95.99
PLN02256304 arogenate dehydrogenase 95.82
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 95.6
PLN02712667 arogenate dehydrogenase 95.48
COG2085211 Predicted dinucleotide-binding enzymes [General fu 95.44
PLN02712 667 arogenate dehydrogenase 95.4
PRK07417279 arogenate dehydrogenase; Reviewed 95.21
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 95.13
PRK06444197 prephenate dehydrogenase; Provisional 95.09
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 94.78
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 94.51
PRK08507275 prephenate dehydrogenase; Validated 94.45
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.39
PRK05479330 ketol-acid reductoisomerase; Provisional 94.2
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 94.19
PRK08655 437 prephenate dehydrogenase; Provisional 93.61
COG0569225 TrkA K+ transport systems, NAD-binding component [ 92.83
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 92.56
PRK07502307 cyclohexadienyl dehydrogenase; Validated 92.3
PRK06545359 prephenate dehydrogenase; Validated 92.23
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 92.17
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 91.96
PRK08818370 prephenate dehydrogenase; Provisional 90.93
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 90.89
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 90.78
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 89.77
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 88.97
PF10100429 DUF2338: Uncharacterized protein conserved in bact 87.69
KOG2380 480 consensus Prephenate dehydrogenase (NADP+) [Amino 87.22
TIGR00112245 proC pyrroline-5-carboxylate reductase. This enzym 84.71
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 84.51
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 83.62
PRK06753 373 hypothetical protein; Provisional 83.44
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 83.24
PRK00711 416 D-amino acid dehydrogenase small subunit; Validate 82.78
COG0654 387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 82.23
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 82.13
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 81.89
PLN00093 450 geranylgeranyl diphosphate reductase; Provisional 81.61
COG2910211 Putative NADH-flavin reductase [General function p 81.21
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 80.8
PRK12409 410 D-amino acid dehydrogenase small subunit; Provisio 80.57
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 80.15
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.7e-39  Score=306.69  Aligned_cols=243  Identities=19%  Similarity=0.196  Sum_probs=183.6

Q ss_pred             ccEEEEccChhHHHHHHhc--CCCcE-EecCCC-CCC-----------------------CC-----CCCcEEEEecCcc
Q 021746           50 APAAIVGGGRVGTALKEMG--KGQDL-LVKRGE-LVP-----------------------LD-----FEGPIFVCTRNDD   97 (308)
Q Consensus        50 m~i~IiG~G~vG~~~a~~~--~g~~v-~v~Rg~-~~~-----------------------~~-----~~~~IlvatK~~d   97 (308)
                      |||+|+|+|+||++||+++  +|++| +|.|+. ++.                       .+     +.+.||||||+|+
T Consensus         3 m~I~IiGaGaiG~~~a~~L~~~G~~V~lv~r~~~~~~~i~~~~Gl~i~~~g~~~~~~~~~~~~~~~~~~D~viv~vK~~~   82 (305)
T PRK05708          3 MTWHILGAGSLGSLWACRLARAGLPVRLILRDRQRLAAYQQAGGLTLVEQGQASLYAIPAETADAAEPIHRLLLACKAYD   82 (305)
T ss_pred             ceEEEECCCHHHHHHHHHHHhCCCCeEEEEechHHHHHHhhcCCeEEeeCCcceeeccCCCCcccccccCEEEEECCHHh
Confidence            8999999999999999764  58887 999963 320                       00     1156899999999


Q ss_pred             HHHHHHhCCCC--CCCeEEEEecCCC-hhHHhhcCCCCCceeEEEEEeeccCCCC-CCCceecCCCCCccccc----ccH
Q 021746           98 LEAVLEAAPRS--RWNDLVFFQNGMI-EPWLESKGLKDANQVLAYFAVSKLGERP-IDGKTDTNPEGLTAAYG----KWA  169 (308)
Q Consensus        98 l~~~l~~l~~~--~~t~IV~LQNGl~-~~~l~~~~~~~~~~v~~~~~~~~~G~~~-~dg~i~~~g~g~~~~~G----~~a  169 (308)
                      ++++++++.+.  .++.||++|||++ ++.+..+ ++.. .  ++.++...|... .+|++.+++.+... +|    +..
T Consensus        83 ~~~al~~l~~~l~~~t~vv~lQNGv~~~e~l~~~-~~~~-~--v~~g~~~~ga~~~~pg~v~~~~~g~~~-~G~~~~~~~  157 (305)
T PRK05708         83 AEPAVASLAHRLAPGAELLLLQNGLGSQDAVAAR-VPHA-R--CIFASSTEGAFRDGDWRVVFAGHGFTW-LGDPRNPTA  157 (305)
T ss_pred             HHHHHHHHHhhCCCCCEEEEEeCCCCCHHHHHHh-CCCC-c--EEEEEeeeceecCCCCEEEEeceEEEE-EcCCCCcch
Confidence            99999999884  5689999999999 4555433 2221 1  233333444432 23677776655432 33    446


Q ss_pred             HHHHHHHHcCCCceeecChhhHHHHHHHHHHHHHhhhhhhHhhcCccccccccchHHHHHHHHHHHHHHHHHhcCCCCCh
Q 021746          170 SVVAERLSVGGLSCKVLDKEAFQKQMLEKLIWISAFMLVGARHTGATVGVVEKEYRSEVSALIAELALAAAAEKGITFDP  249 (308)
Q Consensus       170 ~~l~~~L~~aGI~~~v~~~~dI~~~~WeKlv~N~a~N~ltAl~~~~tvG~L~~~~~~~~~~lm~Ev~avA~a~~Gv~l~~  249 (308)
                      +++.+.|+++|+++.+  ++||+.++|+||+|||++|++||++ ++++|++... .++++.+|+|+.+++++ .|+.+++
T Consensus       158 ~~l~~~l~~ag~~~~~--~~di~~~~W~Kl~~N~~~N~ltal~-~~~~g~l~~~-~~~~~~l~~E~~~va~a-~G~~~~~  232 (305)
T PRK05708        158 PAWLDDLREAGIPHEW--TVDILTRLWRKLALNCAINPLTVLH-DCRNGGLLEH-AQEVAALCAELSELLRR-CGQPAAA  232 (305)
T ss_pred             HHHHHHHHhcCCCCcc--CHHHHHHHHHHHHHHccccHhHHhh-CCCCcchhcC-HHHHHHHHHHHHHHHHH-cCCCccH
Confidence            8899999999999985  4699999999999999999999999 8999999543 26789999999999997 7999885


Q ss_pred             H-HHHHHHHHhhhcCCCCc---------chhhhhhhhhHHhhcchHHHhCCCCCCCcchHHHHHHhcc
Q 021746          250 A-MEDRLCAYSRAVANFPT---------AVKEFKWRNGWFYSLSEKASAEGKPDPCPLHTAWLKEIKV  307 (308)
Q Consensus       250 ~-~~e~~~~~~~~~~~~~t---------~~~Ei~~~nG~vv~~~~~~~~~Gv~~p~P~~~~l~~~~~~  307 (308)
                      + ..+.+.+..+..+...+         +++|+|+||||++++   |+++|+  |+|+|+.+|+.++.
T Consensus       233 ~~~~~~~~~~~~~~~~~~sSM~qD~~~gR~tEid~i~G~vvr~---a~~~Gv--~~P~~~~l~~~v~~  295 (305)
T PRK05708        233 ANLHEEVQRVIQATAANYSSMYQDVRAGRRTEISYLLGYACRA---ADRHGL--PLPRLQHLQQRLVA  295 (305)
T ss_pred             HHHHHHHHHHHHhccCCCcHHHHHHHcCCceeehhhhhHHHHH---HHHcCC--CCchHHHHHHHHHH
Confidence            4 44555544444433222         156999999999988   568899  99999999988763

>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>TIGR00745 apbA_panE 2-dehydropantoate 2-reductase Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PF08546 ApbA_C: Ketopantoate reductase PanE/ApbA C terminal; InterPro: IPR013752 This is the C-terminal domain of 2-dehydropantoate 2-reductases also known as ketopantoate reductases, 1 Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK02318 mannitol-1-phosphate 5-dehydrogenase; Provisional Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PF10100 DUF2338: Uncharacterized protein conserved in bacteria (DUF2338); InterPro: IPR016935 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG2380 consensus Prephenate dehydrogenase (NADP+) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00112 proC pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query308
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 8e-08
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 7e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-07
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 2e-06
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 1e-05
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 2e-05
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 3e-05
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Length = 317 Back     alignment and structure
 Score = 51.9 bits (125), Expect = 8e-08
 Identities = 30/188 (15%), Positives = 59/188 (31%), Gaps = 23/188 (12%)

Query: 89  IFVCTRNDDLEAVLEAAPRSRWND--LVFFQNGMIEPWLES-KGLKDANQVL---AYFAV 142
           I  CT++ D+E  +         +  ++   NG      E  +       V     Y + 
Sbjct: 87  ILFCTKDYDMERGVAEIRPMIGQNTKILPLLNGA--DIAERMRTYLPDTVVWKGCVYISA 144

Query: 143 SKLGERPIDGKTDTNPEGLTAAYGKW-------ASVVAERLSVGGLSCKVLDKEAFQKQM 195
            K       G      +     +G            +AE L+  G+             +
Sbjct: 145 RKSA----PGLITLEADRELFYFGSGLPEQTDDEVRLAELLTAAGIRAYNPT--DIDWYI 198

Query: 196 LEKLIWISAFMLVGARHTGATVGVVEKEYRSEVSALIAELALAAAAEKGITFDPAMEDRL 255
           ++K + IS      A      +G +  E+  E+ +L+ E+A    A+        +  +L
Sbjct: 199 MKKFMMISVTATATAY-FDKPIGSILTEHEPELLSLLEEVAELFRAK-YGQVPDDVVQQL 256

Query: 256 CAYSRAVA 263
               R + 
Sbjct: 257 LDKQRKMP 264
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Length = 320 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Length = 335 Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Length = 307 Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Length = 291 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query308
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 100.0
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 100.0
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 100.0
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 100.0
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 100.0
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 100.0
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 99.94
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 99.93
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 99.9
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 99.8
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 99.75
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 99.72
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 99.72
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 99.67
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 99.64
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 99.61
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 99.38
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 99.16
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 99.0
1vpd_A299 Tartronate semialdehyde reductase; structural geno 98.84
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 98.73
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 98.7
1yb4_A295 Tartronic semialdehyde reductase; structural genom 98.64
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 98.54
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 98.54
1dlj_A 402 UDP-glucose dehydrogenase; rossmann fold, ternary 98.52
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 98.49
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 98.46
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 98.45
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 98.42
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 98.4
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 98.4
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 98.35
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 98.28
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 98.27
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 98.17
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 98.02
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 97.99
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 97.99
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 97.97
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 97.95
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 97.94
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 97.94
4ezb_A317 Uncharacterized conserved protein; structural geno 97.88
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 97.02
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 97.68
3qha_A296 Putative oxidoreductase; seattle structural genomi 97.68
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 97.63
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 97.62
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 97.42
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 97.37
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 97.33
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 97.25
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 97.11
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 96.95
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 96.92
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 96.9
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 96.85
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 96.35
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 96.31
1lss_A140 TRK system potassium uptake protein TRKA homolog; 96.25
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 96.19
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 96.18
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 96.15
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 95.97
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 95.93
3l6d_A306 Putative oxidoreductase; structural genomics, prot 95.88
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 95.76
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 95.7
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 94.94
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 94.94
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 94.32
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 94.17
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 93.83
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 92.52
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 92.24
4fgw_A391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 91.67
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 91.6
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 91.46
4g65_A 461 TRK system potassium uptake protein TRKA; structur 91.31
4hb9_A 412 Similarities with probable monooxygenase; flavin, 90.69
1id1_A153 Putative potassium channel protein; RCK domain, E. 89.97
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 89.94
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 89.83
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 89.55
3c85_A183 Putative glutathione-regulated potassium-efflux S 88.77
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 87.38
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 87.38
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 87.36
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 86.78
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 86.49
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 86.29
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 86.29
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 85.86
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 85.46
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 85.44
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 85.05
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 84.75
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 84.55
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 84.12
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 83.74
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 83.31
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 83.14
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 83.07
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 82.57
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 82.56
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 81.89
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 81.85
3rp8_A 407 Flavoprotein monooxygenase; FAD-binding protein, o 81.32
3ius_A286 Uncharacterized conserved protein; APC63810, silic 81.29
4g6h_A 502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 81.19
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 80.79
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 80.56
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
Probab=100.00  E-value=8.7e-37  Score=286.27  Aligned_cols=240  Identities=16%  Similarity=0.096  Sum_probs=182.7

Q ss_pred             ccEEEEccChhHHHHHHhc-CCCcE-EecCCCC-C------------C-----------CC---CCCcEEEEecCccHHH
Q 021746           50 APAAIVGGGRVGTALKEMG-KGQDL-LVKRGEL-V------------P-----------LD---FEGPIFVCTRNDDLEA  100 (308)
Q Consensus        50 m~i~IiG~G~vG~~~a~~~-~g~~v-~v~Rg~~-~------------~-----------~~---~~~~IlvatK~~dl~~  100 (308)
                      |||+|||+|++|++||..+ .|++| ++.|++. .            +           .+   ..+.||||||++++++
T Consensus         3 mkI~IiGaGa~G~~~a~~L~~g~~V~~~~r~~~~~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~~D~vilavK~~~~~~   82 (307)
T 3ego_A            3 LKIGIIGGGSVGLLCAYYLSLYHDVTVVTRRQEQAAAIQSEGIRLYKGGEEFRADCSADTSINSDFDLLVVTVKQHQLQS   82 (307)
T ss_dssp             CEEEEECCSHHHHHHHHHHHTTSEEEEECSCHHHHHHHHHHCEEEEETTEEEEECCEEESSCCSCCSEEEECCCGGGHHH
T ss_pred             CEEEEECCCHHHHHHHHHHhcCCceEEEECCHHHHHHHHhCCceEecCCCeecccccccccccCCCCEEEEEeCHHHHHH
Confidence            8999999999999999653 67887 9999751 1            0           01   1257999999999999


Q ss_pred             HHHhCCCCCCCeEEEEecCCC-hhHHhhcCCCCC--ceeEEEEEeeccCCCCCCCceecCCCCCccccc------ccHHH
Q 021746          101 VLEAAPRSRWNDLVFFQNGMI-EPWLESKGLKDA--NQVLAYFAVSKLGERPIDGKTDTNPEGLTAAYG------KWASV  171 (308)
Q Consensus       101 ~l~~l~~~~~t~IV~LQNGl~-~~~l~~~~~~~~--~~v~~~~~~~~~G~~~~dg~i~~~g~g~~~~~G------~~a~~  171 (308)
                      +++.+.+...+.||++|||+. ++.+.+. ++..  ....++++....|    +|++.+.+.|.. .+|      +..++
T Consensus        83 ~l~~l~~~~~~~ivs~~nGi~~~e~l~~~-~~~~~vl~g~~~~~a~~~~----pg~v~~~~~g~~-~iG~~~~~~~~~~~  156 (307)
T 3ego_A           83 VFSSLERIGKTNILFLQNGMGHIHDLKDW-HVGHSIYVGIVEHGAVRKS----DTAVDHTGLGAI-KWSAFDDAEPDRLN  156 (307)
T ss_dssp             HHHHTTSSCCCEEEECCSSSHHHHHHHTC-CCSCEEEEEEECCEEEECS----SSEEEEEECCCE-EEEECTTCCGGGGT
T ss_pred             HHHHhhcCCCCeEEEecCCccHHHHHHHh-CCCCcEEEEEEeeceEECC----CCEEEEeeeeeE-EEEeCCCCcHHHHH
Confidence            999998753333999999999 4566543 2221  1123333333333    366666554432 222      34466


Q ss_pred             HHHHHHcCCCceeecChhhHHHHHHHHHHHHHhhhhhhHhhcCcccccc--ccchHHHHHHHHHHHHHHHHHhcCCCCCh
Q 021746          172 VAERLSVGGLSCKVLDKEAFQKQMLEKLIWISAFMLVGARHTGATVGVV--EKEYRSEVSALIAELALAAAAEKGITFDP  249 (308)
Q Consensus       172 l~~~L~~aGI~~~v~~~~dI~~~~WeKlv~N~a~N~ltAl~~~~tvG~L--~~~~~~~~~~lm~Ev~avA~a~~Gv~l~~  249 (308)
                      +.+.|+++|+++.+.  +||+..+|+||+|||++|++||++ ++++|++  .+..+++++.+|+|+.+++++    ..++
T Consensus       157 l~~~l~~ag~~~~~~--~di~~~~W~Kl~~N~~~N~ltal~-~~~~g~l~~~~~~~~l~~~l~~E~~~va~~----~~~~  229 (307)
T 3ego_A          157 ILFQHNHSDFPIYYE--TDWYRLLTGKLIVNACINPLTALL-QVKNGELLTTPAYLAFMKLVFQEACRILKL----ENEE  229 (307)
T ss_dssp             TTTSSCCTTSCEEEC--SCHHHHHHHHHHHHHHHHHHHHHH-TCCTTHHHHSHHHHHHHHHHHHHHHHHHTC----SCHH
T ss_pred             HHHHhhhCCCCcEec--hhHHHHHHHHHHHhhhhhHHHHHh-cCCcchhhcChhHHHHHHHHHHHHHHHHhc----cChH
Confidence            888899999999875  599999999999999999999999 8999999  344789999999999999764    2467


Q ss_pred             HHHHHHHHHhhhcCCCCcc---------hhhhhhhhhHHhhcchHHHhCCCCCCCcchHHHHHHhcc
Q 021746          250 AMEDRLCAYSRAVANFPTA---------VKEFKWRNGWFYSLSEKASAEGKPDPCPLHTAWLKEIKV  307 (308)
Q Consensus       250 ~~~e~~~~~~~~~~~~~t~---------~~Ei~~~nG~vv~~~~~~~~~Gv~~p~P~~~~l~~~~~~  307 (308)
                      +..+++++.++..+...++         ++|+|+||||++++   |+++|+  |||+|+.+|..++.
T Consensus       230 ~~~~~~~~~~~~~~~~~sSM~qD~~~gr~tEid~i~G~vv~~---a~~~gv--~tP~~~~l~~li~~  291 (307)
T 3ego_A          230 KAWERVQAVCGQTKENRSSMLVDVIGGRQTEADAIIGYLLKE---ASLQGL--DAVHLEFLYGSIKA  291 (307)
T ss_dssp             HHHHHHHHHHHHTTTCCCHHHHHHHHTCCCSHHHHHHHHHHH---HHHTTC--CCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHhcCCCCchHHHHHHcCCcccHHHhhhHHHHH---HHHcCC--CCcHHHHHHHHHHH
Confidence            8888888877666543331         67999999999987   668899  99999999998875
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query308
d1ks9a1124 Ketopantoate reductase PanE {Escherichia coli [Tax 99.87
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 99.45
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 98.0
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 97.52
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 97.49
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 97.39
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 97.13
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 96.62
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 96.51
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 95.52
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 95.3
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 94.56
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 94.5
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 94.39
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 92.75
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 92.15
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 92.01
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 90.88
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 90.55
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 89.75
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 89.74
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 89.7
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 89.6
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 89.12
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 89.07
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 88.71
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 88.57
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 88.56
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 88.34
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 88.19
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 88.08
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 87.66
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 87.54
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 87.51
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 87.5
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 87.36
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 87.34
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 86.89
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 86.0
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 85.84
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 85.83
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 85.53
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 85.44
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 84.67
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 84.25
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 84.23
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 84.12
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 83.54
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 83.25
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 83.23
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 82.99
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 82.92
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 82.9
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 82.2
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 81.91
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 81.86
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 80.77
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 80.62
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 80.51
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 80.35
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 80.22
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 80.02
>d1ks9a1 a.100.1.7 (A:168-291) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: 6-phosphogluconate dehydrogenase C-terminal domain-like
superfamily: 6-phosphogluconate dehydrogenase C-terminal domain-like
family: Ketopantoate reductase PanE
domain: Ketopantoate reductase PanE
species: Escherichia coli [TaxId: 562]

Probab=99.87  E-value=1.6e-22  Score=163.78  Aligned_cols=110  Identities=17%  Similarity=0.180  Sum_probs=91.7

Q ss_pred             hHHHHHHHHHHHHHhhhhhhHhhcCccccccccchHHHHHHHHHHHHHHHHHhcCCCCChHHHH-HHHHHhhhcCCCCcc
Q 021746          190 AFQKQMLEKLIWISAFMLVGARHTGATVGVVEKEYRSEVSALIAELALAAAAEKGITFDPAMED-RLCAYSRAVANFPTA  268 (308)
Q Consensus       190 dI~~~~WeKlv~N~a~N~ltAl~~~~tvG~L~~~~~~~~~~lm~Ev~avA~a~~Gv~l~~~~~e-~~~~~~~~~~~~~t~  268 (308)
                      ||+.++|+||+|||++|++|+++ ++++|++... +++++.+|.|+.+++++ .|+.++++..+ .+...++.++...++
T Consensus         1 dI~~~~W~Kl~~N~~~n~l~al~-~~~~g~l~~~-~~~~~~l~~E~~~va~a-~g~~~~~~~~~~~~~~~~~~~~~~~sS   77 (124)
T d1ks9a1           1 NIRAELWRKLAVNCVINPLTAIW-NCPNGELRHH-PQEIMQICEEVAAVIER-EGHHTSAEDLRDYVMQVIDATAENISS   77 (124)
T ss_dssp             THHHHHHHHHHHHHHHHHHHHHT-TCCGGGGGGC-HHHHHHHHHHHHHHHHH-HTCCCCHHHHHHHHHHHHHHTTTCCCH
T ss_pred             CHHHHHHHHHHHHHhHhHHHHHh-CCCchHHHhC-HHHHHHHHHHHHHHHHH-cCCCCcHHHHHHHHHHHHhccCCCCCh
Confidence            79999999999999999999999 8999999543 57899999999999997 79999865554 444455555543331


Q ss_pred             ---------hhhhhhhhhHHhhcchHHHhCCCCCCCcchHHHHHHhcc
Q 021746          269 ---------VKEFKWRNGWFYSLSEKASAEGKPDPCPLHTAWLKEIKV  307 (308)
Q Consensus       269 ---------~~Ei~~~nG~vv~~~~~~~~~Gv~~p~P~~~~l~~~~~~  307 (308)
                               ++|+|++||+++++   |+++|+  +||+|+.+|..|+.
T Consensus        78 M~qD~~~gr~tEid~i~G~vv~~---a~~~gi--~tP~~~~l~~lik~  120 (124)
T d1ks9a1          78 MLQDIRALRHTEIDYINGFLLRR---ARAHGI--AVPENTRLFEMVKR  120 (124)
T ss_dssp             HHHHHHTTCCCSGGGTHHHHHHH---HHHHTC--CCHHHHHHHHHHHH
T ss_pred             HHHHHHcCCcchHHHHHHHHHHH---HHHhCC--CCcHHHHHHHHHHH
Confidence                     67999999999988   668899  99999999998864
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure