Citrus Sinensis ID: 021757

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
MNSVFSADDFSDSFLSSPSPPPASFHALPMNRSQSEWELEKFLQEVTVSPRAISSSSASDNSVPAVIGPSVMSKSRAYEIGDDDVVEIKKSHRDQSLDPPVIPSSTAPVDSDEYRAYLKTKLDLACAAVALRTAPVKPEDKSSLIENQTQAAKPSELGSQAMATVNVSTAHDALGTHPKADFRPLGSADLPAVQARPAAQVRQSTSGSSREDSDDDELEGDTETIEGLDSVDDKRARRMLSNRESARRSRRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYDESAVNNRILKADIETLRAKKFF
cccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
cccEEEHHccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
mnsvfsaddfsdsflsspspppasfhalpmnrsqSEWELEKFLQEvtvspraissssasdnsvpavigpsvmsksrayeigddDVVEIKkshrdqsldppvipsstapvdsdEYRAYLKTKLDLACAAVAlrtapvkpedksslienqtqaakpselgsqAMATVNVSTahdalgthpkadfrplgsadlpavqarpaaqvrqstsgssredsdddelegdtetiegldsVDDKRARRMLSNRESARRSRRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYDESAVNNRILKADIETLRAKKFF
mnsvfsaddfsdsflsSPSPPPASFHALPMNRSQSEWELEKFLQEVTVSPraissssasdnsvpavigpsvmsksrAYEIGDDDVVEIKKshrdqsldppvipsstapvdsDEYRAYLKTKLDLACAAVALRtapvkpedksslIENQTQAAKPSELGSQAMATVNVSTAHDALGTHPKADFRPLGSADLPAVqarpaaqvrqstsgssredsdddelegdtetiegldsvddkrarrmlsnresarrsrrrkqAHLNEletqagqlraEHSSLLKGLTDvnqkydesavnnrilkadietlrakkff
MNSVfsaddfsdsflsspspppasfhalpMNRSQSEWELEKFLQEVTvspraissssasdnsvpavIGPSVMSKSRAYEIGDDDVVEIKKSHRDQSLDPPVIPSSTAPVDSDEYRAYLKTKLDLACAAVALRTAPVKPEDKSSLIENQTQAAKPSELGSQAMATVNVSTAHDALGTHPKADFRPLGSADLpavqarpaaqvrqstsgssredsdddelegdtetiegLDSVDDKRARRMLsnresarrsrrrKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYDESAVNNRILKADIETLRAKKFF
*****************************************************************************************************************YRAYLKTKLDLACAAVALRT****************************************************************************************************************************************************************I**************
*NSVFSADDFSDSF********************************************************************************************************************************************************************************************************************************************RRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYDESAVNNRILKADIETLRA*K**
*******************PPPASFHALPMNRSQSEWELEKFLQEVTV***************PAVIGPSVMSKSRAYEIGDDDVVEIKKSHRDQSLDPPVIPSSTAPVDSDEYRAYLKTKLDLACAAVALRTAPVKPEDKSSLIENQTQAAKPSELGSQAMATVNVSTAHDALGTHPKADFRPLGSADLPA******************************ETIEGLDSVDDKRARRM***************AHLNELETQAGQLRAEHSSLLKGLTDVNQKYDESAVNNRILKADIETLRAKKFF
****FSADDFSDSFLS********************WELEKFLQEVTV*********************************************************TAPVDSDEYRAYLKTKLDLACAAVALRTAP********************************************************************************************************************RKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYDESAVNNRILKADIETLRA*K**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSVFSADDFSDSFLSSPSPPPASFHALPMNRSQSEWELEKFLQEVTVSPRAISSSSASDNSVPAVIGPSVMSKSRAYEIGDDDVVEIKKSHRDQSLDPPVIPSSTAPVDSDEYRAYLKTKLDLACAAVALRTAPVKPEDKSSLIENQTQAAKPSELGSQAMATVNVSTAHDALGTHPKADFRPLGSADLPAVQARPAAQVRQSTSGSSREDSDDDELEGDTETIEGLDSVDDKRARRMLSNxxxxxxxxxxxxxxxxxxxxxxxxxxxxHSSLLKGLTDVNQKYDESAVNNRILKADIETLRAKKFF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query308 2.2.26 [Sep-21-2011]
Q99090 401 Light-inducible protein C N/A no 0.873 0.670 0.482 5e-47
O22763 411 Basic leucine zipper 10 O yes no 0.902 0.676 0.434 3e-39
Q9M1G6403 Basic leucine zipper 25 O no no 0.896 0.684 0.450 3e-34
B9DGI8314 Basic leucine zipper 63 O no no 0.649 0.636 0.418 3e-31
Q9FUD3277 Basic leucine zipper 9 OS no no 0.379 0.422 0.491 2e-21
P12959 453 Regulatory protein opaque N/A no 0.288 0.196 0.533 3e-19
P23922349 Transcription factor HBP- N/A no 0.298 0.263 0.382 1e-07
Q9SJN0442 Protein ABSCISIC ACID-INS no no 0.243 0.169 0.412 1e-06
P42777270 G-box-binding factor 4 OS no no 0.181 0.207 0.482 5e-06
P24068151 Ocs element-binding facto N/A no 0.253 0.516 0.392 1e-05
>sp|Q99090|CPRF2_PETCR Light-inducible protein CPRF2 OS=Petroselinum crispum GN=CPRF2 PE=2 SV=2 Back     alignment and function desciption
 Score =  188 bits (477), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 148/307 (48%), Positives = 197/307 (64%), Gaps = 38/307 (12%)

Query: 1   MNSVFSADDFSDSFLSSPSPPPASFHALPMNRSQSEWELEKFLQEVTVSPRAISSSSASD 60
           M+ VFS +D SD F S P+   +S   L MNRS SEW  + FLQ+          +SA +
Sbjct: 1   MDRVFSVEDISDQFWSPPAREDSS--KLVMNRSDSEWAFQSFLQQ----------ASALE 48

Query: 61  NSVPAVIGPSVMSKSRAYEIGDDDVVEIKKSHRDQSLDPPVIPSSTAPVDSDEYRAYLKT 120
           +S P    P  ++       GD     +K        +P  IP++  PVDS++Y+AYLK+
Sbjct: 49  SSQPLPSDPVPVA-------GD-----VK--------NPVEIPANV-PVDSEDYQAYLKS 87

Query: 121 KLDLACAAVAL-RTAPVKPEDKSSLIENQTQAAKPSELGSQAMATVNVSTAHDALGTHPK 179
           +LDLACAAVAL R + +KP+D ++L++N +QA+  S+L SQ        + HD      K
Sbjct: 88  RLDLACAAVALTRASSLKPQDSAALLDNGSQASNTSQLVSQVPPK---GSGHDLSKEEDK 144

Query: 180 ADFRPLGSADLPAVQARPAAQVRQSTSGSSREDSDDD-ELEGDTETIEGLDSVDDKRARR 238
                  +  LPA+Q + A QV+ +TSGSSR+ SDDD ELEG+TET    D  D KR RR
Sbjct: 145 EALAATATPLLPALQKKSAIQVKSTTSGSSRDHSDDDDELEGETETTRNGDPSDAKRVRR 204

Query: 239 MLSNRESARRSRRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYDESAVNNRILKAD 298
           MLSNRESARRSRRRKQAH+ ELETQ  QLR E+SSLLK LTD++Q+Y+++AV+NR+LKAD
Sbjct: 205 MLSNRESARRSRRRKQAHMTELETQVSQLRVENSSLLKRLTDISQRYNDAAVDNRVLKAD 264

Query: 299 IETLRAK 305
           IET+RAK
Sbjct: 265 IETMRAK 271
Binds to the G-box-like motif (5'-ACGTGGC-3') of the chalcone synthase (CHS) gene promoter. G-box and G-box-like motifs are defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control.
Petroselinum crispum (taxid: 4043)
>sp|O22763|BZP10_ARATH Basic leucine zipper 10 OS=Arabidopsis thaliana GN=BZIP10 PE=1 SV=2 Back     alignment and function description
>sp|Q9M1G6|BZP25_ARATH Basic leucine zipper 25 OS=Arabidopsis thaliana GN=BZIP25 PE=1 SV=1 Back     alignment and function description
>sp|B9DGI8|BZP63_ARATH Basic leucine zipper 63 OS=Arabidopsis thaliana GN=BZIP63 PE=1 SV=1 Back     alignment and function description
>sp|Q9FUD3|BZIP9_ARATH Basic leucine zipper 9 OS=Arabidopsis thaliana GN=BZIP9 PE=1 SV=1 Back     alignment and function description
>sp|P12959|OP2_MAIZE Regulatory protein opaque-2 OS=Zea mays GN=O2 PE=1 SV=1 Back     alignment and function description
>sp|P23922|HBP1A_WHEAT Transcription factor HBP-1a OS=Triticum aestivum PE=2 SV=1 Back     alignment and function description
>sp|Q9SJN0|ABI5_ARATH Protein ABSCISIC ACID-INSENSITIVE 5 OS=Arabidopsis thaliana GN=ABI5 PE=1 SV=1 Back     alignment and function description
>sp|P42777|GBF4_ARATH G-box-binding factor 4 OS=Arabidopsis thaliana GN=GBF4 PE=1 SV=1 Back     alignment and function description
>sp|P24068|OCS1_MAIZE Ocs element-binding factor 1 OS=Zea mays GN=OBF1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query308
298204854383 unnamed protein product [Vitis vinifera] 0.899 0.723 0.487 5e-55
225451342 423 PREDICTED: light-inducible protein CPRF2 0.899 0.654 0.487 6e-55
16797791 450 bZIP transcription factor [Nicotiana tab 0.928 0.635 0.468 4e-53
147796457 446 hypothetical protein VITISV_022136 [Viti 0.902 0.623 0.461 1e-52
255559911 441 DNA binding protein, putative [Ricinus c 0.912 0.637 0.511 3e-52
444300790 444 bZIP transcription factor family protein 0.918 0.637 0.447 3e-51
351720703 417 bZIP protein [Glycine max] gi|183014149| 0.928 0.685 0.464 1e-49
351725229404 bZIP transcription factor bZIP89 [Glycin 0.928 0.707 0.461 6e-48
224123412371 predicted protein [Populus trichocarpa] 0.756 0.628 0.469 2e-47
118486477 445 unknown [Populus trichocarpa] 0.935 0.647 0.543 1e-46
>gi|298204854|emb|CBI34161.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  221 bits (562), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 156/320 (48%), Positives = 204/320 (63%), Gaps = 43/320 (13%)

Query: 1   MNSVFSADDFSDSFLSSPSPPPASFHALPMNRSQSEWELEKFLQEVTVSPRAISSSSASD 60
           M+ VFS D+  + F +SP    +S     MNRS SEW  ++FLQE +  P + S S++  
Sbjct: 1   MDRVFSVDEIPEQFWASPPS--SSKEPSQMNRSASEWAFQRFLQESSSPPSSSSVSASGP 58

Query: 61  NSVPAVIGPSVMSKSRAYEIGDDDVVEIKKSHRD--------------QSLDPPVIPSST 106
           ++                   ++DVVE+K    D               SLDPP      
Sbjct: 59  SA-------------------ENDVVELKVPIDDPKPTPAPPAPPAPATSLDPP----PN 95

Query: 107 APVDSDEYRAYLKTKLDLACAAVAL-RTAPVKPEDKSSLIENQTQAAKPSELGSQAMATV 165
            P+DS+EY+A+LK++L+LACAAVAL R + VKP+D ++L +  +QA+K S+L SQA    
Sbjct: 96  VPIDSEEYQAFLKSRLNLACAAVALSRASFVKPQDSAALADTGSQASKTSQLRSQAPCK- 154

Query: 166 NVSTAHDALGTHPKADFRPLGSADLPAVQARPAAQVRQSTSGSSREDSDDDELEGDTETI 225
              + +D  G   K    PLG   LPA+Q +  AQ+R +TS SSRE SDDDE+EG+TETI
Sbjct: 155 --GSGYDLSGAPDKEAGGPLGIPSLPAMQKKAGAQLRPTTSESSREHSDDDEVEGETETI 212

Query: 226 EGLDSVDDKRARRMLSNRESARRSRRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKY 285
           E +D  D KR RRMLSNRESARRSRRRKQAHL ELETQ  QLR E+SSLLK LTD++QKY
Sbjct: 213 ENMDPADAKRVRRMLSNRESARRSRRRKQAHLTELETQVAQLRLENSSLLKRLTDISQKY 272

Query: 286 DESAVNNRILKADIETLRAK 305
           +E+AV+NR+LKAD+ETLRAK
Sbjct: 273 NEAAVDNRVLKADVETLRAK 292

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225451342|ref|XP_002279520.1| PREDICTED: light-inducible protein CPRF2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|16797791|gb|AAL27150.1| bZIP transcription factor [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|147796457|emb|CAN74806.1| hypothetical protein VITISV_022136 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255559911|ref|XP_002520974.1| DNA binding protein, putative [Ricinus communis] gi|223539811|gb|EEF41391.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|444300790|gb|AGD98704.1| bZIP transcription factor family protein 6 [Camellia sinensis] Back     alignment and taxonomy information
>gi|351720703|ref|NP_001237953.1| bZIP protein [Glycine max] gi|183014149|dbj|BAG24402.1| bZIP protein [Glycine max] Back     alignment and taxonomy information
>gi|351725229|ref|NP_001237085.1| bZIP transcription factor bZIP89 [Glycine max] gi|113367196|gb|ABI34655.1| bZIP transcription factor bZIP89 [Glycine max] Back     alignment and taxonomy information
>gi|224123412|ref|XP_002319072.1| predicted protein [Populus trichocarpa] gi|222857448|gb|EEE94995.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|118486477|gb|ABK95078.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query308
TAIR|locus:505006398403 BZIP25 "basic leucine zipper 2 0.25 0.191 0.571 5.1e-34
TAIR|locus:2184251314 BZO2H3 "AT5G28770" [Arabidopsi 0.233 0.229 0.569 2.3e-33
TAIR|locus:2149403277 BZIP9 "AT5G24800" [Arabidopsis 0.25 0.277 0.415 3.5e-09
TAIR|locus:2053124171 bZIP2 "AT2G18160" [Arabidopsis 0.246 0.444 0.289 0.00063
TAIR|locus:505006398 BZIP25 "basic leucine zipper 25" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 217 (81.4 bits), Expect = 5.1e-34, Sum P(2) = 5.1e-34
 Identities = 44/77 (57%), Positives = 53/77 (68%)

Query:   229 DSVDDKRARRMLXXXXXXXXXXXXKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYDES 288
             D  D KRARRML            KQ  +NE +TQ GQLRAEHS+L+  L+D+N KYD +
Sbjct:   226 DPTDVKRARRMLSNRESARRSRRRKQEQMNEFDTQVGQLRAEHSTLINRLSDMNHKYDAA 285

Query:   289 AVNNRILKADIETLRAK 305
             AV+NRIL+ADIETLR K
Sbjct:   286 AVDNRILRADIETLRTK 302
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS;IDA
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0046983 "protein dimerization activity" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=IDA
GO:0046982 "protein heterodimerization activity" evidence=IPI
GO:2000693 "positive regulation of seed maturation" evidence=IDA
GO:0007165 "signal transduction" evidence=RCA
GO:0009410 "response to xenobiotic stimulus" evidence=RCA
GO:0009723 "response to ethylene stimulus" evidence=RCA
GO:0009755 "hormone-mediated signaling pathway" evidence=RCA
GO:0030968 "endoplasmic reticulum unfolded protein response" evidence=RCA
TAIR|locus:2184251 BZO2H3 "AT5G28770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149403 BZIP9 "AT5G24800" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053124 bZIP2 "AT2G18160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query308
smart0033865 smart00338, BRLZ, basic region leucin zipper 3e-14
pfam0017064 pfam00170, bZIP_1, bZIP transcription factor 8e-10
cd1219354 cd12193, B_zip1, basic leucine zipper DNA-binding 3e-05
pfam0771654 pfam07716, bZIP_2, Basic region leucine zipper 4e-05
>gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper Back     alignment and domain information 
 Score = 66.0 bits (162), Expect = 3e-14
 Identities = 25/62 (40%), Positives = 37/62 (59%)

Query: 232 DDKRARRMLSNRESARRSRRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYDESAVN 291
           D+KR RR   NRE+ARRSR RK+A + ELE +  QL AE+  L K +  + ++ ++    
Sbjct: 3   DEKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKSE 62

Query: 292 NR 293
             
Sbjct: 63  LE 64

Length = 65
>gnl|CDD|201054 pfam00170, bZIP_1, bZIP transcription factor Back     alignment and domain information
>gnl|CDD|213400 cd12193, B_zip1, basic leucine zipper DNA-binding and multimerization region of GCN4 and related proteins Back     alignment and domain information
>gnl|CDD|203738 pfam07716, bZIP_2, Basic region leucine zipper Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 308
smart0033865 BRLZ basic region leucin zipper. 99.36
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 99.34
KOG4005 292 consensus Transcription factor XBP-1 [Transcriptio 99.26
KOG4343 655 consensus bZIP transcription factor ATF6 [Transcri 99.26
KOG0709 472 consensus CREB/ATF family transcription factor [Tr 99.13
KOG3584348 consensus cAMP response element binding protein an 99.11
PF0771654 bZIP_2: Basic region leucine zipper; InterPro: IPR 99.03
PF0313192 bZIP_Maf: bZIP Maf transcription factor; InterPro: 98.09
KOG0837279 consensus Transcriptional activator of the JUN fam 97.98
KOG4571294 consensus Activating transcription factor 4 [Trans 97.26
KOG4196135 consensus bZIP transcription factor MafK [Transcri 97.18
KOG3119269 consensus Basic region leucine zipper transcriptio 96.8
KOG3863604 consensus bZIP transcription factor NRF1 [Transcri 96.46
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 96.15
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 95.73
TIGR0244965 conserved hypothetical protein TIGR02449. Members 95.69
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 95.34
PRK13169110 DNA replication intiation control protein YabA; Re 95.23
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 94.87
PRK10884206 SH3 domain-containing protein; Provisional 94.79
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 94.76
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 94.6
COG307479 Uncharacterized protein conserved in bacteria [Fun 94.57
TIGR0244965 conserved hypothetical protein TIGR02449. Members 94.56
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 94.17
PRK13169110 DNA replication intiation control protein YabA; Re 94.1
PRK10884206 SH3 domain-containing protein; Provisional 93.99
COG4467114 Regulator of replication initiation timing [Replic 93.74
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 93.55
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 93.54
PF0798975 Microtub_assoc: Microtubule associated; InterPro: 93.26
PRK1542279 septal ring assembly protein ZapB; Provisional 93.12
PF1022480 DUF2205: Predicted coiled-coil protein (DUF2205); 92.59
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 91.92
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 91.03
PF1374789 DUF4164: Domain of unknown function (DUF4164) 90.92
PRK11637 428 AmiB activator; Provisional 90.23
COG4467114 Regulator of replication initiation timing [Replic 90.17
smart0034044 HALZ homeobox associated leucin zipper. 89.86
TIGR00219 283 mreC rod shape-determining protein MreC. MreC (mur 89.62
PRK0211973 hypothetical protein; Provisional 89.59
KOG4005 292 consensus Transcription factor XBP-1 [Transcriptio 89.47
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 89.45
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 89.37
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 89.01
PRK0211973 hypothetical protein; Provisional 88.58
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 88.56
PRK0440675 hypothetical protein; Provisional 88.56
PF13851201 GAS: Growth-arrest specific micro-tubule binding 88.28
PRK11637 428 AmiB activator; Provisional 88.12
PRK0029568 hypothetical protein; Provisional 87.85
PRK0279372 phi X174 lysis protein; Provisional 87.8
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 87.57
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 87.55
PRK1542279 septal ring assembly protein ZapB; Provisional 87.49
PF06785 401 UPF0242: Uncharacterised protein family (UPF0242); 87.04
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 86.96
PRK0432574 hypothetical protein; Provisional 86.94
PF15294278 Leu_zip: Leucine zipper 86.81
KOG1414 395 consensus Transcriptional activator FOSB/c-Fos and 86.71
PRK0432574 hypothetical protein; Provisional 86.57
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 86.34
PRK0440675 hypothetical protein; Provisional 86.28
PRK0073668 hypothetical protein; Provisional 85.94
PF10186 302 Atg14: UV radiation resistance protein and autopha 85.9
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 85.88
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 85.61
PRK10803 263 tol-pal system protein YbgF; Provisional 85.32
PRK0084677 hypothetical protein; Provisional 85.31
PRK0279372 phi X174 lysis protein; Provisional 85.18
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 85.04
COG4942 420 Membrane-bound metallopeptidase [Cell division and 84.82
PRK0029568 hypothetical protein; Provisional 84.61
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 84.5
smart0033865 BRLZ basic region leucin zipper. 84.37
PRK13922 276 rod shape-determining protein MreC; Provisional 84.33
KOG1414395 consensus Transcriptional activator FOSB/c-Fos and 84.31
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 84.22
COG4026290 Uncharacterized protein containing TOPRIM domain, 84.08
PHA03162135 hypothetical protein; Provisional 84.05
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 83.96
PF14662 193 CCDC155: Coiled-coil region of CCDC155 83.91
PF1280852 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2 83.9
COG4026 290 Uncharacterized protein containing TOPRIM domain, 83.89
PF09755 310 DUF2046: Uncharacterized conserved protein H4 (DUF 83.79
PF05278269 PEARLI-4: Arabidopsis phospholipase-like protein ( 83.77
PHA03155115 hypothetical protein; Provisional 83.64
PF10805106 DUF2730: Protein of unknown function (DUF2730); In 83.55
COG307479 Uncharacterized protein conserved in bacteria [Fun 83.52
PF0864796 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 82.99
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 82.92
KOG1962216 consensus B-cell receptor-associated protein and r 82.91
PF11932 251 DUF3450: Protein of unknown function (DUF3450); In 82.72
COG3883 265 Uncharacterized protein conserved in bacteria [Fun 82.72
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 82.6
PF07798177 DUF1640: Protein of unknown function (DUF1640); In 82.39
PF06810155 Phage_GP20: Phage minor structural protein GP20; I 82.36
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 82.3
PF0489970 MbeD_MobD: MbeD/MobD like ; InterPro: IPR006983 Th 82.18
PRK09039 343 hypothetical protein; Validated 81.82
PF14662193 CCDC155: Coiled-coil region of CCDC155 81.68
PF0116659 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 81.36
PRK0084677 hypothetical protein; Provisional 81.32
PF1271186 Kinesin-relat_1: Kinesin motor; InterPro: IPR02465 81.28
PRK00888105 ftsB cell division protein FtsB; Reviewed 81.11
PF07407 420 Seadorna_VP6: Seadornavirus VP6 protein; InterPro: 80.93
PF08172 248 CASP_C: CASP C terminal; InterPro: IPR012955 This 80.77
PHA02562 562 46 endonuclease subunit; Provisional 80.73
PRK00888105 ftsB cell division protein FtsB; Reviewed 80.65
PRK0073668 hypothetical protein; Provisional 80.57
KOG3119269 consensus Basic region leucine zipper transcriptio 80.46
PF09726 697 Macoilin: Transmembrane protein; InterPro: IPR0191 80.37
PF10805106 DUF2730: Protein of unknown function (DUF2730); In 80.24
PF11932 251 DUF3450: Protein of unknown function (DUF3450); In 80.04
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information 
Probab=99.36  E-value=5e-12  Score=94.93  Aligned_cols=61  Identities=41%  Similarity=0.566  Sum_probs=55.4

Q ss_pred             HHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 021757          232 DDKRARRMLSNRESARRSRRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYDESAVNN  292 (308)
Q Consensus       232 e~KR~RR~lsNReSArRSR~RKk~~l~eLE~qV~~Le~EN~~L~~el~~L~qk~~~l~~EN  292 (308)
                      ++|+.+|+++||+||++||.||++|+.+||.+|..|+.+|..|..++..|..++..+..+|
T Consensus         3 ~~k~~rR~~rNR~aA~~~R~rKk~~~~~Le~~~~~L~~en~~L~~~~~~l~~e~~~lk~~~   63 (65)
T smart00338        3 DEKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKSEL   63 (65)
T ss_pred             cHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            5799999999999999999999999999999999999999999999998777777666655

>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>KOG4343 consensus bZIP transcription factor ATF6 [Transcription] Back     alignment and domain information
>KOG0709 consensus CREB/ATF family transcription factor [Transcription] Back     alignment and domain information
>KOG3584 consensus cAMP response element binding protein and related transcription factors [Transcription] Back     alignment and domain information
>PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization Back     alignment and domain information
>PF03131 bZIP_Maf: bZIP Maf transcription factor; InterPro: IPR004826 There are several different types of Maf transcription factors with different roles in the cell Back     alignment and domain information
>KOG0837 consensus Transcriptional activator of the JUN family [Transcription] Back     alignment and domain information
>KOG4571 consensus Activating transcription factor 4 [Transcription] Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information
>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] Back     alignment and domain information
>KOG3863 consensus bZIP transcription factor NRF1 [Transcription] Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PF07989 Microtub_assoc: Microtubule associated; InterPro: IPR012943 Proteins with this domain associate with the spindle body during cell division [] Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PF13747 DUF4164: Domain of unknown function (DUF4164) Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>smart00340 HALZ homeobox associated leucin zipper Back     alignment and domain information
>TIGR00219 mreC rod shape-determining protein MreC Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK00295 hypothetical protein; Provisional Back     alignment and domain information
>PRK02793 phi X174 lysis protein; Provisional Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PRK04325 hypothetical protein; Provisional Back     alignment and domain information
>PF15294 Leu_zip: Leucine zipper Back     alignment and domain information
>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] Back     alignment and domain information
>PRK04325 hypothetical protein; Provisional Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>PRK00736 hypothetical protein; Provisional Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK00846 hypothetical protein; Provisional Back     alignment and domain information
>PRK02793 phi X174 lysis protein; Provisional Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK00295 hypothetical protein; Provisional Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PHA03162 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF12808 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2-binding region; InterPro: IPR024545 This domain occurs at the C terminus of microtubule organising proteins in both budding and fission fungi Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>PF05278 PEARLI-4: Arabidopsis phospholipase-like protein (PEARLI 4); InterPro: IPR007942 This family contains several phospholipase-like proteins from Arabidopsis thaliana and other members of the Streptophyta which are homologous to PEARLI 4 Back     alignment and domain information
>PHA03155 hypothetical protein; Provisional Back     alignment and domain information
>PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins Back     alignment and domain information
>PF06810 Phage_GP20: Phage minor structural protein GP20; InterPro: IPR009636 This family consists of several phage minor structural protein Gp20 sequences and prophage sequences of around 180 residues in length Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>PF04899 MbeD_MobD: MbeD/MobD like ; InterPro: IPR006983 The MbeD and MobD proteins are plasmid encoded, and are involved in the plasmid mobilisation and transfer in the presence of conjugative plasmids [] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF01166 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 Several eukaryotic proteins are evolutionary related and are thought to be involved in transcriptional regulation Back     alignment and domain information
>PRK00846 hypothetical protein; Provisional Back     alignment and domain information
>PF12711 Kinesin-relat_1: Kinesin motor; InterPro: IPR024658 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>PF07407 Seadorna_VP6: Seadornavirus VP6 protein; InterPro: IPR009982 This family consists of several VP6 proteins from the Banna virus as well as a related protein VP5 from the Kadipiro virus Back     alignment and domain information
>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>PRK00736 hypothetical protein; Provisional Back     alignment and domain information
>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query308
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 4e-13
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 2e-09
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 3e-08
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 1e-07
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 2e-07
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 2e-07
2wt7_B90 Transcription factor MAFB; transcription, transcri 1e-06
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 1e-06
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 5e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 2e-04
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Length = 55 Back     alignment and structure
 Score = 62.0 bits (151), Expect = 4e-13
 Identities = 18/52 (34%), Positives = 32/52 (61%)

Query: 234 KRARRMLSNRESARRSRRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKY 285
           KR  R++ NRE+AR SRR+K+ ++  LE +   L  ++ +L++ L  +   Y
Sbjct: 1   KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKDLY 52
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61 Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Length = 62 Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Length = 63 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Length = 63 Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Length = 107 Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Length = 90 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Length = 63 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Length = 70 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Length = 87 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query308
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 99.53
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 99.29
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 99.24
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 99.18
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 99.14
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 99.01
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 98.91
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 98.51
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 98.5
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 98.41
2wt7_B90 Transcription factor MAFB; transcription, transcri 98.2
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 97.46
1deb_A54 APC protein, adenomatous polyposis coli protein; c 95.59
1skn_P92 DNA-binding domain of SKN-1; complex (transcriptio 95.5
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 95.26
2w6a_A63 ARF GTPase-activating protein GIT1; PIX, zinc, sig 95.05
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 94.82
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 93.84
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 92.98
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 92.6
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 92.37
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 91.11
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 90.52
3m48_A33 General control protein GCN4; leucine zipper, synt 90.21
3he5_A49 Synzip1; heterodimeric coiled-coil, de novo protei 89.75
3cve_A72 Homer protein homolog 1; coiled coil, alternative 89.64
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 89.56
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 89.51
1kd8_B36 GABH BLL, GCN4 acid base heterodimer base-D12LA16L 89.46
2c9l_Y63 EB1, zebra, BZLF1 trans-activator protein; viral p 89.34
4etp_A 403 Kinesin-like protein KAR3; kinesin motor protein, 89.19
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 89.01
1p9i_A31 Cortexillin I/GCN4 hybrid peptide; coiled-coil, un 88.78
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 88.44
3efg_A78 Protein SLYX homolog; xanthomonas campestris PV. c 88.33
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 88.3
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 87.54
3vmx_A48 Voltage-gated hydrogen channel 1; coiled-coil, ION 87.48
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 87.05
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 86.88
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 86.81
1kd8_A36 GABH AIV, GCN4 acid base heterodimer acid-D12IA16V 86.77
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 86.74
3u06_A 412 Protein claret segregational; motor domain, stalk 86.53
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 86.47
3a7o_A75 Autophagy protein 16; coiled-coil, coiled coil, cy 86.46
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 86.39
3efg_A78 Protein SLYX homolog; xanthomonas campestris PV. c 86.38
3a2a_A58 Voltage-gated hydrogen channel 1; voltage-gated pr 86.31
3swy_A46 Cyclic nucleotide-gated cation channel alpha-3; co 86.27
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 85.63
3c3g_A33 Alpha/beta peptide with the GCN4-PLI SIDE chain S 85.4
1uo4_A34 General control protein GCN4; four helix bundle, c 85.24
3bas_A89 Myosin heavy chain, striated muscle/general contro 85.15
2hy6_A34 General control protein GCN4; protein design, para 84.9
3m91_A51 Proteasome-associated ATPase; coil COIL alpha heli 84.84
2w83_C77 C-JUN-amino-terminal kinase-interacting protein 4; 84.76
2xdj_A83 Uncharacterized protein YBGF; unknown function; 1. 84.55
2bni_A34 General control protein GCN4; four helix bundle, a 84.53
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 84.51
3swf_A74 CGMP-gated cation channel alpha-1; coiled-coil, as 84.2
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 83.96
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 83.59
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 83.53
2kz5_A91 Transcription factor NF-E2 45 kDa subunit; structu 83.51
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 83.37
2wq1_A33 General control protein GCN4; TAA, nucleus, coiled 83.1
3m9b_A 251 Proteasome-associated ATPase; coil COIL with 5 bet 83.06
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 83.05
2ve7_C250 Kinetochore protein NUF2, kinetochore protein SPC; 82.92
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 82.63
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 82.01
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 81.9
3m48_A33 General control protein GCN4; leucine zipper, synt 81.81
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 81.64
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 81.46
1t6f_A37 Geminin; coiled-coil, cell cycle; 1.47A {Synthetic 81.43
2oa5_A110 Hypothetical protein BQLF2; MHR28B, NESG, structur 81.29
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 81.15
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 81.14
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 80.8
1gk6_A59 Vimentin; intermediate filament, dimer, parallel c 80.07
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 80.06
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
Probab=99.53  E-value=9.8e-15  Score=106.80  Aligned_cols=53  Identities=34%  Similarity=0.596  Sum_probs=49.4

Q ss_pred             HHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 021757          234 KRARRMLSNRESARRSRRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYD  286 (308)
Q Consensus       234 KR~RR~lsNReSArRSR~RKk~~l~eLE~qV~~Le~EN~~L~~el~~L~qk~~  286 (308)
                      ||.+||++||+||++||.||++|+++||.+|..|+.||..|..++..|++.|.
T Consensus         1 kr~rR~~~NResA~rSR~RKk~~~~~LE~~v~~L~~eN~~L~~~~~~L~~~~~   53 (55)
T 1dh3_A            1 KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKDLYS   53 (55)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTST
T ss_pred             ChHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            58899999999999999999999999999999999999999999998877653
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 Back     alignment and structure
>1skn_P DNA-binding domain of SKN-1; complex (transcription factor/DNA), transcription/DNA complex; HET: DNA LDA; 2.50A {Caenorhabditis elegans} SCOP: a.37.1.1 Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>2w6a_A ARF GTPase-activating protein GIT1; PIX, zinc, signaling protein, CAT-1, cytoplasm, ANK repeat, coiled-coil, zinc-finger, metal-binding; 1.40A {Rattus norvegicus} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B Back     alignment and structure
>2c9l_Y EB1, zebra, BZLF1 trans-activator protein; viral protein, epstein-BARR virus, EBV; 2.25A {Human herpesvirus 4} SCOP: h.1.3.1 PDB: 2c9n_Y Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>1p9i_A Cortexillin I/GCN4 hybrid peptide; coiled-coil, unknown function; 1.17A {Synthetic} SCOP: h.1.10.1 Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>3vmx_A Voltage-gated hydrogen channel 1; coiled-coil, ION channel, ION transport, membrane protein; 1.45A {Mus musculus} Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3a7o_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3a2a_A Voltage-gated hydrogen channel 1; voltage-gated proton channel, alternative splicing, coiled C transport, ionic channel, membrane, transmembrane; 2.00A {Homo sapiens} Back     alignment and structure
>3swy_A Cyclic nucleotide-gated cation channel alpha-3; coiled-coil, assembly domain, transport protein; 1.90A {Homo sapiens} Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* Back     alignment and structure
>1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* Back     alignment and structure
>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A Back     alignment and structure
>2hy6_A General control protein GCN4; protein design, parallel heptamer, protein structure, biosyn protein; 1.25A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2nrn_A 3crp_A 2b1f_A 3crp_B 2ipz_A 3ck4_A 3ck4_B 2b22_A 1ce9_A Back     alignment and structure
>3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A Back     alignment and structure
>2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} Back     alignment and structure
>2xdj_A Uncharacterized protein YBGF; unknown function; 1.82A {Escherichia coli} PDB: 2wz7_A Back     alignment and structure
>2bni_A General control protein GCN4; four helix bundle, antiparallel four helix bundle acyl transferase; HET: TYZ; 1.5A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2ccn_A 1w5k_A* 2ccf_A 2cce_A 1w5j_A* 1uo2_A 1gcl_A 1uo1_A 1unv_A 1uo0_A 1unt_A 1uo5_A 1unz_A 1unx_A 1unu_A 1unw_A 1uo4_A 1uo3_A 1uny_A 1u9f_A* ... Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>3swf_A CGMP-gated cation channel alpha-1; coiled-coil, assembly domain, transport protein; 2.14A {Bos taurus} Back     alignment and structure
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>2kz5_A Transcription factor NF-E2 45 kDa subunit; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>2wq1_A General control protein GCN4; TAA, nucleus, coiled coil, DNA-binding, protein export, ION coordination, polar core residues; 1.08A {Saccharomyces cerevisiae} PDB: 2wq0_A 2wq2_A 2wq3_A 2wpz_A 2wpy_A 1ij0_A 1ij1_A 1gcm_A 1rb5_A 1rb6_A 1rb1_A 1rb4_A 1swi_A 3k7z_A 1zii_A 1zij_A 1ij2_A 1ij3_A 1zil_A 1zim_A ... Back     alignment and structure
>3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>2ve7_C Kinetochore protein NUF2, kinetochore protein SPC; mitosis, centromere, cell cycle, microtubule, C division, calponin homology; 2.88A {Homo sapiens} PDB: 3iz0_D* Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1t6f_A Geminin; coiled-coil, cell cycle; 1.47A {Synthetic} SCOP: h.1.28.1 Back     alignment and structure
>2oa5_A Hypothetical protein BQLF2; MHR28B, NESG, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; HET: PE5; 2.10A {Murid herpesvirus 4} SCOP: d.362.1.1 PDB: 2h3r_A* Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>1gk6_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, leucine zipper, fusion protein; 1.9A {Saccharomyces cerevisiae} SCOP: h.1.20.1 Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query308
d1sknp_74 Skn-1 {Caenorhabditis elegans [TaxId: 6239]} 88.89
d2oa5a196 Uncharacterized protein BQLF2 {Murid herpesvirus 4 82.37
>d1sknp_ a.37.1.1 (P:) Skn-1 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: All alpha proteins
fold: A DNA-binding domain in eukaryotic transcription factors
superfamily: A DNA-binding domain in eukaryotic transcription factors
family: A DNA-binding domain in eukaryotic transcription factors
domain: Skn-1
species: Caenorhabditis elegans [TaxId: 6239]

Probab=88.89  E-value=0.091  Score=38.58  Aligned_cols=28  Identities=25%  Similarity=0.338  Sum_probs=23.3

Q ss_pred             HHHHHHHHHHhhHHHHHHHHHHHHHHHH
Q 021757          232 DDKRARRMLSNRESARRSRRRKQAHLNE  259 (308)
Q Consensus       232 e~KR~RR~lsNReSArRSR~RKk~~l~e  259 (308)
                      -.+-.||.=+|+.+||++|+||.....+
T Consensus        46 lirDIRRRGKNKvAAqnCRKRKld~~d~   73 (74)
T d1sknp_          46 LIRKIRRRGKNKVAARTCRQRRTDRHDK   73 (74)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHTTT
T ss_pred             HHHHHHHhcccHHHHHHHHHhhhhhhcc
Confidence            3577889999999999999999876543
>d2oa5a1 d.362.1.1 (A:7-102) Uncharacterized protein BQLF2 {Murid herpesvirus 4 [TaxId: 33708]} Back     information, alignment and structure