Citrus Sinensis ID: 021792

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------
MSRQPHLPPRCPFQKKHVSGPIHDPISPPQRAESYVRHHKSSSQSSILEDQPAWLDNLLSDPGANSVGILHRRSASDSVTLLDGIVGSFLDLNPQNDDKNLDGHEACSGLESSCLYGPNSPRKRSNLTFAGNAIVSAISESALENHLLQYVDESLCISGVIPSDLNGDIHTLTGEHNAETKMTKRQFGQRSRVRKLQYIAELERTVEYFQTLQADLGARVALLLQQHVSLSMENSKLKQKIARVQKEKLIMEGQYQYLKKEAERLKVSLAISPRSKVKTYFGTNSAAEGSQSGVNWQMLDFAKLNLN
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccc
cccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHcccccHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHcccc
msrqphlpprcpfqkkhvsgpihdpisppqraesyvrhhksssqssiledqpAWLDnllsdpgansvgilhrrsasdsvtlldgivgsfldlnpqnddknldgheacsglessclygpnsprkrsnltfAGNAIVSAISESALENHLLQYVdeslcisgvipsdlngdihtltgehnaetkmtkrqfgqrsRVRKLQYIAELERTVEYFQTLQADLGARVALLLQQHVSLSMENSKLKQKIARVQKEKLIMEGQYQYLKKEAERLKVSLaisprskvktyfgtnsaaegsqsgvnwQMLDFAKLNLN
msrqphlpprcpfqkkhvsgpiHDPISPPQRAESYVRHHKSSSQSSILEDQPAWLDNLLSDPGANSVGILHRRSASDSVTLLDGIVGSFLDLNPQNDDKNLDGHEACSGLESSCLYGPNSPRKRSNLTFAGNAIVSAISESALENHLLQYVDESLCISGVIPSDLNGDIHTLtgehnaetkmtkrqfgqrsrvRKLQYIAELERTVEYFQTLQADLGARVALLLQQHVSlsmensklkQKIARVQKEKLIMEGQYQYLKKEAERLKVslaisprskvktYFGTnsaaegsqsgvnwqMLDFAKLNLN
MSRQPHLPPRCPFQKKHVSGPIHDPISPPQRAESYVRHHKSSSQSSILEDQPAWLDNLLSDPGANSVGILHRRSASDSVTLLDGIVGSFLDLNPQNDDKNLDGHEACSGLESSCLYGPNSPRKRSNLTFAGNAIVSAISESALENHLLQYVDESLCISGVIPSDLNGDIHTLTGEHNAETKMTKRQFGQRSRVRKLQYIAELERTVEYFQTLQADLGARVALLLQQHVSLSMENSKLKQKIARVQKEKLIMEGQYQYLKKEAERLKVSLAISPRSKVKTYFGTNSAAEGSQSGVNWQMLDFAKLNLN
*****************************************************WLDNLL******SVGILHRRSASDSVTLLDGIVGSFLDL**********************************LTFAGNAIVSAISESALENHLLQYVDESLCISGVIPSDLNGDIHTLTG*****************RVRKLQYIAELERTVEYFQTLQADLGARVALLLQQHVSLSM*******KIARVQKEKLIMEGQYQYLKKEAERLKVSLAIS****VKTYFG************NWQMLDF******
*****HL***********************************************************************************************************************************************************************************************IAELERTVEYFQTLQADLGARVALLLQQHV**************************YQYLKKEAE********************************************
********PRCPFQKKHVSGPIHDPI*********************LEDQPAWLDNLLSDPGANSVGILHRRSASDSVTLLDGIVGSFLDLNPQNDDKNLDGHEACSGLESSCLYGPNSPRKRSNLTFAGNAIVSAISESALENHLLQYVDESLCISGVIPSDLNGDIHTLTGEHNAET************VRKLQYIAELERTVEYFQTLQADLGARVALLLQQHVSLSMENSKLKQKIARVQKEKLIMEGQYQYLKKEAERLKVSLAISPRSKVKTYFGTNSAAEGSQSGVNWQMLDFAKLNLN
******LPPRCPFQK***********************************QPAWLDNLLSDPG*****************LLDGIVGSFLDL***********************************************************************************HNAETKMTKRQFGQRSRVRKLQYIAELERTVEYFQTLQADLGARVALLLQQHVSLSMENSKLKQKIARVQKEKLIMEGQYQYLKKEAERLKVSLAI**********************VNWQMLDFAKLN**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRQPHLPPRCPFQKKHVSGPIHDPISPPQRAESYVRHHKSSSQSSILEDQPAWLDNLLSDPGANSVGILHRRSASDSVTLLDGIVGSFLDLNPQNDDKNLDGHEACSGLESSCLYGPNSPRKRSNLTFAGNAIVSAISESALENHLLQYVDESLCISGVIPSDLNGDIHTLTGEHNAETKMTKRQFGQRSRVRKLQYIAELERTVEYFQTLQADLGARVALLLQQxxxxxxxxxxxxxxxxxxxxxxxxxxxxYQYLKKEAERLKVSLAISPRSKVKTYFGTNSAAEGSQSGVNWQMLDFAKLNLN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query307 2.2.26 [Sep-21-2011]
Q69IL4380 Transcription factor RF2a no no 0.273 0.221 0.404 6e-09
Q8W3M7265 Uncharacterized protein A no no 0.276 0.320 0.353 1e-07
Q6S4P4329 Transcription factor RF2b no no 0.283 0.264 0.356 2e-07
Q04088398 Probable transcription fa no no 0.325 0.251 0.336 5e-07
Q9MA75341 Transcription factor VIP1 no no 0.335 0.302 0.300 2e-06
>sp|Q69IL4|RF2A_ORYSJ Transcription factor RF2a OS=Oryza sativa subsp. japonica GN=RF2a PE=1 SV=1 Back     alignment and function desciption
 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 53/84 (63%)

Query: 185 RQFGQRSRVRKLQYIAELERTVEYFQTLQADLGARVALLLQQHVSLSMENSKLKQKIARV 244
           RQ   RS+ RK++YIAELER V+  QT    L A++ALL +    L+ ENS+LK ++  +
Sbjct: 192 RQSAARSKERKMRYIAELERKVQTLQTEATTLSAQLALLQRDTSGLTTENSELKLRLQTM 251

Query: 245 QKEKLIMEGQYQYLKKEAERLKVS 268
           +++  + +     LK E +RLKV+
Sbjct: 252 EQQVHLQDALNDTLKSEVQRLKVA 275
Transcription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication.
Oryza sativa subsp. japonica (taxid: 39947)
>sp|Q8W3M7|Y4598_ARATH Uncharacterized protein At4g06598 OS=Arabidopsis thaliana GN=At4g06598 PE=2 SV=2 Back     alignment and function description
>sp|Q6S4P4|RF2B_ORYSJ Transcription factor RF2b OS=Oryza sativa subsp. japonica GN=RF2b PE=1 SV=1 Back     alignment and function description
>sp|Q04088|POF21_ARATH Probable transcription factor PosF21 OS=Arabidopsis thaliana GN=POSF21 PE=2 SV=1 Back     alignment and function description
>sp|Q9MA75|VIP1_ARATH Transcription factor VIP1 OS=Arabidopsis thaliana GN=VIP1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query307
224110108294 predicted protein [Populus trichocarpa] 0.957 1.0 0.566 2e-86
224100593293 predicted protein [Populus trichocarpa] 0.954 1.0 0.570 2e-85
225463707308 PREDICTED: uncharacterized protein LOC10 0.996 0.993 0.588 2e-81
22326603307 bZIP protein [Arabidopsis thaliana] gi|2 0.970 0.970 0.471 1e-58
449434526280 PREDICTED: probable transcription factor 0.895 0.982 0.491 1e-58
297806467303 bZIP protein [Arabidopsis lyrata subsp. 0.957 0.970 0.465 7e-58
9758459342 unnamed protein product [Arabidopsis tha 0.996 0.894 0.446 3e-57
449522015279 PREDICTED: probable transcription factor 0.892 0.982 0.473 3e-55
195640550322 hypothetical protein [Zea mays] 0.934 0.891 0.404 6e-50
224032473322 unknown [Zea mays] gi|413922612|gb|AFW62 0.934 0.891 0.401 1e-48
>gi|224110108|ref|XP_002315418.1| predicted protein [Populus trichocarpa] gi|222864458|gb|EEF01589.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  325 bits (832), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 174/307 (56%), Positives = 218/307 (71%), Gaps = 13/307 (4%)

Query: 1   MSRQPHLPPRCPFQKKHVSGPIHDPISPPQRAESYVRHHKSSSQSSILEDQPAWLDNLLS 60
           MSRQ  LPPRCPFQK  VS PIHD         SY +HH+S SQ SIL ++PAWLD+LLS
Sbjct: 1   MSRQSLLPPRCPFQKPVVSRPIHD---------SYPQHHRSPSQGSILGEKPAWLDDLLS 51

Query: 61  DPGANSVGILHRRSASDSVTLLDGIVGSFLDLNPQNDDKNLDGHEACSGLESSCLYGPNS 120
           D  A+S G   RRSASDSVTLL+GIV SF   +P N++    G E CSGLES+ +YGPNS
Sbjct: 52  DEDADSRGTCLRRSASDSVTLLEGIVDSFSGSSPYNNEAASGGGETCSGLESASMYGPNS 111

Query: 121 PRKRSNLTFAGNAIVSAISESALENHLLQYVDESLCISGVIPSDLNGDIHTLTGEHNAET 180
           PR+R N+TF+ NAI SA+SE A +N L QYVD SLCI G  P D  G+     GE N ET
Sbjct: 112 PRRRGNVTFSENAIASALSEYAFQNPL-QYVDGSLCIWGNTPLDSMGNACGSAGELNGET 170

Query: 181 KMTKRQFGQRSRVRKLQYIAELERTVEYFQTLQADLGARVALLLQQHVSLSMENSKLKQK 240
              KRQ GQRSRVRKLQYIAELERTV   QTL+++L  +VA +LQ+  +LS+EN+ LKQ+
Sbjct: 171 STVKRQSGQRSRVRKLQYIAELERTVNVLQTLESELAFKVASMLQKRAALSLENNTLKQQ 230

Query: 241 IARVQKEKLIMEGQYQYLKKEAERLKVSLAISPRSKVKTYFGTNSAAEGSQSGVNWQMLD 300
           +AR+++EKLI++ Q++ LKKEAERLK  L  S  +K +TY  ++ + E ++S V WQM  
Sbjct: 231 VARLRQEKLIVDAQHKTLKKEAERLKNKLGSSTNNKFRTYSRSSLSPEAARSEVTWQM-- 288

Query: 301 FAKLNLN 307
            A+LNLN
Sbjct: 289 -ARLNLN 294

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224100593|ref|XP_002311938.1| predicted protein [Populus trichocarpa] gi|222851758|gb|EEE89305.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225463707|ref|XP_002262794.1| PREDICTED: uncharacterized protein LOC100250801 [Vitis vinifera] gi|296084439|emb|CBI24998.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|22326603|ref|NP_196104.2| bZIP protein [Arabidopsis thaliana] gi|20466830|gb|AAM20732.1| unknown protein [Arabidopsis thaliana] gi|30984520|gb|AAP42723.1| At5g04840 [Arabidopsis thaliana] gi|332003410|gb|AED90793.1| bZIP protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449434526|ref|XP_004135047.1| PREDICTED: probable transcription factor PosF21-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297806467|ref|XP_002871117.1| bZIP protein [Arabidopsis lyrata subsp. lyrata] gi|297316954|gb|EFH47376.1| bZIP protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|9758459|dbj|BAB08988.1| unnamed protein product [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449522015|ref|XP_004168024.1| PREDICTED: probable transcription factor PosF21-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|195640550|gb|ACG39743.1| hypothetical protein [Zea mays] Back     alignment and taxonomy information
>gi|224032473|gb|ACN35312.1| unknown [Zea mays] gi|413922612|gb|AFW62544.1| putative bZIP transcription factor superfamily protein isoform 1 [Zea mays] gi|413922613|gb|AFW62545.1| putative bZIP transcription factor superfamily protein isoform 2 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query307
TAIR|locus:2175473307 AT5G04840 "AT5G04840" [Arabido 0.970 0.970 0.474 1.3e-59
TAIR|locus:2196225374 AT1G58110 "AT1G58110" [Arabido 0.283 0.232 0.471 3.2e-22
TAIR|locus:2085425329 BZIP61 [Arabidopsis thaliana ( 0.387 0.361 0.386 8.4e-17
TAIR|locus:2008673300 AT1G35490 "AT1G35490" [Arabido 0.276 0.283 0.362 1.6e-16
TAIR|locus:2053761321 BZIP34 "AT2G42380" [Arabidopsi 0.276 0.264 0.482 1.2e-12
TAIR|locus:2061908367 AT2G40620 "AT2G40620" [Arabido 0.599 0.501 0.295 1.9e-09
TAIR|locus:2198856423 AT1G06070 "AT1G06070" [Arabido 0.557 0.404 0.276 4.9e-08
TAIR|locus:2033123337 bZIP52 "AT1G06850" [Arabidopsi 0.674 0.614 0.255 1.9e-07
TAIR|locus:2061340398 AT2G31370 [Arabidopsis thalian 0.325 0.251 0.336 1.5e-06
TAIR|locus:2031123341 VIP1 "VIRE2-interacting protei 0.374 0.337 0.310 3.6e-06
TAIR|locus:2175473 AT5G04840 "AT5G04840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 611 (220.1 bits), Expect = 1.3e-59, P = 1.3e-59
 Identities = 150/316 (47%), Positives = 196/316 (62%)

Query:     1 MSRQPHLPPRCPFQKKHVSGPIHDPI-SPPQRAESYVRHHKSSSQSSILEDQPAWLDNLL 59
             MSR   LPPRCP  KK    P+ D   S     ESY+  +KSS+Q S LEDQPAWLD LL
Sbjct:     1 MSRPAPLPPRCPIPKKLSLSPVADTFYSSSSPIESYIGQYKSSTQDSRLEDQPAWLDELL 60

Query:    60 SDP--GANSVGILHRRSASDSVTLLDGIVGSFLDLNPQNDDKNLDGHEACSGLESSCLYG 117
              D   G  + G   RRSASDSV LL  I  +F   +   D+++L   EAC  LES+C+YG
Sbjct:    61 CDKTDGLLTRGGPLRRSASDSVVLLGDISATFSGFDQSEDEESLSS-EACGDLESACVYG 119

Query:   118 PNSPRKRSNLTFAGNAIVSAISESALENHLLQYVDESLCISGVIPSDLNGDIHTLTGEHN 177
             PNSPR ++N +F+ N I SA S+   +    Q +D++  + G+  S +  +     G  N
Sbjct:   120 PNSPRAKNNSSFSNNPIASAFSDYGSQTPP-QNLDDT--VKGINRSPVAENACGSMGIPN 176

Query:   178 AETKMTKRQFGQRSRVRKLQYIAELERTVEYFQTLQADLGARVALLLQQHVSLSMENSKL 237
             A     KR  GQRSRVRKLQYIAELERTV   QT++ADL  RVA LLQ   +LS+ENS+L
Sbjct:   177 A-----KRNPGQRSRVRKLQYIAELERTVGMLQTVEADLSVRVASLLQTRATLSLENSQL 231

Query:   238 KQKIARVQKEKLIMEGQYQYLKKEAERLKVSLAI--SPRSK---VKTYF-GTNSAAEGSQ 291
             KQ++A ++++KLI EG+YQ LKKEA+RLK  L    S  +    V++Y  G+N A   + 
Sbjct:   232 KQQMAILKQDKLIREGEYQLLKKEAQRLKSGLGYLGSTNNSNRLVRSYSAGSNVAPRTAS 291

Query:   292 SGVNWQMLDFAKLNLN 307
             S ++W +LD  KLNLN
Sbjct:   292 SHLDWNLLDLTKLNLN 307
GO:0003677 "DNA binding" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
TAIR|locus:2196225 AT1G58110 "AT1G58110" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085425 BZIP61 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008673 AT1G35490 "AT1G35490" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053761 BZIP34 "AT2G42380" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061908 AT2G40620 "AT2G40620" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2198856 AT1G06070 "AT1G06070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033123 bZIP52 "AT1G06850" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061340 AT2G31370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031123 VIP1 "VIRE2-interacting protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query307
smart0033865 smart00338, BRLZ, basic region leucin zipper 4e-04
>gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper Back     alignment and domain information 
 Score = 37.9 bits (89), Expect = 4e-04
 Identities = 20/67 (29%), Positives = 30/67 (44%), Gaps = 21/67 (31%)

Query: 189 QRSRVRKLQYIAELERTVEYFQTLQADLGARVALLLQQHVSLSMENSKLKQKIARVQKEK 248
           +RSR RK   I ELER VE                      L  EN +LK++I R+++E 
Sbjct: 18  RRSRERKKAEIEELERKVE---------------------QLEAENERLKKEIERLRREL 56

Query: 249 LIMEGQY 255
             ++ + 
Sbjct: 57  EKLKSEL 63

Length = 65

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 307
smart0033865 BRLZ basic region leucin zipper. 98.95
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 98.86
PF0771654 bZIP_2: Basic region leucine zipper; InterPro: IPR 98.42
KOG4005292 consensus Transcription factor XBP-1 [Transcriptio 97.97
KOG0837279 consensus Transcriptional activator of the JUN fam 97.46
KOG4343 655 consensus bZIP transcription factor ATF6 [Transcri 97.33
KOG0709472 consensus CREB/ATF family transcription factor [Tr 97.15
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 96.94
PRK13169110 DNA replication intiation control protein YabA; Re 96.8
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 96.59
PF0313192 bZIP_Maf: bZIP Maf transcription factor; InterPro: 96.42
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 96.4
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 96.03
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 95.79
COG4467114 Regulator of replication initiation timing [Replic 95.76
PRK10884206 SH3 domain-containing protein; Provisional 95.46
KOG3584348 consensus cAMP response element binding protein an 94.98
PF14662193 CCDC155: Coiled-coil region of CCDC155 94.78
COG307479 Uncharacterized protein conserved in bacteria [Fun 94.77
PF14662193 CCDC155: Coiled-coil region of CCDC155 94.62
KOG4571294 consensus Activating transcription factor 4 [Trans 94.33
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 94.27
PF0798975 Microtub_assoc: Microtubule associated; InterPro: 94.15
COG2433 652 Uncharacterized conserved protein [Function unknow 93.81
PF1271186 Kinesin-relat_1: Kinesin motor; InterPro: IPR02465 93.79
PRK1542279 septal ring assembly protein ZapB; Provisional 93.57
PF05837106 CENP-H: Centromere protein H (CENP-H); InterPro: I 93.21
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 93.16
PF1022480 DUF2205: Predicted coiled-coil protein (DUF2205); 93.04
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 92.67
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 92.37
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 92.27
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 92.2
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 92.18
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 92.14
TIGR00219 283 mreC rod shape-determining protein MreC. MreC (mur 91.86
PRK0211973 hypothetical protein; Provisional 91.76
PRK0029568 hypothetical protein; Provisional 91.54
PF05700221 BCAS2: Breast carcinoma amplified sequence 2 (BCAS 91.48
PRK0432574 hypothetical protein; Provisional 91.29
PF05911 769 DUF869: Plant protein of unknown function (DUF869) 91.24
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 91.15
PRK10884206 SH3 domain-containing protein; Provisional 91.15
PRK11637 428 AmiB activator; Provisional 91.11
PRK0073668 hypothetical protein; Provisional 90.85
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 90.83
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 90.83
TIGR0244965 conserved hypothetical protein TIGR02449. Members 90.57
KOG3119269 consensus Basic region leucine zipper transcriptio 90.48
PRK0279372 phi X174 lysis protein; Provisional 90.46
PRK09039343 hypothetical protein; Validated 90.44
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 90.36
PF10186 302 Atg14: UV radiation resistance protein and autopha 90.18
PRK09039 343 hypothetical protein; Validated 90.13
TIGR03495135 phage_LysB phage lysis regulatory protein, LysB fa 90.03
PRK0084677 hypothetical protein; Provisional 89.75
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 89.7
KOG4807593 consensus F-actin binding protein, regulates actin 89.45
COG2433 652 Uncharacterized conserved protein [Function unknow 89.39
PRK0440675 hypothetical protein; Provisional 89.18
KOG1103 561 consensus Predicted coiled-coil protein [Function 89.01
KOG0982502 consensus Centrosomal protein Nuf [Cell cycle cont 88.82
PF10805106 DUF2730: Protein of unknown function (DUF2730); In 88.52
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 88.49
PF00038 312 Filament: Intermediate filament protein; InterPro: 88.46
PRK13922 276 rod shape-determining protein MreC; Provisional 88.3
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 88.29
PRK11637 428 AmiB activator; Provisional 88.24
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 88.21
PF0472856 LPP: Lipoprotein leucine-zipper; InterPro: IPR0068 87.99
KOG1899 861 consensus LAR transmembrane tyrosine phosphatase-i 87.96
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 87.95
PF15058 200 Speriolin_N: Speriolin N terminus 87.53
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 87.49
PF07798177 DUF1640: Protein of unknown function (DUF1640); In 87.39
PF10186 302 Atg14: UV radiation resistance protein and autopha 87.24
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 86.81
KOG0995 581 consensus Centromere-associated protein HEC1 [Cell 86.65
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 86.63
KOG3863604 consensus bZIP transcription factor NRF1 [Transcri 86.54
PF0537755 FlaC_arch: Flagella accessory protein C (FlaC); In 86.51
PF06216 389 RTBV_P46: Rice tungro bacilliform virus P46 protei 86.13
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 85.85
KOG0239 670 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] 85.47
PF04880166 NUDE_C: NUDE protein, C-terminal conserved region; 85.45
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 85.41
PF15294278 Leu_zip: Leucine zipper 85.06
TIGR0244965 conserved hypothetical protein TIGR02449. Members 84.86
PF00038312 Filament: Intermediate filament protein; InterPro: 84.82
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 84.74
COG3883 265 Uncharacterized protein conserved in bacteria [Fun 84.72
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 84.68
PF02403108 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom 84.54
PF14817 632 HAUS5: HAUS augmin-like complex subunit 5 84.43
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 84.26
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 84.18
PF10211189 Ax_dynein_light: Axonemal dynein light chain; Inte 83.95
COG307479 Uncharacterized protein conserved in bacteria [Fun 83.9
PF1374789 DUF4164: Domain of unknown function (DUF4164) 83.71
PF08172248 CASP_C: CASP C terminal; InterPro: IPR012955 This 83.18
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 83.09
PF06428100 Sec2p: GDP/GTP exchange factor Sec2p; InterPro: IP 83.07
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 83.06
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 82.87
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 82.66
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 82.54
PRK1542279 septal ring assembly protein ZapB; Provisional 82.26
KOG3650120 consensus Predicted coiled-coil protein [General f 82.08
PF05667 594 DUF812: Protein of unknown function (DUF812); Inte 82.02
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 81.91
PRK10803263 tol-pal system protein YbgF; Provisional 81.87
PF05103131 DivIVA: DivIVA protein; InterPro: IPR007793 The Ba 81.8
KOG12651189 consensus Phospholipase C [Lipid transport and met 81.5
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 81.47
PF13870177 DUF4201: Domain of unknown function (DUF4201) 81.39
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 81.27
KOG4005292 consensus Transcription factor XBP-1 [Transcriptio 81.01
PF1280852 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2 81.01
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 80.98
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 80.95
TIGR0220985 ftsL_broad cell division protein FtsL. This model 80.73
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 80.66
PF05529192 Bap31: B-cell receptor-associated protein 31-like 80.65
PF15035182 Rootletin: Ciliary rootlet component, centrosome c 80.56
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 80.45
COG4942 420 Membrane-bound metallopeptidase [Cell division and 80.09
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information 
Probab=98.95  E-value=2.9e-09  Score=79.86  Aligned_cols=56  Identities=32%  Similarity=0.364  Sum_probs=48.9

Q ss_pred             chhhHH-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHhhhhhhhhh
Q 021792          179 ETKMTK-----RQFGQRSRVRKLQYIAELERTVEYFQTLQADLGARVALLLQQHVSLSMEN  234 (307)
Q Consensus       179 DpKR~K-----RqSA~RSR~RKl~Yi~ELE~kVq~Lq~E~a~Ls~~l~~L~~~~~~L~~EN  234 (307)
                      |+|+.+     |.+|+++|+||.+||.+||.+|+.|+.++..|..+|..|..+...|..+|
T Consensus         3 ~~k~~rR~~rNR~aA~~~R~rKk~~~~~Le~~~~~L~~en~~L~~~~~~l~~e~~~lk~~~   63 (65)
T smart00338        3 DEKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKSEL   63 (65)
T ss_pred             cHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            556666     99999999999999999999999999999999999998876666666554

>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>KOG0837 consensus Transcriptional activator of the JUN family [Transcription] Back     alignment and domain information
>KOG4343 consensus bZIP transcription factor ATF6 [Transcription] Back     alignment and domain information
>KOG0709 consensus CREB/ATF family transcription factor [Transcription] Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PF03131 bZIP_Maf: bZIP Maf transcription factor; InterPro: IPR004826 There are several different types of Maf transcription factors with different roles in the cell Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>KOG3584 consensus cAMP response element binding protein and related transcription factors [Transcription] Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>KOG4571 consensus Activating transcription factor 4 [Transcription] Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PF07989 Microtub_assoc: Microtubule associated; InterPro: IPR012943 Proteins with this domain associate with the spindle body during cell division [] Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12711 Kinesin-relat_1: Kinesin motor; InterPro: IPR024658 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PF05837 CENP-H: Centromere protein H (CENP-H); InterPro: IPR008426 Chromosome segregation in eukaryotes requires the kinetochore, a multi-protein structure that assembles on centromeric DNA, and which acts to link chromosomes to spindle microtubules Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>TIGR00219 mreC rod shape-determining protein MreC Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>PRK00295 hypothetical protein; Provisional Back     alignment and domain information
>PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function Back     alignment and domain information
>PRK04325 hypothetical protein; Provisional Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK00736 hypothetical protein; Provisional Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] Back     alignment and domain information
>PRK02793 phi X174 lysis protein; Provisional Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>TIGR03495 phage_LysB phage lysis regulatory protein, LysB family Back     alignment and domain information
>PRK00846 hypothetical protein; Provisional Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>KOG1103 consensus Predicted coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PF04728 LPP: Lipoprotein leucine-zipper; InterPro: IPR006817 This repeating sequence, NAKVDQLSNDV, is found in the enterobacterial outer membrane lipoprotein LPP Back     alignment and domain information
>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PF15058 Speriolin_N: Speriolin N terminus Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>KOG3863 consensus bZIP transcription factor NRF1 [Transcription] Back     alignment and domain information
>PF05377 FlaC_arch: Flagella accessory protein C (FlaC); InterPro: IPR008039 Although archaeal flagella appear superficially similar to those of bacteria, they are quite distinct [] Back     alignment and domain information
>PF06216 RTBV_P46: Rice tungro bacilliform virus P46 protein; InterPro: IPR009347 This family consists of several Rice tungro bacilliform virus P46 proteins Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] Back     alignment and domain information
>PF04880 NUDE_C: NUDE protein, C-terminal conserved region; InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PF15294 Leu_zip: Leucine zipper Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PF14817 HAUS5: HAUS augmin-like complex subunit 5 Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13747 DUF4164: Domain of unknown function (DUF4164) Back     alignment and domain information
>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>PF06428 Sec2p: GDP/GTP exchange factor Sec2p; InterPro: IPR009449 In Saccharomyces cerevisiae, Sec2p is a GDP/GTP exchange factor for Sec4p, which is required for vesicular transport at the post-Golgi stage of yeast secretion [] Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>KOG3650 consensus Predicted coiled-coil protein [General function prediction only] Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF05103 DivIVA: DivIVA protein; InterPro: IPR007793 The Bacillus subtilis divIVA1 mutation causes misplacement of the septum during cell division, resulting in the formation of small, circular, anucleate minicells [] Back     alignment and domain information
>KOG1265 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>PF12808 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2-binding region; InterPro: IPR024545 This domain occurs at the C terminus of microtubule organising proteins in both budding and fission fungi Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>TIGR02209 ftsL_broad cell division protein FtsL Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PF05529 Bap31: B-cell receptor-associated protein 31-like ; InterPro: IPR008417 Bap31 is a polytopic integral protein of the endoplasmic reticulum membrane and a substrate of caspase-8 Back     alignment and domain information
>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query307
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 1e-05
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 2e-04
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Length = 107 Back     alignment and structure
 Score = 42.7 bits (100), Expect = 1e-05
 Identities = 17/88 (19%), Positives = 34/88 (38%), Gaps = 5/88 (5%)

Query: 164 DLNGDIHTLTGEHNAETKMTKR-----QFGQRSRVRKLQYIAELERTVEYFQTLQADLGA 218
           +LN  +  L+ E   + K  +R      +    RV+++    ELE+     Q     L +
Sbjct: 20  ELNQHLRGLSKEEIIQLKQRRRTLKNRGYAASCRVKRVTQKEELEKQKAELQQEVEKLAS 79

Query: 219 RVALLLQQHVSLSMENSKLKQKIARVQK 246
             A +  +  +L  +   L+     V +
Sbjct: 80  ENASMKLELDALRSKYEALQNFARTVAR 107
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query307
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 99.08
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 98.81
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 98.79
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 98.74
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 98.67
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 98.55
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 98.31
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 97.54
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 97.52
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 97.41
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 96.73
2wt7_B90 Transcription factor MAFB; transcription, transcri 96.64
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 95.6
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 95.5
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 95.16
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 94.8
2w6a_A63 ARF GTPase-activating protein GIT1; PIX, zinc, sig 94.59
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 94.37
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 94.04
3swy_A46 Cyclic nucleotide-gated cation channel alpha-3; co 92.72
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 91.89
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 91.65
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 91.61
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 91.43
3efg_A78 Protein SLYX homolog; xanthomonas campestris PV. c 91.35
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 91.3
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 90.93
3swf_A74 CGMP-gated cation channel alpha-1; coiled-coil, as 90.8
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 89.27
3m48_A33 General control protein GCN4; leucine zipper, synt 89.21
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 88.89
1deb_A54 APC protein, adenomatous polyposis coli protein; c 88.43
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 88.02
3m48_A33 General control protein GCN4; leucine zipper, synt 87.93
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 87.79
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 87.63
3cve_A72 Homer protein homolog 1; coiled coil, alternative 87.62
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 87.51
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 87.1
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 86.88
3m9b_A 251 Proteasome-associated ATPase; coil COIL with 5 bet 86.82
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 86.59
3m0d_C65 TNF receptor-associated factor 1; trimeric helix c 86.58
3c3g_A33 Alpha/beta peptide with the GCN4-PLI SIDE chain S 86.13
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 85.9
2wq1_A33 General control protein GCN4; TAA, nucleus, coiled 85.44
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 85.4
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 85.32
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 85.28
3qh9_A81 Liprin-beta-2; coiled-coil, dimerization, structur 85.09
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 85.0
1kd8_B36 GABH BLL, GCN4 acid base heterodimer base-D12LA16L 84.36
3a7o_A75 Autophagy protein 16; coiled-coil, coiled coil, cy 84.07
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 83.94
4etp_A 403 Kinesin-like protein KAR3; kinesin motor protein, 83.92
3c3g_A33 Alpha/beta peptide with the GCN4-PLI SIDE chain S 83.62
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 83.13
1uo4_A34 General control protein GCN4; four helix bundle, c 83.11
2bni_A34 General control protein GCN4; four helix bundle, a 82.97
3cve_A72 Homer protein homolog 1; coiled coil, alternative 82.86
1kd8_A36 GABH AIV, GCN4 acid base heterodimer acid-D12IA16V 82.55
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 82.55
2w83_C77 C-JUN-amino-terminal kinase-interacting protein 4; 82.29
2hy6_A34 General control protein GCN4; protein design, para 82.2
2j5u_A 255 MREC protein; bacterial cell shape determining pro 82.15
3he5_A49 Synzip1; heterodimeric coiled-coil, de novo protei 81.96
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 81.84
2wq1_A33 General control protein GCN4; TAA, nucleus, coiled 81.74
4ati_A118 MITF, microphthalmia-associated transcription fact 81.28
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 81.27
2bni_A34 General control protein GCN4; four helix bundle, a 81.16
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 80.9
4emc_A190 Monopolin complex subunit CSM1; RWD domain, kineto 80.9
2hy6_A34 General control protein GCN4; protein design, para 80.37
1uo4_A34 General control protein GCN4; four helix bundle, c 80.3
3na7_A 256 HP0958; flagellar biogenesis, flagellum export, C4 80.24
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 80.17
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 80.06
2no2_A107 HIP-I, huntingtin-interacting protein 1; clathrin 80.06
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
Probab=99.08  E-value=2e-10  Score=83.89  Aligned_cols=43  Identities=23%  Similarity=0.308  Sum_probs=40.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHhh
Q 021792          185 RQFGQRSRVRKLQYIAELERTVEYFQTLQADLGARVALLLQQH  227 (307)
Q Consensus       185 RqSA~RSR~RKl~Yi~ELE~kVq~Lq~E~a~Ls~~l~~L~~~~  227 (307)
                      |+||+|||.||++||.+||.+|..|+.||..|..++..|++..
T Consensus        10 ResA~rSR~RKk~~~~~LE~~v~~L~~eN~~L~~~~~~L~~~~   52 (55)
T 1dh3_A           10 REAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKDLY   52 (55)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTS
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            9999999999999999999999999999999999999987654
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure
>2w6a_A ARF GTPase-activating protein GIT1; PIX, zinc, signaling protein, CAT-1, cytoplasm, ANK repeat, coiled-coil, zinc-finger, metal-binding; 1.40A {Rattus norvegicus} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3swy_A Cyclic nucleotide-gated cation channel alpha-3; coiled-coil, assembly domain, transport protein; 1.90A {Homo sapiens} Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>3swf_A CGMP-gated cation channel alpha-1; coiled-coil, assembly domain, transport protein; 2.14A {Bos taurus} Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>3m0d_C TNF receptor-associated factor 1; trimeric helix coiled coiled, acetylation, alternative splic apoptosis, coiled coil, cytoplasm; 2.80A {Homo sapiens} Back     alignment and structure
>3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2wq1_A General control protein GCN4; TAA, nucleus, coiled coil, DNA-binding, protein export, ION coordination, polar core residues; 1.08A {Saccharomyces cerevisiae} PDB: 2wq0_A 2wq2_A 2wq3_A 2wpz_A 2wpy_A 1ij0_A 1ij1_A 1gcm_A 1rb5_A 1rb6_A 1rb1_A 1rb4_A 1swi_A 3k7z_A 1zii_A 1zij_A 1ij2_A 1ij3_A 1zil_A 1zim_A ... Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B Back     alignment and structure
>3a7o_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* Back     alignment and structure
>2bni_A General control protein GCN4; four helix bundle, antiparallel four helix bundle acyl transferase; HET: TYZ; 1.5A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2ccn_A 1w5k_A* 2ccf_A 2cce_A 1w5j_A* 1uo2_A 1gcl_A 1uo1_A 1unv_A 1uo0_A 1unt_A 1uo5_A 1unz_A 1unx_A 1unu_A 1unw_A 1uo4_A 1uo3_A 1uny_A 1u9f_A* ... Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} Back     alignment and structure
>2hy6_A General control protein GCN4; protein design, parallel heptamer, protein structure, biosyn protein; 1.25A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2nrn_A 3crp_A 2b1f_A 3crp_B 2ipz_A 3ck4_A 3ck4_B 2b22_A 1ce9_A Back     alignment and structure
>2j5u_A MREC protein; bacterial cell shape determining protein MREC, cell shape regulation; 2.5A {Listeria monocytogenes} Back     alignment and structure
>3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2wq1_A General control protein GCN4; TAA, nucleus, coiled coil, DNA-binding, protein export, ION coordination, polar core residues; 1.08A {Saccharomyces cerevisiae} PDB: 2wq0_A 2wq2_A 2wq3_A 2wpz_A 2wpy_A 1ij0_A 1ij1_A 1gcm_A 1rb5_A 1rb6_A 1rb1_A 1rb4_A 1swi_A 3k7z_A 1zii_A 1zij_A 1ij2_A 1ij3_A 1zil_A 1zim_A ... Back     alignment and structure
>4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>2bni_A General control protein GCN4; four helix bundle, antiparallel four helix bundle acyl transferase; HET: TYZ; 1.5A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2ccn_A 1w5k_A* 2ccf_A 2cce_A 1w5j_A* 1uo2_A 1gcl_A 1uo1_A 1unv_A 1uo0_A 1unt_A 1uo5_A 1unz_A 1unx_A 1unu_A 1unw_A 1uo4_A 1uo3_A 1uny_A 1u9f_A* ... Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>4emc_A Monopolin complex subunit CSM1; RWD domain, kinetochore-binding, kinetoch replication-replication complex; 3.05A {Saccharomyces cerevisiae} PDB: 3n7n_A 3n4x_A Back     alignment and structure
>2hy6_A General control protein GCN4; protein design, parallel heptamer, protein structure, biosyn protein; 1.25A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2nrn_A 3crp_A 2b1f_A 3crp_B 2ipz_A 3ck4_A 3ck4_B 2b22_A 1ce9_A Back     alignment and structure
>1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>2no2_A HIP-I, huntingtin-interacting protein 1; clathrin light chain binding, HIP1 coiled-coil domain, endocytosis, clathrin SELF-assembly, cell adhesion; 2.80A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query307
d1seta1110 Seryl-tRNA synthetase (SerRS) {Thermus thermophilu 86.81
d1uklc_61 SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} 81.37
d1lrza165 Methicillin resistance protein FemA probable tRNA- 80.43
>d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: tRNA-binding arm
family: Seryl-tRNA synthetase (SerRS)
domain: Seryl-tRNA synthetase (SerRS)
species: Thermus thermophilus, strain hb27 [TaxId: 274]

Probab=86.81  E-value=4.6  Score=29.85  Aligned_cols=70  Identities=14%  Similarity=0.138  Sum_probs=45.7

Q ss_pred             HHHHHHHHHHHHHHHHHHhHHHHHHHHHHHhhhhhhh-hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 021792          196 LQYIAELERTVEYFQTLQADLGARVALLLQQHVSLSM-ENSKLKQKIARVQKEKLIMEGQYQYLKKEAERL  265 (307)
Q Consensus       196 l~Yi~ELE~kVq~Lq~E~a~Ls~~l~~L~~~~~~L~~-EN~~LK~rl~~l~qq~~lkda~~E~L~~Ei~RL  265 (307)
                      +..|.+|..+...|+++...|.++...+..+-..+.. +..+|+.++..+..+..-.+.....+..++..+
T Consensus        27 ld~i~~ld~~rr~l~~~~e~l~~~rN~~sk~i~k~~~~~~~~l~~~~k~lk~~i~~le~~~~~~~~~l~~~   97 (110)
T d1seta1          27 LEALLALDREVQELKKRLQEVQTERNQVAKRVPKAPPEEKEALIARGKALGEEAKRLEEALREKEARLEAL   97 (110)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHGGGCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            5667777777777777777777777776665543332 345667777777666666666666666666444
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lrza1 a.2.7.4 (A:245-309) Methicillin resistance protein FemA probable tRNA-binding arm {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure