Citrus Sinensis ID: 021816


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------
MKWETEVISPASYISSSNWLLEESKSTRWTAAENKMFENALAVYDKDSPDRWQKVAAMIPGKTVVDVIKQYKELEADISNIEAGLIPLPGYGNSSPFTLEWVNNHGYDGFKHPYAVGGKRSSSVRPAEHERKKGVPWTEEEHKLFLLGLKKHGKGDWRNISRNFVTSRTPTQVASHAQKYFIRQLSGGKDKRRASIHDITTVNLNETRTSSPDTQRAPSPEQVTSGLSQQQPNCGGALSRTNFQWHQPNNGATTAFGSTQGNMFMTSPYGINSYGIKMPGQNLQRDAVHEPYFGLQNLAFQMQFPQG
ccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccEEEccccHHccccccEEcccccccccHHHHHHHHHHHHHccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccHHHHHHHHHHHHHHcccccHcccHccEEcccHHHHHHHHHHHHHHHHccccccccccHHcccEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccc
mkwetevispasyisssnwlleeskstRWTAAENKMFENALavydkdspdRWQKVAAMIPGKTVVDVIKQYKELEADISNIeagliplpgygnsspftLEWVnnhgydgfkhpyavggkrsssvrpaeherkkgvpwteEEHKLFLLGLkkhgkgdwrnisrnfvtsrtptqvASHAQKYFIRQLsggkdkrrasiHDITtvnlnetrtsspdtqrapspeqvtsglsqqqpncggalsrtnfqwhqpnngattafgstqgnmfmtspyginsygikmpgqnlqrdavhepyfglqNLAFQMQFPQG
mkwetevispasyisssnwllEESKSTRWTAAENKMFENALAVYDKDSPDRWQKVAAMIPGKTVVDVIKQYKELEADISNIEAGLIPLPGYGNSSPFTLEWVNNHGYDGFKHPYAVGGkrsssvrpaeherkkgvpwteeeHKLFLLglkkhgkgdwRNISRNfvtsrtptqvashAQKYFIRQlsggkdkrrasihdittvnlnetrtsspdtqraPSPEQVTSGLSQQQPNCGGALSRTNFQWHQPNNGATTAFGSTQGNMFMTSPYGINSYGIKMPGQNLQRDAVHEPYFGLQNLAFQMQFPQG
MKWETEVISPASYISSSNWLLEESKSTRWTAAENKMFENALAVYDKDSPDRWQKVAAMIPGKTVVDVIKQYKELEADISNIEAGLIPLPGYGNSSPFTLEWVNNHGYDGFKHPYAVGGKRSSSVRPAEHERKKGVPWTeeehklfllglkkhgkgDWRNISRNFVTSRTPTQVASHAQKYFIRQLSGGKDKRRASIHDITTVNLNETRTSSPDTQRAPSPEQVTSGLSQQQPNCGGALSRTNFQWHQPNNGATTAFGSTQGNMFMTSPYGINSYGIKMPGQNLQRDAVHEPYFGLQNLAFQMQFPQG
************YI**SNWLLE****TRWTAAENKMFENALAVYDKDSPDRWQKVAAMIPGKTVVDVIKQYKELEADISNIEAGLIPLPGYGNSSPFTLEWVNNHGYDGFKHPYAV********************WTEEEHKLFLLGLKKHGKGDWRNISRNFVTSRTPTQVASHAQKYFIRQL*********************************************************FQW********TAFGSTQGNMFMTSPYGINSYGIKMPGQNLQRDAVHEPYFGLQNLAFQ******
*********************************NKMFENALAVYDKDSPDRWQKVAAMIPGKTVVDVIKQYKELEADISNIEAGLIPLPGYGNSSPFTLEWVNNHGYDG****************************TEEEHKLFLLGLKKHGKGDWRNISRNFVTSRTPTQVASHAQKY*********************************************************************************************************************L**QMQ****
**********ASYISSSNWLLEESKSTRWTAAENKMFENALAVYDKDSPDRWQKVAAMIPGKTVVDVIKQYKELEADISNIEAGLIPLPGYGNSSPFTLEWVNNHGYDGFKHPYAVG*******************WTEEEHKLFLLGLKKHGKGDWRNISRNFVTSRTPTQVASHAQKYFIRQLSGGKDKRRASIHDITTVNLNE*****************************GALSRTNFQWHQPNNGATTAFGSTQGNMFMTSPYGINSYGIKMPGQNLQRDAVHEPYFGLQNLAFQMQFPQG
*KWETEVISPASYISSSNWLLEESKSTRWTAAENKMFENALAVYDKDSPDRWQKVAAMIPGKTVVDVIKQYKELEADISNIEAGLIPLPGYGNS*************************************KKGVPWTEEEHKLFLLGLKKHGKGDWRNISRNFVTSRTPTQVASHAQKYFIRQLS**********H****VNL***********************************************ATTAFGSTQGNMFMTSPYGINSYGIKMPGQNLQRDAVHEPYFGLQNLAFQMQ****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKWETEVISPASYISSSNWLLEESKSTRWTAAENKMFENALAVYDKDSPDRWQKVAAMIPGKTVVDVIKQYKELEADISNIEAGLIPLPGYGNSSPFTLEWVNNHGYDGFKHPYAVGGKRSSSVRPAEHERKKGVPWTEEEHKLFLLGLKKHGKGDWRNISRNFVTSRTPTQVASHAQKYFIRQLSGGKDKRRASIHDITTVNLNETRTSSPDTQRAPSPEQVTSGLSQQQPNCGGALSRTNFQWHQPNNGATTAFGSTQGNMFMTSPYGINSYGIKMPGQNLQRDAVHEPYFGLQNLAFQMQFPQG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query307 2.2.26 [Sep-21-2011]
Q8S9H7307 Transcription factor DIVA N/A no 0.957 0.957 0.639 1e-109
Q2V9B0297 Transcription factor MYB1 N/A no 0.234 0.242 0.75 3e-22
Q1A17397 Protein RADIALIS-like 6 O no no 0.205 0.649 0.587 2e-15
F4JVB8100 Protein RADIALIS-like 1 O no no 0.228 0.7 0.5 8e-14
Q869R9 734 Myb-like protein J OS=Dic yes no 0.211 0.088 0.544 1e-13
Q58FS393 Transcription factor RADI N/A no 0.205 0.677 0.555 2e-13
Q8GW75100 Protein RADIALIS-like 5 O no no 0.192 0.59 0.559 2e-12
Q9SIJ5101 Protein RADIALIS-like 2 O no no 0.218 0.663 0.492 2e-12
Q6NNN081 Protein RADIALIS-like 3 O no no 0.205 0.777 0.492 2e-12
Q1G3C477 Protein RADIALIS-like 4 O no no 0.205 0.818 0.476 8e-11
>sp|Q8S9H7|DIV_ANTMA Transcription factor DIVARICATA OS=Antirrhinum majus GN=DIVARICATA PE=2 SV=1 Back     alignment and function desciption
 Score =  394 bits (1012), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 193/302 (63%), Positives = 240/302 (79%), Gaps = 8/302 (2%)

Query: 6   EVISPASYISSSNWLLEESKST-RWTAAENKMFENALAVYDKDSPDRWQKVAAMIPGKTV 64
           E+++P+SY SSS+W LEES+ST RWTAAENK FENALAV+D+++P+RW++VA  +PGKTV
Sbjct: 2   EILAPSSYFSSSSWFLEESRSTTRWTAAENKAFENALAVFDENTPNRWERVAERVPGKTV 61

Query: 65  VDVIKQYKELEADISNIEAGLIPLPGYGNSSPFTLEWVNNHGYDGFKHPYAVGGKRSSSV 124
            DV++QYKELE D+S+IEAG +P+PGY  SSPFTLEW + HG+DGFK  Y  GG++SSS 
Sbjct: 62  GDVMRQYKELEDDVSSIEAGFVPVPGYSTSSPFTLEWGSGHGFDGFKQSYGTGGRKSSSG 121

Query: 125 RPAEHERKKGVPWTEEEHKLFLLGLKKHGKGDWRNISRNFVTSRTPTQVASHAQKYFIRQ 184
           RP+E ERKKGVPWTEEEHKLFL+GLKK+GKGDWRNISRNFV +RTPTQVASHAQKYFIRQ
Sbjct: 122 RPSEQERKKGVPWTEEEHKLFLMGLKKYGKGDWRNISRNFVITRTPTQVASHAQKYFIRQ 181

Query: 185 LSGGKDKRRASIHDITTVNLNETRTSSPDTQRAP-SPEQVTSGLSQQQPNCGGALSRTNF 243
           LSGGKDKRRASIHDITTVNL++ +T SPD ++ P SP+   +    QQ     ++ +  F
Sbjct: 182 LSGGKDKRRASIHDITTVNLSDNQTPSPDNKKPPSSPDHSMA----QQQTSSTSIHKLPF 237

Query: 244 QWHQPNNGATTAFGST--QGNMFMTSPYGINSYGIKMPGQNLQRDAVHEPYFGLQNLAFQ 301
           QW Q +N     F S+   GNMF ++P+G+NSYG KM GQ +QR    + Y G QN+AFQ
Sbjct: 238 QWDQTSNETIMGFASSGHHGNMFQSNPFGMNSYGFKMQGQQMQRGGFCDTYLGSQNMAFQ 297

Query: 302 MQ 303
           MQ
Sbjct: 298 MQ 299




Involved in the dorsovental asymmetry of flowers. Promotes ventral identity.
Antirrhinum majus (taxid: 4151)
>sp|Q2V9B0|MY1R1_SOLTU Transcription factor MYB1R1 OS=Solanum tuberosum PE=2 SV=1 Back     alignment and function description
>sp|Q1A173|RADL6_ARATH Protein RADIALIS-like 6 OS=Arabidopsis thaliana GN=RL6 PE=2 SV=1 Back     alignment and function description
>sp|F4JVB8|RADL1_ARATH Protein RADIALIS-like 1 OS=Arabidopsis thaliana GN=RL1 PE=2 SV=1 Back     alignment and function description
>sp|Q869R9|MYBJ_DICDI Myb-like protein J OS=Dictyostelium discoideum GN=mybJ PE=3 SV=1 Back     alignment and function description
>sp|Q58FS3|RAD_ANTMA Transcription factor RADIALIS OS=Antirrhinum majus GN=RAD PE=1 SV=1 Back     alignment and function description
>sp|Q8GW75|RADL5_ARATH Protein RADIALIS-like 5 OS=Arabidopsis thaliana GN=RL5 PE=3 SV=1 Back     alignment and function description
>sp|Q9SIJ5|RADL2_ARATH Protein RADIALIS-like 2 OS=Arabidopsis thaliana GN=RL2 PE=2 SV=1 Back     alignment and function description
>sp|Q6NNN0|RADL3_ARATH Protein RADIALIS-like 3 OS=Arabidopsis thaliana GN=RL3 PE=2 SV=1 Back     alignment and function description
>sp|Q1G3C4|RADL4_ARATH Protein RADIALIS-like 4 OS=Arabidopsis thaliana GN=RL4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query307
224106307308 predicted protein [Populus trichocarpa] 0.980 0.977 0.753 1e-130
225434676307 PREDICTED: uncharacterized protein LOC10 0.986 0.986 0.717 1e-128
255569255307 DNA binding protein, putative [Ricinus c 0.983 0.983 0.728 1e-127
224059326302 predicted protein [Populus trichocarpa] 0.964 0.980 0.731 1e-125
237664615304 DIV1A protein [Heptacodium miconioides] 0.951 0.960 0.685 1e-112
356566155321 PREDICTED: uncharacterized protein LOC10 0.973 0.931 0.656 1e-108
75330977307 RecName: Full=Transcription factor DIVAR 0.957 0.957 0.639 1e-107
449523595315 PREDICTED: transcription factor DIVARICA 0.986 0.961 0.630 1e-107
237664619318 DIV3B protein [Heptacodium miconioides] 0.970 0.937 0.625 1e-105
356539533323 PREDICTED: uncharacterized protein LOC77 0.970 0.922 0.654 1e-104
>gi|224106307|ref|XP_002314123.1| predicted protein [Populus trichocarpa] gi|222850531|gb|EEE88078.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  470 bits (1209), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 232/308 (75%), Positives = 260/308 (84%), Gaps = 7/308 (2%)

Query: 1   MKWETEVISPASYISSSNWLLEESKSTRWTAAENKMFENALAVYDKDSPDRWQKVAAMIP 60
           MKWETE++SP SY+SSSNWL EESK+T+WT AENK FENALA+YDK++ DRW KVAAMIP
Sbjct: 1   MKWETEILSPGSYLSSSNWLAEESKNTKWTIAENKAFENALAIYDKETSDRWHKVAAMIP 60

Query: 61  GKTVVDVIKQYKELEADISNIEAGLIPLPGYGNSSPFTLEWVNN--HGYDGFKHPYAVGG 118
           GKTV DVIKQYKELE D+S IEAGLIP+PGY +SSPFTL+WVN   +GYDGFK  Y +GG
Sbjct: 61  GKTVEDVIKQYKELELDVSYIEAGLIPVPGY-SSSPFTLDWVNGNGYGYDGFKQSYGLGG 119

Query: 119 KRSSSVRPAEHERKKGVPWTEEEHKLFLLGLKKHGKGDWRNISRNFVTSRTPTQVASHAQ 178
           KRSS+ RP + ERKKGVPWTEEEHKLFL+GLKK+GKGDWRNISRNFV SRTPTQVASHAQ
Sbjct: 120 KRSSTGRPTDQERKKGVPWTEEEHKLFLMGLKKYGKGDWRNISRNFVISRTPTQVASHAQ 179

Query: 179 KYFIRQLSGGKDKRRASIHDITTVNLNETRTSSPDTQRAPSPEQVTSGLSQQQPNCGGAL 238
           KYFIRQLSGGKDKRRASIHDITTVNLNETRT SPD +R  SP+Q  SG   QQPN   A+
Sbjct: 180 KYFIRQLSGGKDKRRASIHDITTVNLNETRTPSPDNKRT-SPDQ--SGAISQQPNS-AAM 235

Query: 239 SRTNFQWHQPNNGATTAFGSTQGNMFMTSPYGINSYGIKMPGQNLQRDAVHEPYFGLQNL 298
            RT+FQW+QPN+GAT AF ST  NMFM+SPYGINSYG+KM GQN  R AVH+ Y G Q +
Sbjct: 236 PRTHFQWNQPNSGATMAFNSTNANMFMSSPYGINSYGLKMQGQNPHRGAVHDSYIGQQTM 295

Query: 299 AFQMQFPQ 306
            FQMQ  Q
Sbjct: 296 GFQMQSAQ 303




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225434676|ref|XP_002280403.1| PREDICTED: uncharacterized protein LOC100244960 [Vitis vinifera] gi|147844863|emb|CAN81229.1| hypothetical protein VITISV_033664 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255569255|ref|XP_002525595.1| DNA binding protein, putative [Ricinus communis] gi|223535031|gb|EEF36713.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224059326|ref|XP_002299827.1| predicted protein [Populus trichocarpa] gi|222847085|gb|EEE84632.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|237664615|gb|ACR09746.1| DIV1A protein [Heptacodium miconioides] Back     alignment and taxonomy information
>gi|356566155|ref|XP_003551300.1| PREDICTED: uncharacterized protein LOC100784163 [Glycine max] Back     alignment and taxonomy information
>gi|75330977|sp|Q8S9H7.1|DIV_ANTMA RecName: Full=Transcription factor DIVARICATA gi|18874263|gb|AAL78741.1| MYB-like transcription factor DIVARICATA [Antirrhinum majus] Back     alignment and taxonomy information
>gi|449523595|ref|XP_004168809.1| PREDICTED: transcription factor DIVARICATA-like isoform 1 [Cucumis sativus] Back     alignment and taxonomy information
>gi|237664619|gb|ACR09748.1| DIV3B protein [Heptacodium miconioides] Back     alignment and taxonomy information
>gi|356539533|ref|XP_003538252.1| PREDICTED: uncharacterized protein LOC778181 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query307
UNIPROTKB|Q8S9H7307 DIVARICATA "Transcription fact 0.957 0.957 0.592 3.3e-95
TAIR|locus:2042872298 AT2G38090 [Arabidopsis thalian 0.905 0.932 0.516 4.8e-71
TAIR|locus:2154508288 AT5G58900 [Arabidopsis thalian 0.869 0.927 0.531 3.5e-68
TAIR|locus:2150149267 AT5G01200 [Arabidopsis thalian 0.713 0.820 0.510 3.5e-52
TAIR|locus:2166459277 AT5G05790 [Arabidopsis thalian 0.657 0.729 0.490 9.8e-48
TAIR|locus:2074723263 AT3G11280 [Arabidopsis thalian 0.599 0.699 0.545 1.6e-47
TAIR|locus:2159607298 AT5G08520 [Arabidopsis thalian 0.684 0.704 0.389 1.2e-33
TAIR|locus:2175478215 AT5G04760 [Arabidopsis thalian 0.622 0.888 0.378 1.4e-30
TAIR|locus:2171711337 AT5G23650 [Arabidopsis thalian 0.837 0.762 0.318 8.4e-26
TAIR|locus:2028461314 AT1G49010 [Arabidopsis thalian 0.654 0.640 0.374 3.4e-22
UNIPROTKB|Q8S9H7 DIVARICATA "Transcription factor DIVARICATA" [Antirrhinum majus (taxid:4151)] Back     alignment and assigned GO terms
 Score = 947 (338.4 bits), Expect = 3.3e-95, P = 3.3e-95
 Identities = 179/302 (59%), Positives = 226/302 (74%)

Query:     6 EVISPASYISSSNWLLEESKST-RWTAAENKMFENALAVYDKDSPDRWQKVAAMIPGKTV 64
             E+++P+SY SSS+W LEES+ST RWTAAENK FENALAV+D+++P+RW++VA  +PGKTV
Sbjct:     2 EILAPSSYFSSSSWFLEESRSTTRWTAAENKAFENALAVFDENTPNRWERVAERVPGKTV 61

Query:    65 VDVIKQYKELEADISNIEAGLIPLPGYGNSSPFTLEWVNNHGYDGFKHPYAVGGKRSSSV 124
              DV++QYKELE D+S+IEAG +P+PGY  SSPFTLEW + HG+DGFK  Y  GG++SSS 
Sbjct:    62 GDVMRQYKELEDDVSSIEAGFVPVPGYSTSSPFTLEWGSGHGFDGFKQSYGTGGRKSSSG 121

Query:   125 RPAEHERKKGVPWTXXXXXXXXXXXXXXXXXDWRNISRNFVTSRTPTQVASHAQKYFIRQ 184
             RP+E ERKKGVPWT                 DWRNISRNFV +RTPTQVASHAQKYFIRQ
Sbjct:   122 RPSEQERKKGVPWTEEEHKLFLMGLKKYGKGDWRNISRNFVITRTPTQVASHAQKYFIRQ 181

Query:   185 LSGGKDKRRASIHDITTVNLNETRTSSPDTQRAPS-PEQVTSGLSQQQPNCGGALSRTNF 243
             LSGGKDKRRASIHDITTVNL++ +T SPD ++ PS P+     ++QQQ +   ++ +  F
Sbjct:   182 LSGGKDKRRASIHDITTVNLSDNQTPSPDNKKPPSSPDH---SMAQQQTS-STSIHKLPF 237

Query:   244 QWHQPNNGATTAFGST--QGNMFMTSPYGINSYGIKMPGQNLQRDAVHEPYFGLQNLAFQ 301
             QW Q +N     F S+   GNMF ++P+G+NSYG KM GQ +QR    + Y G QN+AFQ
Sbjct:   238 QWDQTSNETIMGFASSGHHGNMFQSNPFGMNSYGFKMQGQQMQRGGFCDTYLGSQNMAFQ 297

Query:   302 MQ 303
             MQ
Sbjct:   298 MQ 299




GO:0009908 "flower development" evidence=IMP
GO:0048262 "determination of dorsal/ventral asymmetry" evidence=IMP
TAIR|locus:2042872 AT2G38090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154508 AT5G58900 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150149 AT5G01200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166459 AT5G05790 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074723 AT3G11280 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2159607 AT5G08520 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175478 AT5G04760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171711 AT5G23650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2028461 AT1G49010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8S9H7DIV_ANTMANo assigned EC number0.63900.95760.9576N/Ano

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query307
TIGR0155757 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domai 1e-14
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 2e-10
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 2e-10
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 4e-10
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 2e-06
cd1166050 cd11660, SANT_TRF, Telomere repeat binding factor- 3e-06
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 4e-06
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 3e-04
cd1166146 cd11661, SANT_MTA3_like, Myb-Like Dna-Binding Doma 5e-04
>gnl|CDD|130620 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
 Score = 67.0 bits (164), Expect = 1e-14
 Identities = 24/57 (42%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 132 KKGVPWTEEEHKLFLLGLKKHGKGDW---RNISRNFVTSR-TPTQVASHAQKYFIRQ 184
           K  V WTE+ H  FL  ++K G  DW   + I    V    T  QVASH QKY ++Q
Sbjct: 1   KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLKQ 57


This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif. Length = 57

>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|212558 cd11660, SANT_TRF, Telomere repeat binding factor-like DNA-binding domains of the SANT/myb-like family Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|212559 cd11661, SANT_MTA3_like, Myb-Like Dna-Binding Domain of MTA3 and related proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 307
PLN03212249 Transcription repressor MYB5; Provisional 99.86
PLN03091 459 hypothetical protein; Provisional 99.85
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.77
KOG0724335 consensus Zuotin and related molecular chaperones 99.55
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.53
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 99.53
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.44
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.42
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.23
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.2
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.13
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.1
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 98.99
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 98.93
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.88
PLN031421033 Probable chromatin-remodeling complex ATPase chain 98.84
PLN03212249 Transcription repressor MYB5; Provisional 98.83
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 98.73
KOG0051607 consensus RNA polymerase I termination factor, Myb 98.72
PLN03091 459 hypothetical protein; Provisional 98.59
KOG0048238 consensus Transcription factor, Myb superfamily [T 98.5
COG5147 512 REB1 Myb superfamily proteins, including transcrip 98.49
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 98.42
KOG0457438 consensus Histone acetyltransferase complex SAGA/A 97.67
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 97.67
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.65
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 97.61
KOG1279506 consensus Chromatin remodeling factor subunit and 97.34
KOG4167907 consensus Predicted DNA-binding protein, contains 97.32
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 97.32
KOG1194534 consensus Predicted DNA-binding protein, contains 97.18
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 97.17
KOG1279506 consensus Chromatin remodeling factor subunit and 97.16
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 97.06
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 96.56
KOG0051607 consensus RNA polymerase I termination factor, Myb 96.5
KOG0385971 consensus Chromatin remodeling complex WSTF-ISWI, 96.39
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 96.38
KOG4329445 consensus DNA-binding protein [General function pr 96.26
COG5114432 Histone acetyltransferase complex SAGA/ADA, subuni 95.96
COG5147 512 REB1 Myb superfamily proteins, including transcrip 95.73
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 95.62
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 95.0
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 94.43
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 94.32
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 94.03
KOG4329445 consensus DNA-binding protein [General function pr 92.39
PLN03162 526 golden-2 like transcription factor; Provisional 92.14
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 91.34
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 89.66
KOG4468 782 consensus Polycomb-group transcriptional regulator 88.7
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 88.44
KOG3554 693 consensus Histone deacetylase complex, MTA1 compon 88.19
KOG4167 907 consensus Predicted DNA-binding protein, contains 87.62
PRK13923170 putative spore coat protein regulator protein YlbO 87.62
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 87.47
KOG2656445 consensus DNA methyltransferase 1-associated prote 86.94
KOG1878 1672 consensus Nuclear receptor coregulator SMRT/SMRTER 85.91
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 85.83
KOG4468 782 consensus Polycomb-group transcriptional regulator 84.13
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 83.02
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 82.93
KOG3554 693 consensus Histone deacetylase complex, MTA1 compon 82.77
PLN031421033 Probable chromatin-remodeling complex ATPase chain 81.19
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
Probab=99.86  E-value=1.1e-21  Score=180.91  Aligned_cols=111  Identities=16%  Similarity=0.230  Sum_probs=96.0

Q ss_pred             CCcccCCCccccCCCCCCCCCHHHHHHHHHHHHHhCCCCChhHHHHHhhC-CCCCHHHHHHHHHHHHHhhhhhhhcCCCC
Q 021816           10 PASYISSSNWLLEESKSTRWTAAENKMFENALAVYDKDSPDRWQKVAAMI-PGKTVVDVIKQYKELEADISNIEAGLIPL   88 (307)
Q Consensus        10 p~~~~~~~~w~~~~~~~~~WT~EEdk~Le~Ala~y~~~tpdRW~kIAa~v-PGRT~~qc~~rY~~L~~dV~~IEsG~v~~   88 (307)
                      |||+.       ..-.++.||+|||++|.++|++|+..   +|..||..+ ++||.+||++||...+.            
T Consensus        16 pcc~K-------~glKRg~WT~EEDe~L~~lV~kyG~~---nW~~IAk~~g~gRT~KQCReRW~N~L~------------   73 (249)
T PLN03212         16 PCCTK-------MGMKRGPWTVEEDEILVSFIKKEGEG---RWRSLPKRAGLLRCGKSCRLRWMNYLR------------   73 (249)
T ss_pred             CCccc-------CCCcCCCCCHHHHHHHHHHHHHhCcc---cHHHHHHhhhcCCCcchHHHHHHHhhc------------
Confidence            66665       23357789999999999999999965   599999988 59999999999998876            


Q ss_pred             CCCCCCCCcchhhhccCCCCCCCCccccCCCCCCCCCcccccccCCCCCCHHHHHHHHHHHHHhCCCchhcchhcccCCC
Q 021816           89 PGYGNSSPFTLEWVNNHGYDGFKHPYAVGGKRSSSVRPAEHERKKGVPWTEEEHKLFLLGLKKHGKGDWRNISRNFVTSR  168 (307)
Q Consensus        89 P~y~~~s~f~l~~~~~~~~dg~k~~~~~ggkr~~~~rs~~~erkKg~pWT~EEd~llL~~l~kyG~G~W~~Ia~~~v~tR  168 (307)
                      |.+.                                         ..+||+|||++||+++.+||. +|..||+ +|++|
T Consensus        74 P~I~-----------------------------------------kgpWT~EED~lLlel~~~~Gn-KWs~IAk-~LpGR  110 (249)
T PLN03212         74 PSVK-----------------------------------------RGGITSDEEDLILRLHRLLGN-RWSLIAG-RIPGR  110 (249)
T ss_pred             hhcc-----------------------------------------cCCCChHHHHHHHHHHHhccc-cHHHHHh-hcCCC
Confidence            4432                                         248999999999999999998 9999997 99999


Q ss_pred             CHHHHHHHHHHHHHHHh
Q 021816          169 TPTQVASHAQKYFIRQL  185 (307)
Q Consensus       169 T~~Qv~sh~qky~~r~~  185 (307)
                      |+.||++||..++++..
T Consensus       111 TDnqIKNRWns~LrK~l  127 (249)
T PLN03212        111 TDNEIKNYWNTHLRKKL  127 (249)
T ss_pred             CHHHHHHHHHHHHhHHH
Confidence            99999999998877654



>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>KOG4329 consensus DNA-binding protein [General function prediction only] Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>KOG4329 consensus DNA-binding protein [General function prediction only] Back     alignment and domain information
>PLN03162 golden-2 like transcription factor; Provisional Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1878 consensus Nuclear receptor coregulator SMRT/SMRTER, contains Myb-like domains [Transcription] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query307
2cjj_A93 Crystal Structure Of The Myb Domain Of The Rad Tran 1e-14
2m2e_A73 Solution Nmr Structure Of The Sant Domain Of Human 1e-07
4eef_G74 Crystal Structure Of The Designed Inhibitor Protein 1e-05
>pdb|2CJJ|A Chain A, Crystal Structure Of The Myb Domain Of The Rad Transcription Factor From Antirrhinum Majus Length = 93 Back     alignment and structure

Iteration: 1

Score = 76.6 bits (187), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 35/63 (55%), Positives = 43/63 (68%) Query: 29 WTAAENKMFENALAVYDKDSPDRWQKVAAMIPGKTVVDVIKQYKELEADISNIEAGLIPL 88 W+A ENK FE ALAVYDKD+PDRW VA + G+T +V K Y+ L DI IE+G +P Sbjct: 11 WSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIESGKVPF 70 Query: 89 PGY 91 P Y Sbjct: 71 PNY 73
>pdb|2M2E|A Chain A, Solution Nmr Structure Of The Sant Domain Of Human Dnajc2, Northeast Structural Genomics Consortium Target Hr8254a Length = 73 Back     alignment and structure
>pdb|4EEF|G Chain G, Crystal Structure Of The Designed Inhibitor Protein F-Hb80.4 In Complex With The 1918 Influenza Virus Hemagglutinin. Length = 74 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query307
2cjj_A93 Radialis; plant development, DNA-binding protein, 3e-32
2cjj_A93 Radialis; plant development, DNA-binding protein, 4e-04
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 2e-25
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 3e-06
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 7e-25
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 2e-04
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 2e-21
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 5e-07
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 3e-19
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 2e-06
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 5e-15
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 2e-14
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 4e-13
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 6e-07
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 3e-12
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 4e-07
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 5e-11
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 8e-11
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 5e-10
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 4e-04
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 2e-09
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 2e-09
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 6e-08
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 1e-06
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 2e-07
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 3e-07
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 5e-07
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 7e-07
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 2e-06
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 3e-06
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 1e-05
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 6e-04
2crg_A70 Metastasis associated protein MTA3; transcription 2e-04
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 3e-04
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 4e-04
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 6e-04
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 7e-04
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 9e-04
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Length = 93 Back     alignment and structure
 Score =  114 bits (286), Expect = 3e-32
 Identities = 35/83 (42%), Positives = 47/83 (56%), Gaps = 1/83 (1%)

Query: 22  EESKSTRWTAAENKMFENALAVYDKDSPDRWQKVAAMIPGKTVVDVIKQYKELEADISNI 81
                  W+A ENK FE ALAVYDKD+PDRW  VA  + G+T  +V K Y+ L  DI  I
Sbjct: 4   TRGSGRPWSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYI 63

Query: 82  EAGLIPLPGYGNSSPFTLEWVNN 104
           E+G +P P Y  ++   ++    
Sbjct: 64  ESGKVPFPNY-RTTGGNMKTDEK 85


>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Length = 93 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Length = 74 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Length = 74 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Length = 70 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Length = 64 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query307
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.92
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.92
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.91
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.9
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.9
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.87
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.86
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.79
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 99.79
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.68
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 99.63
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.63
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.62
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 99.59
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 99.58
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 99.51
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.5
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.5
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.49
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.47
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.45
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.44
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.43
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.43
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.42
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.41
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.4
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.39
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.35
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.33
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.33
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.31
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.29
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.29
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.28
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.28
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.94
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.26
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.26
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.25
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.24
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.24
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.23
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.23
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.19
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.18
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.18
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.16
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.16
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.16
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.15
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 99.11
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.11
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 99.11
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.1
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.09
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.07
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.06
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.05
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.05
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.04
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.01
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.93
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.92
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.9
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 98.88
2crg_A70 Metastasis associated protein MTA3; transcription 98.82
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.8
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.29
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 98.8
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 98.71
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.71
2crg_A70 Metastasis associated protein MTA3; transcription 98.68
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 98.62
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 98.57
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.51
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.5
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 98.47
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 98.41
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 97.89
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.85
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 97.82
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.75
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.74
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 97.65
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 97.53
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 97.47
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 96.51
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 96.16
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 96.91
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 96.61
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 96.51
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 95.93
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 95.84
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 95.02
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 94.15
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 89.25
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
Probab=99.92  E-value=5.9e-25  Score=178.21  Aligned_cols=102  Identities=16%  Similarity=0.392  Sum_probs=91.1

Q ss_pred             CCCCHHHHHHHHHHHHHhCCCCChhHHHHHhhCCCCCHHHHHHHHHHHHHhhhhhhhcCCCCCCCCCCCCcchhhhccCC
Q 021816           27 TRWTAAENKMFENALAVYDKDSPDRWQKVAAMIPGKTVVDVIKQYKELEADISNIEAGLIPLPGYGNSSPFTLEWVNNHG  106 (307)
Q Consensus        27 ~~WT~EEdk~Le~Ala~y~~~tpdRW~kIAa~vPGRT~~qc~~rY~~L~~dV~~IEsG~v~~P~y~~~s~f~l~~~~~~~  106 (307)
                      +.||+|||.+|..+|..|+..   +|..||..|||||..||++||..+++            |.+               
T Consensus         2 ~~Wt~eED~~L~~~v~~~g~~---~W~~Ia~~~~~Rt~~qcr~Rw~~~L~------------p~i---------------   51 (107)
T 2k9n_A            2 VKFTEEEDLKLQQLVMRYGAK---DWIRISQLMITRNPRQCRERWNNYIN------------PAL---------------   51 (107)
T ss_dssp             CSSCHHHHHHHHHHHHHHCSS---CHHHHHHHTTTSCHHHHHHHHHHHSS------------SCC---------------
T ss_pred             CCCCHHHHHHHHHHHHHHCCC---CHHHHhhhcCCCCHHHHHHHHHHHHc------------ccc---------------
Confidence            579999999999999999964   59999999999999999999998765            332               


Q ss_pred             CCCCCCccccCCCCCCCCCcccccccCCCCCCHHHHHHHHHHHHHhCCCchhcchhcccCCCCHHHHHHHHHHHHHHHhc
Q 021816          107 YDGFKHPYAVGGKRSSSVRPAEHERKKGVPWTEEEHKLFLLGLKKHGKGDWRNISRNFVTSRTPTQVASHAQKYFIRQLS  186 (307)
Q Consensus       107 ~dg~k~~~~~ggkr~~~~rs~~~erkKg~pWT~EEd~llL~~l~kyG~G~W~~Ia~~~v~tRT~~Qv~sh~qky~~r~~s  186 (307)
                                                +.++||+|||.+|+.++.+||. +|..||+ +|++||+.||++||..+.++...
T Consensus        52 --------------------------~~~~WT~eEd~~L~~~~~~~G~-~W~~Ia~-~l~gRt~~~~k~rw~~l~r~~~~  103 (107)
T 2k9n_A           52 --------------------------RTDPWSPEEDMLLDQKYAEYGP-KWNKISK-FLKNRSDNNIRNRWMMIARHRAK  103 (107)
T ss_dssp             --------------------------TTCCCCHHHHHHHHHHHHHTCS-CHHHHHH-HHSSSCHHHHHHHHHHHHHHHHS
T ss_pred             --------------------------cccccCHHHHHHHHHHHHHhCc-CHHHHHH-HCCCCCHHHHHHHHHHHHhhHHH
Confidence                                      1248999999999999999998 9999997 99999999999999988877653



>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 307
d2cqqa159 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 3e-20
d2cqqa159 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 2e-05
d1irza_64 a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis th 2e-16
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 9e-15
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 3e-07
d2crga157 a.4.1.3 (A:8-64) Metastasis associated protein MTA 2e-14
d2crga157 a.4.1.3 (A:8-64) Metastasis associated protein MTA 2e-04
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 5e-10
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 9e-06
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 3e-09
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 1e-08
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 1e-08
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 1e-05
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 3e-08
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 2e-06
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 9e-06
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 8e-05
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 5e-04
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: DnaJ homolog subfamily C member 1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 80.6 bits (199), Expect = 3e-20
 Identities = 14/61 (22%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 26 STRWTAAENKMFENALAVYDKDSPDRWQKVAAMIPGKTVVDVIKQYKELEADISNIEAGL 85
          +  WT  +      ++  +   +P RW+K+A  + G++V DV  + K+L+  ++    G+
Sbjct: 1  APEWTEEDLSQLTRSMVKFPGGTPGRWEKIAHEL-GRSVTDVTTKAKQLKDSVTC-SPGM 58

Query: 86 I 86
          +
Sbjct: 59 V 59


>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query307
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.78
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.61
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.57
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.54
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.49
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.47
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.46
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.45
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.36
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.36
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.36
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.32
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.3
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.29
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.29
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.28
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 99.27
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.24
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.24
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.2
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.16
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.12
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.08
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.07
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.06
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.06
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 99.05
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.05
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 98.98
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.9
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.67
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.59
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.54
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 98.17
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 97.96
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 97.17
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 97.11
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 96.95
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 96.25
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 95.56
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 94.36
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 93.47
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 91.25
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 90.44
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: Radialis
species: Garden snapdragon (Antirrhinum majus) [TaxId: 4151]
Probab=99.78  E-value=2.1e-19  Score=131.60  Aligned_cols=63  Identities=52%  Similarity=0.894  Sum_probs=60.1

Q ss_pred             CCCCCHHHHHHHHHHHHHhCCCCChhHHHHHhhCCCCCHHHHHHHHHHHHHhhhhhhhcCCCC
Q 021816           26 STRWTAAENKMFENALAVYDKDSPDRWQKVAAMIPGKTVVDVIKQYKELEADISNIEAGLIPL   88 (307)
Q Consensus        26 ~~~WT~EEdk~Le~Ala~y~~~tpdRW~kIAa~vPGRT~~qc~~rY~~L~~dV~~IEsG~v~~   88 (307)
                      +.+||+|||++|++||+.|+.+.+++|.+||.+|||||+.||++||+.|.+||+.||+|.||+
T Consensus         1 G~~WT~eEd~~L~~~v~~~~~~~~~~W~~Ia~~l~gRt~~qc~~r~~~L~~dik~iesg~vpf   63 (63)
T d2cjja1           1 GRPWSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIESGKVPF   63 (63)
T ss_dssp             CCSCCHHHHHHHHHHHHHSCTTCTTHHHHHHHHSTTCCHHHHHHHHHHHHHHHHHHHHSSCCC
T ss_pred             CcCCCHHHHHHHHHHHHHHCCCCchHHHHHHHHcCCCCHHHHHHHHHHHHHHhhccccCCCCC
Confidence            467999999999999999999999999999999999999999999999999999999998874



>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure