Citrus Sinensis ID: 021827
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 307 | ||||||
| 224131776 | 474 | predicted protein [Populus trichocarpa] | 0.814 | 0.527 | 0.390 | 2e-32 | |
| 255565717 | 485 | Protein phosphatase 1 regulatory subunit | 0.840 | 0.531 | 0.407 | 7e-27 | |
| 359479546 | 446 | PREDICTED: protein phosphatase 1 regulat | 0.729 | 0.502 | 0.365 | 4e-25 | |
| 147772156 | 560 | hypothetical protein VITISV_001509 [Viti | 0.729 | 0.4 | 0.365 | 2e-24 | |
| 449443646 | 478 | PREDICTED: leucine-rich repeat-containin | 0.879 | 0.564 | 0.321 | 2e-20 | |
| 449462407 | 479 | PREDICTED: LOW QUALITY PROTEIN: uncharac | 0.872 | 0.559 | 0.295 | 1e-17 | |
| 359806683 | 472 | uncharacterized protein LOC100782829 [Gl | 0.732 | 0.476 | 0.326 | 5e-16 | |
| 357453175 | 468 | Protein phosphatase 1 regulatory subunit | 0.778 | 0.510 | 0.317 | 2e-15 | |
| 356543614 | 471 | PREDICTED: protein phosphatase 1 regulat | 0.762 | 0.496 | 0.344 | 3e-15 | |
| 388511123 | 474 | unknown [Lotus japonicus] | 0.778 | 0.504 | 0.340 | 4e-15 |
| >gi|224131776|ref|XP_002328105.1| predicted protein [Populus trichocarpa] gi|222837620|gb|EEE75985.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 145 bits (366), Expect = 2e-32, Method: Compositional matrix adjust.
Identities = 107/274 (39%), Positives = 157/274 (57%), Gaps = 24/274 (8%)
Query: 39 SYFFNLNNLNLQGNPVAEYDKLAKKVKTLLPNLCIFNARPIDRITKNEKDNIVDKVNDSS 98
S +L NLNL GNP+AE K+ KKV+ LPNL IFNARP+D+ +NE I + +DSS
Sbjct: 220 SSLVDLKNLNLLGNPIAENAKITKKVQKFLPNLHIFNARPVDKSARNE---ISGRADDSS 276
Query: 99 NNSDDTIKVRMGKKRGGTRETNDKLSNEEIQWSKSDSA---AGKKLKKKSKEKEGELDAI 155
+ + KK+ TR+ N + + D+A A K L++K K+ +G++ +
Sbjct: 277 LIPTNELDYHSEKKKDHTRDVNSSKHVTDQRRDHFDNASDDAEKDLRQKRKKTKGKVSKM 336
Query: 156 DDAKNSGGVVPGQNKDANLNGSGDVEMEKDLKRKGRKTSENLSNKGIQVHDDDKRFRKKQ 215
++A KD D +EK LKRK + E L N ++H+DD+ +K+
Sbjct: 337 EEAST-------DEKD-------DAVIEKKLKRK-KPHEELLKNNDDKIHNDDRTKVEKK 381
Query: 216 KKRSKEKQ--GELDIIDNGETAFSELFSANIAGNPGFDGDNNMVNEASKFNSVDGLVTSS 273
K K ++ ELDIIDNGE +F++LFS + N + ++ V++ S N + GL+ S
Sbjct: 382 LKSKKSRKELSELDIIDNGEVSFADLFSVDAVENLKHNSESKTVDK-SGINVLGGLLVVS 440
Query: 274 GKKKKSKNRGMGLTVQLSQEPEVGLGGPSTWGDE 307
KKKK+KN+G+ TV LS EVG+GGPSTWGDE
Sbjct: 441 AKKKKTKNQGLVSTVPLSPAVEVGMGGPSTWGDE 474
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255565717|ref|XP_002523848.1| Protein phosphatase 1 regulatory subunit SDS22, putative [Ricinus communis] gi|223536936|gb|EEF38574.1| Protein phosphatase 1 regulatory subunit SDS22, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359479546|ref|XP_002273076.2| PREDICTED: protein phosphatase 1 regulatory subunit 7-like [Vitis vinifera] gi|296084874|emb|CBI28283.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147772156|emb|CAN69048.1| hypothetical protein VITISV_001509 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449443646|ref|XP_004139588.1| PREDICTED: leucine-rich repeat-containing protein 9-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449462407|ref|XP_004148932.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101214183 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|359806683|ref|NP_001241543.1| uncharacterized protein LOC100782829 [Glycine max] gi|255641324|gb|ACU20939.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357453175|ref|XP_003596864.1| Protein phosphatase 1 regulatory subunit [Medicago truncatula] gi|355485912|gb|AES67115.1| Protein phosphatase 1 regulatory subunit [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356543614|ref|XP_003540255.1| PREDICTED: protein phosphatase 1 regulatory subunit 7-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388511123|gb|AFK43623.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 307 | ||||||
| TAIR|locus:2176397 | 452 | AT5G22320 [Arabidopsis thalian | 0.114 | 0.077 | 0.685 | 1.5e-18 |
| TAIR|locus:2176397 AT5G22320 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 126 (49.4 bits), Expect = 1.5e-18, Sum P(3) = 1.5e-18
Identities = 24/35 (68%), Positives = 33/35 (94%)
Query: 1 MDDVTSVVSLRALILNDNEIVSICKLDQMKELNTL 35
M++++S+V+LRALILNDNEI SICKLD +K+LN+L
Sbjct: 100 MNEISSLVNLRALILNDNEISSICKLDLLKDLNSL 134
|
|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.00660138 | hypothetical protein (475 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| eugene3.29890001 | • | 0.460 | |||||||||
| gw1.298.28.1 | • | 0.456 | |||||||||
| fgenesh4_pg.C_LG_XVI001182 | • | 0.443 | |||||||||
| eugene3.01970033 | • | 0.442 | |||||||||
| eugene3.00150629 | • | 0.427 | |||||||||
| eugene3.00410224 | • | 0.425 | |||||||||
| gw1.V.1354.1 | • | 0.423 | |||||||||
| fgenesh4_pg.C_scaffold_18994000001 | • | 0.418 | |||||||||
| fgenesh4_pg.C_scaffold_184000015 | • | 0.418 | |||||||||
| fgenesh4_pg.C_scaffold_166000065 | • | 0.418 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 307 | |||
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 99.72 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 99.29 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 98.79 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.54 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.42 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.29 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.17 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 98.16 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 98.15 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 98.01 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 97.88 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 97.68 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.41 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.41 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 97.24 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 97.23 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 97.2 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.19 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.02 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 96.95 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 96.87 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 96.82 | |
| smart00365 | 26 | LRR_SD22 Leucine-rich repeat, SDS22-like subfamily | 96.81 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 96.79 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 96.65 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 96.48 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 96.41 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 96.41 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 96.4 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 96.31 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 95.92 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 95.91 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 95.89 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 95.89 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 95.85 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 95.81 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 95.78 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 95.78 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 95.7 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 95.68 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 95.64 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 95.54 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 95.29 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 95.13 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 95.06 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 94.98 | |
| smart00446 | 26 | LRRcap occurring C-terminal to leucine-rich repeat | 94.82 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 94.15 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 94.14 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 94.14 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 94.09 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 93.56 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 93.42 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 93.18 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 92.68 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 92.61 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 92.52 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 92.3 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 91.75 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 89.46 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 88.69 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 86.87 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 86.7 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 86.46 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 86.45 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 86.02 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 85.98 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 85.22 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 84.8 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 82.91 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 81.2 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 81.2 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 81.03 |
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
Probab=99.72 E-value=4.3e-18 Score=149.19 Aligned_cols=90 Identities=24% Similarity=0.412 Sum_probs=48.3
Q ss_pred Ccccc-ccccCCeeeccCcccccccCCCCCCCCCeEeccc-------------------------------------CCC
Q 021827 1 MDDVT-SVVSLRALILNDNEIVSICKLDQMKELNTLGMDS-------------------------------------YFF 42 (307)
Q Consensus 1 IDeL~-~L~nL~aL~LS~N~IssIegLe~L~nL~TLdLS~-------------------------------------~L~ 42 (307)
|+++. .|.+|+.|+||+|+|++|++|+.|+.|++|+|++ .|+
T Consensus 34 Ie~L~~~l~~L~~L~Ls~N~I~~l~~l~~L~~L~~L~L~~N~I~~i~~~l~~~lp~L~~L~L~~N~I~~l~~l~~L~~l~ 113 (175)
T PF14580_consen 34 IENLGATLDKLEVLDLSNNQITKLEGLPGLPRLKTLDLSNNRISSISEGLDKNLPNLQELYLSNNKISDLNELEPLSSLP 113 (175)
T ss_dssp --S--TT-TT--EEE-TTS--S--TT----TT--EEE--SS---S-CHHHHHH-TT--EEE-TTS---SCCCCGGGGG-T
T ss_pred ccchhhhhcCCCEEECCCCCCccccCccChhhhhhcccCCCCCCccccchHHhCCcCCEEECcCCcCCChHHhHHHHcCC
Confidence 34555 4566777777777777777777777777777664 789
Q ss_pred CCceEEccCCCccCccchHHHHHHhCCCCceecCcccChhhhhhhccc
Q 021827 43 NLNNLNLQGNPVAEYDKLAKKVKTLLPNLCIFNARPIDRITKNEKDNI 90 (307)
Q Consensus 43 nLrtLnLeGNPIak~e~YrrKI~a~LP~L~yLDarpV~e~tRe~a~~r 90 (307)
+|++|+|.||||++.+.||.+|+..||+|++||+.+|.+++|.+|...
T Consensus 114 ~L~~L~L~~NPv~~~~~YR~~vi~~lP~Lk~LD~~~V~~~ER~~A~~~ 161 (175)
T PF14580_consen 114 KLRVLSLEGNPVCEKKNYRLFVIYKLPSLKVLDGQDVTEEERQEAEKL 161 (175)
T ss_dssp T--EEE-TT-GGGGSTTHHHHHHHH-TT-SEETTEETTS-B-------
T ss_pred CcceeeccCCcccchhhHHHHHHHHcChhheeCCEEccHHHhcccccc
Confidence 999999999999999999999999999999999999999999998543
|
|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >smart00446 LRRcap occurring C-terminal to leucine-rich repeats | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 307 | |||
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 3e-07 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 5e-05 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 2e-04 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 3e-04 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 5e-04 |
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
Score = 50.5 bits (120), Expect = 3e-07
Identities = 15/76 (19%), Positives = 32/76 (42%), Gaps = 13/76 (17%)
Query: 9 SLRALILNDNEIVSICKLDQMKELNTLGMD-------------SYFFNLNNLNLQGNPVA 55
L L +DN + ++ + + L L + L LNLQGN +
Sbjct: 487 CLEVLQASDNALENVDGVANLPRLQELLLCNNRLQQSAAIQPLVSCPRLVLLNLQGNSLC 546
Query: 56 EYDKLAKKVKTLLPNL 71
+ + + +++ +LP++
Sbjct: 547 QEEGIQERLAEMLPSV 562
|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 307 | |||
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 99.27 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.23 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.08 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.01 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.0 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.82 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.75 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.73 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 98.69 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 98.63 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.61 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.59 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.55 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.54 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.53 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 98.51 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.5 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.5 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 98.5 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 98.5 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.49 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.48 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.48 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.46 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 98.46 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.45 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.44 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.44 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.44 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 98.43 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.41 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.41 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.4 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.4 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.4 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.39 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.38 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.37 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.37 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.35 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.34 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.33 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.33 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.32 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.31 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.3 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.3 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 98.28 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 98.28 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 98.27 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.26 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.26 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.26 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.25 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.25 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.24 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.23 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.23 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.23 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.22 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.21 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.2 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.19 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.19 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.19 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.17 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.15 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.14 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.13 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.13 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.13 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.12 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.11 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.11 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.1 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.09 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.09 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.09 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.08 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.08 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.07 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.07 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.06 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.06 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.06 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.06 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.04 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.02 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.02 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.02 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.02 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 98.01 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.01 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.01 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.0 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 97.99 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 97.99 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 97.99 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 97.96 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 97.95 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 97.92 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 97.92 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 97.91 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 97.9 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.9 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 97.89 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 97.88 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 97.87 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 97.87 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 97.85 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 97.84 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 97.82 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 97.82 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 97.81 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 97.81 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 97.8 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 97.8 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 97.79 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 97.78 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.71 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 97.69 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 97.69 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.65 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 97.64 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 97.55 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 97.53 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.48 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 97.48 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.47 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 97.47 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 97.45 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 97.41 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 97.41 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 97.39 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 97.36 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 97.35 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 97.34 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.33 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 97.32 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 97.31 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 97.1 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 97.03 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 97.01 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 96.95 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 96.87 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 96.85 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 96.74 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 96.71 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 96.53 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 96.51 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 95.65 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 95.09 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 95.06 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 94.07 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 92.65 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 91.85 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 89.63 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 89.14 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 88.2 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 86.5 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 84.66 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 84.04 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 82.73 |
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
Probab=99.27 E-value=3e-12 Score=116.46 Aligned_cols=78 Identities=17% Similarity=0.320 Sum_probs=69.6
Q ss_pred cccccCCeeeccCcccccccCCC----CCCCCCeEeccc----------CCC--CCceEEccCCCccC----ccchHHHH
Q 021827 5 TSVVSLRALILNDNEIVSICKLD----QMKELNTLGMDS----------YFF--NLNNLNLQGNPVAE----YDKLAKKV 64 (307)
Q Consensus 5 ~~L~nL~aL~LS~N~IssIegLe----~L~nL~TLdLS~----------~L~--nLrtLnLeGNPIak----~e~YrrKI 64 (307)
..|++|++|+|++|+|+.|.+|+ .|++|++|+||+ .|. +|+.|+|.||||+. .+.|+..+
T Consensus 167 ~~l~~L~~L~Ls~N~l~~l~~l~~~~~~l~~L~~L~Ls~N~i~~~~~l~~l~~l~L~~L~L~~Npl~~~~~~~~~y~~~i 246 (267)
T 3rw6_A 167 ENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAI 246 (267)
T ss_dssp HHCTTCCEEECTTSCCCCCGGGTTHHHHSTTCCEEECTTSCCCSGGGGGGGTTSCCSEEECTTSTTGGGCSSHHHHHHHH
T ss_pred hhCCCCCEEECCCCCCCCCccchhHHhhCCCCCEEECCCCccCCchhhhhcccCCcceEEccCCcCccccCcchhHHHHH
Confidence 45889999999999999999877 799999999997 333 89999999999986 46899999
Q ss_pred HHhCCCCceecCcccChh
Q 021827 65 KTLLPNLCIFNARPIDRI 82 (307)
Q Consensus 65 ~a~LP~L~yLDarpV~e~ 82 (307)
+..||+|++||+.+|.+.
T Consensus 247 l~~~P~L~~LDg~~v~p~ 264 (267)
T 3rw6_A 247 RERFPKLLRLDGHELPPP 264 (267)
T ss_dssp HHHCTTCCEESSCBCCCC
T ss_pred HHHCcccCeECCcCCCCC
Confidence 999999999999998753
|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 307 | ||||
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 0.001 |
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain domain: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 36.2 bits (83), Expect = 0.001
Identities = 12/59 (20%), Positives = 27/59 (45%), Gaps = 9/59 (15%)
Query: 13 LILNDNEIVSICKLDQMKELNTLGMDSYFFNLNNLNLQGNPVAEYDKLAKKVKTLLPNL 71
L+L +N + + + L LNLQGN + + + + +++ +LP++
Sbjct: 70 LLLCNNRLQQSAAIQPLVSCP---------RLVLLNLQGNSLCQEEGIQERLAEMLPSV 119
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 307 | |||
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.65 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.44 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 99.29 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.29 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.9 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.68 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.63 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.62 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.46 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.45 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.43 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.41 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.39 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.38 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 98.38 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 98.28 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.26 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.24 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.16 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.15 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 98.12 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.11 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 97.79 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.79 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 97.7 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.68 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 97.66 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.6 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 97.48 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 97.44 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 97.35 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 97.32 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 97.27 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 97.2 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 96.93 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 96.8 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 96.79 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 96.7 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 96.2 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 96.08 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 95.08 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 94.06 |
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: U2A'-like domain: Splicesomal U2A' protein species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.65 E-value=1.5e-16 Score=130.02 Aligned_cols=83 Identities=19% Similarity=0.281 Sum_probs=75.6
Q ss_pred cccccCCeeeccCcccccccCCCCCCCCCeEeccc-------------------------------------CCCCCceE
Q 021827 5 TSVVSLRALILNDNEIVSICKLDQMKELNTLGMDS-------------------------------------YFFNLNNL 47 (307)
Q Consensus 5 ~~L~nL~aL~LS~N~IssIegLe~L~nL~TLdLS~-------------------------------------~L~nLrtL 47 (307)
..|.+|+.|+|++|+|++|++++.|++|++|+|++ .|++|++|
T Consensus 38 ~~l~~L~~L~Ls~N~i~~l~~~~~l~~L~~L~ls~N~i~~l~~~~~~~l~~L~~L~L~~N~i~~~~~l~~l~~l~~L~~L 117 (162)
T d1a9na_ 38 ATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPDLTELILTNNSLVELGDLDPLASLKSLTYL 117 (162)
T ss_dssp GGTTCCSEEECCSSCCCEECCCCCCSSCCEEECCSSCCCEECSCHHHHCTTCCEEECCSCCCCCGGGGGGGGGCTTCCEE
T ss_pred cccccCCEEECCCCCCCccCCcccCcchhhhhcccccccCCCccccccccccccceeccccccccccccccccccccchh
Confidence 45678888888888888888888888888888885 67999999
Q ss_pred EccCCCccCccchHHHHHHhCCCCceecCcccChhhhhhh
Q 021827 48 NLQGNPVAEYDKLAKKVKTLLPNLCIFNARPIDRITKNEK 87 (307)
Q Consensus 48 nLeGNPIak~e~YrrKI~a~LP~L~yLDarpV~e~tRe~a 87 (307)
+|.||||+..+.|+.++...||+|++||+.+|.+.+|.+|
T Consensus 118 ~l~~N~i~~~~~~r~~~i~~lp~L~~LD~~~i~~~er~~A 157 (162)
T d1a9na_ 118 CILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEA 157 (162)
T ss_dssp ECCSSGGGGSTTHHHHHHHHCTTCSEETTEECCHHHHHHH
T ss_pred hcCCCccccccchHHHHHHHCCCcCeeCCCCCCHHHHHHH
Confidence 9999999999999999999999999999999999999988
|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|