Citrus Sinensis ID: 021845
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 306 | ||||||
| 147854667 | 339 | hypothetical protein VITISV_029129 [Viti | 0.856 | 0.772 | 0.673 | 2e-96 | |
| 225466968 | 295 | PREDICTED: peptidyl-prolyl cis-trans iso | 0.761 | 0.789 | 0.709 | 1e-94 | |
| 255565115 | 296 | peptidyl-prolyl cis-trans isomerase, put | 0.777 | 0.804 | 0.687 | 3e-92 | |
| 224091653 | 268 | predicted protein [Populus trichocarpa] | 0.787 | 0.899 | 0.656 | 3e-90 | |
| 449493671 | 309 | PREDICTED: peptidyl-prolyl cis-trans iso | 0.771 | 0.763 | 0.700 | 8e-89 | |
| 356532982 | 287 | PREDICTED: peptidyl-prolyl cis-trans iso | 0.754 | 0.804 | 0.680 | 5e-87 | |
| 449443001 | 314 | PREDICTED: peptidyl-prolyl cis-trans iso | 0.771 | 0.751 | 0.687 | 8e-87 | |
| 356556583 | 286 | PREDICTED: peptidyl-prolyl cis-trans iso | 0.761 | 0.814 | 0.664 | 2e-86 | |
| 297805064 | 281 | peptidyl-prolyl cis-trans isomerase [Ara | 0.901 | 0.982 | 0.618 | 8e-83 | |
| 115475740 | 327 | Os08g0292600 [Oryza sativa Japonica Grou | 0.761 | 0.712 | 0.617 | 4e-82 |
| >gi|147854667|emb|CAN80241.1| hypothetical protein VITISV_029129 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 357 bits (917), Expect = 2e-96, Method: Compositional matrix adjust.
Identities = 190/282 (67%), Positives = 221/282 (78%), Gaps = 20/282 (7%)
Query: 32 ISFPRRTFLFFSSTTSTALSLPSPPA-----PTPDTTITDSIFMDFSLCPTFFRPEGTDP 86
+SF RR LF S++T A S S A P PDTT+TD ++MDFS+CPT FRPE D
Sbjct: 71 LSFTRRHLLFLSTSTXPAPSPLSSSAIPQPPPPPDTTVTDRVYMDFSICPTSFRPEADD- 129
Query: 87 TLCSSPVPLGRLIIGLYGHLAPITVSNFKAMC--SSRSLYRNTLVHKIFPGQFFLAGRQG 144
C +PLGRL+IGLYGHL P+TVSNFKAMC SS S Y+NTLV KIFPGQFF+AGRQG
Sbjct: 130 --CRDSLPLGRLVIGLYGHLVPLTVSNFKAMCTGSSGSSYKNTLVQKIFPGQFFVAGRQG 187
Query: 145 LSRRDSKLGELHPPLDFLPPNTDTLRPNAFLLKHSRGGVVSLCLSENDDDPDVKLDPHYR 204
RRD GE+ PPLD L NT+T+ AF L+HS+ GVVSLCLSENDDD ++KL+P YR
Sbjct: 188 --RRDK--GEVRPPLD-LARNTETVDSRAFALRHSKAGVVSLCLSENDDDDEIKLNPDYR 242
Query: 205 NVEFLITTGPGPCPQLDNKNIVFGTVLQGLDVVAAIASIPTYKPSERIQKYNELAAFIGD 264
NVEFLITTGPGPCPQLDN+NIVFG+VL+GLDVV AIASIPTYKP+ERI++ N+LA F+GD
Sbjct: 243 NVEFLITTGPGPCPQLDNRNIVFGSVLEGLDVVTAIASIPTYKPAERIRQLNDLAEFLGD 302
Query: 265 KRADTARAIWNRPLKTVYISDCGELKLKPNATTKPSLSPTLP 306
RA ARA WN+PLKTVYISDCGELK+ TKPSLSP+LP
Sbjct: 303 DRAPIARATWNKPLKTVYISDCGELKV-----TKPSLSPSLP 339
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225466968|ref|XP_002267887.1| PREDICTED: peptidyl-prolyl cis-trans isomerase B-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255565115|ref|XP_002523550.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis] gi|223537257|gb|EEF38889.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224091653|ref|XP_002309317.1| predicted protein [Populus trichocarpa] gi|222855293|gb|EEE92840.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449493671|ref|XP_004159404.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356532982|ref|XP_003535048.1| PREDICTED: peptidyl-prolyl cis-trans isomerase B-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449443001|ref|XP_004139269.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356556583|ref|XP_003546604.1| PREDICTED: peptidyl-prolyl cis-trans isomerase B-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297805064|ref|XP_002870416.1| peptidyl-prolyl cis-trans isomerase [Arabidopsis lyrata subsp. lyrata] gi|297316252|gb|EFH46675.1| peptidyl-prolyl cis-trans isomerase [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|115475740|ref|NP_001061466.1| Os08g0292600 [Oryza sativa Japonica Group] gi|28564614|dbj|BAC57781.1| unknown protein [Oryza sativa Japonica Group] gi|38175505|dbj|BAD01200.1| unknown protein [Oryza sativa Japonica Group] gi|113623435|dbj|BAF23380.1| Os08g0292600 [Oryza sativa Japonica Group] gi|215697323|dbj|BAG91317.1| unnamed protein product [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 306 | ||||||
| TAIR|locus:2150371 | 281 | AT5G35100 [Arabidopsis thalian | 0.751 | 0.818 | 0.657 | 9.7e-80 | |
| GENEDB_PFALCIPARUM|PFC0975c | 171 | PFC0975c "PFCYP19, cyclophilin | 0.392 | 0.701 | 0.293 | 8.8e-13 | |
| UNIPROTKB|Q76NN7 | 171 | PfCyP19 "Peptidyl-prolyl cis-t | 0.392 | 0.701 | 0.293 | 8.8e-13 | |
| POMBASE|SPBC1709.04c | 173 | cyp3 "cyclophilin family pepti | 0.441 | 0.780 | 0.296 | 5.5e-11 | |
| DICTYBASE|DDB_G0269120 | 197 | cypB "cyclophilin B" [Dictyost | 0.467 | 0.725 | 0.308 | 1.8e-10 | |
| TAIR|locus:2031546 | 317 | AT1G74070 [Arabidopsis thalian | 0.254 | 0.246 | 0.358 | 8.4e-10 | |
| CGD|CAL0002277 | 162 | CYP1 [Candida albicans (taxid: | 0.186 | 0.351 | 0.376 | 1.2e-09 | |
| UNIPROTKB|P22011 | 162 | CYP1 "Peptidyl-prolyl cis-tran | 0.186 | 0.351 | 0.376 | 1.2e-09 | |
| TAIR|locus:2116880 | 172 | ROC5 "rotamase cyclophilin 5" | 0.428 | 0.761 | 0.271 | 1.4e-09 | |
| SGD|S000004543 | 182 | CPR3 "Mitochondrial peptidyl-p | 0.218 | 0.368 | 0.370 | 2e-09 |
| TAIR|locus:2150371 AT5G35100 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 801 (287.0 bits), Expect = 9.7e-80, P = 9.7e-80
Identities = 159/242 (65%), Positives = 186/242 (76%)
Query: 70 MDFSLCPTFFR--PEGT--DPTLCSSPVPLGRLIIGLYGHLAPITVSNFKAMCSSRSL-Y 124
+DFSLCPT+FR P T T CS PLGR+++GLYG PITVS FK MC+S S Y
Sbjct: 47 LDFSLCPTYFRSDPSATLSSTTPCSDSTPLGRVVLGLYGRHVPITVSTFKRMCTSSSTSY 106
Query: 125 RNTLVHKIFPGQFFLAGRQGLSRRDSKLGELHPPLDFLPPNTDTLRPNAFLLKHSRGGVV 184
+NT VHKIFPGQ+FLAGRQG RRD+ E+ L LP NTD + AFLL H+R GVV
Sbjct: 107 KNTPVHKIFPGQYFLAGRQGGGRRDT--AEVGYSLRDLPRNTDVVNSKAFLLPHARAGVV 164
Query: 185 SLCLSENDDDPDVKLDPHYRNVEFLITTGPGPCPQLDNKNIVFGTVLQGLDVVAAIASIP 244
SLCLSENDDD D++LDP YRNVEFLITTGPGP PQLD NIVFGTVL+GLDVV +I+SIP
Sbjct: 165 SLCLSENDDDDDIRLDPDYRNVEFLITTGPGPSPQLDGGNIVFGTVLEGLDVVTSISSIP 224
Query: 245 TYKPSERIQKYNELAAFIGDKRADTARAIWNRPLKTVYISDCGELKLKPNATTKPSLSPT 304
TYKPSE I+++N+ A F+GD+RA AR++WNRPLKTV+IS CGELK+ T PSLSPT
Sbjct: 225 TYKPSENIKQFNDFAEFLGDERAQNARSLWNRPLKTVFISGCGELKV-----TNPSLSPT 279
Query: 305 LP 306
LP
Sbjct: 280 LP 281
|
|
| GENEDB_PFALCIPARUM|PFC0975c PFC0975c "PFCYP19, cyclophilin, peptidyl-prolyl cis-trans isomerase" [Plasmodium falciparum (taxid:5833)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q76NN7 PfCyP19 "Peptidyl-prolyl cis-trans isomerase" [Plasmodium falciparum 3D7 (taxid:36329)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBC1709.04c cyp3 "cyclophilin family peptidyl-prolyl cis- trans isomerase Cyp3" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0269120 cypB "cyclophilin B" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2031546 AT1G74070 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0002277 CYP1 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P22011 CYP1 "Peptidyl-prolyl cis-trans isomerase" [Candida albicans SC5314 (taxid:237561)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2116880 ROC5 "rotamase cyclophilin 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| SGD|S000004543 CPR3 "Mitochondrial peptidyl-prolyl cis-trans isomerase (cyclophilin)" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00010183001 | RecName- Full=Peptidyl-prolyl cis-trans isomerase; EC=5.2.1.8;; PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity) (226 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 306 | |||
| cd00317 | 146 | cd00317, cyclophilin, cyclophilin: cyclophilin-typ | 1e-24 | |
| pfam00160 | 144 | pfam00160, Pro_isomerase, Cyclophilin type peptidy | 9e-20 | |
| cd01926 | 164 | cd01926, cyclophilin_ABH_like, cyclophilin_ABH_lik | 1e-16 | |
| COG0652 | 158 | COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase | 4e-16 | |
| PTZ00060 | 183 | PTZ00060, PTZ00060, cyclophilin; Provisional | 5e-13 | |
| cd01923 | 159 | cd01923, cyclophilin_RING, cyclophilin_RING: cyclo | 2e-09 | |
| cd01927 | 148 | cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclo | 2e-09 | |
| cd01928 | 153 | cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3 | 1e-08 | |
| cd01920 | 155 | cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP | 3e-08 | |
| cd01922 | 146 | cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCY | 2e-07 | |
| cd01921 | 166 | cd01921, cyclophilin_RRM, cyclophilin_RRM: cycloph | 2e-05 | |
| PRK10791 | 164 | PRK10791, PRK10791, peptidyl-prolyl cis-trans isom | 5e-05 | |
| PTZ00221 | 249 | PTZ00221, PTZ00221, cyclophilin; Provisional | 5e-05 | |
| PLN03149 | 186 | PLN03149, PLN03149, peptidyl-prolyl isomerase H (c | 2e-04 | |
| cd01925 | 171 | cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeC | 0.002 |
| >gnl|CDD|238194 cd00317, cyclophilin, cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases | Back alignment and domain information |
|---|
Score = 96.6 bits (241), Expect = 1e-24
Identities = 54/194 (27%), Positives = 73/194 (37%), Gaps = 58/194 (29%)
Query: 96 GRLIIGLYGHLAPITVSNFKAMCSSRSLYRNTLVHKIFPGQFFLAGRQGLSRRDSKLGEL 155
GR++I LYG AP TV NF ++ Y T H++ PG F+ QG
Sbjct: 7 GRIVIELYGDEAPKTVENFLSLARGGF-YDGTTFHRVIPG--FMI--QG----------- 50
Query: 156 HPPLDFLPPNTDTLRP----NAFLLKHSRGGVVSLCLSENDDDPDVKLDPHYRNVEFLIT 211
P + N L H R G +S+ + P+ +F IT
Sbjct: 51 GDPTGTGGGGSGPGYKFPDENFPLKYHHRRGTLSMANA----------GPNTNGSQFFIT 100
Query: 212 TGPGPCPQLDNKNIVFGTVLQGLDVVAAIASIPTYKPSERIQKYNELAAFIGDKRADTAR 271
T P P LD K+ VFG V++G+DVV I T +
Sbjct: 101 TAP--TPHLDGKHTVFGKVVEGMDVVDKIERGDTDE------------------------ 134
Query: 272 AIWNRPLKTVYISD 285
RP+K V ISD
Sbjct: 135 --NGRPIKPVTISD 146
|
This family contains eukaryotic, bacterial and archeal proteins which exhibit a peptidylprolyl cis- trans isomerases activity (PPIase, Rotamase) and in addition bind the immunosuppressive drug cyclosporin (CsA). Immunosuppression in vertebrates is believed to be the result of the cyclophilin A-cyclosporin protein drug complex binding to and inhibiting the protein-phosphatase calcineurin. PPIase is an enzyme which accelerates protein folding by catalyzing the cis-trans isomerization of the peptide bonds preceding proline residues. Cyclophilins are a diverse family in terms of function and have been implicated in protein folding processes which depend on catalytic /chaperone-like activities. This group contains human cyclophilin 40, a co-chaperone of the hsp90 chaperone system; human cyclophilin A, a chaperone in the HIV-1 infectious process and; human cyclophilin H, a component of the U4/U6 snRNP, whose isomerization or chaperoning activities may play a role in RNA splicing. . Length = 146 |
| >gnl|CDD|215759 pfam00160, Pro_isomerase, Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD | Back alignment and domain information |
|---|
| >gnl|CDD|238907 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain | Back alignment and domain information |
|---|
| >gnl|CDD|223725 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|240249 PTZ00060, PTZ00060, cyclophilin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238904 cd01923, cyclophilin_RING, cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|238908 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain | Back alignment and domain information |
|---|
| >gnl|CDD|238909 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3_like | Back alignment and domain information |
|---|
| >gnl|CDD|238901 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E | Back alignment and domain information |
|---|
| >gnl|CDD|238903 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 | Back alignment and domain information |
|---|
| >gnl|CDD|238902 cd01921, cyclophilin_RRM, cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) | Back alignment and domain information |
|---|
| >gnl|CDD|182734 PRK10791, PRK10791, peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|140248 PTZ00221, PTZ00221, cyclophilin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178694 PLN03149, PLN03149, peptidyl-prolyl isomerase H (cyclophilin H); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238906 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 306 | |||
| KOG0880 | 217 | consensus Peptidyl-prolyl cis-trans isomerase [Pos | 100.0 | |
| KOG0546 | 372 | consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos | 100.0 | |
| KOG0879 | 177 | consensus U-snRNP-associated cyclophilin type pept | 100.0 | |
| PTZ00221 | 249 | cyclophilin; Provisional | 100.0 | |
| PLN03149 | 186 | peptidyl-prolyl isomerase H (cyclophilin H); Provi | 100.0 | |
| PTZ00060 | 183 | cyclophilin; Provisional | 100.0 | |
| cd01926 | 164 | cyclophilin_ABH_like cyclophilin_ABH_like: Cycloph | 100.0 | |
| COG0652 | 158 | PpiB Peptidyl-prolyl cis-trans isomerase (rotamase | 100.0 | |
| KOG0111 | 298 | consensus Cyclophilin-type peptidyl-prolyl cis-tra | 100.0 | |
| cd01923 | 159 | cyclophilin_RING cyclophilin_RING: cyclophilin-typ | 100.0 | |
| KOG0881 | 164 | consensus Cyclophilin type peptidyl-prolyl cis-tra | 100.0 | |
| cd01921 | 166 | cyclophilin_RRM cyclophilin_RRM: cyclophilin-type | 100.0 | |
| cd01927 | 148 | cyclophilin_WD40 cyclophilin_WD40: cyclophilin-typ | 100.0 | |
| cd01928 | 153 | Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like. Pro | 100.0 | |
| PRK10903 | 190 | peptidyl-prolyl cis-trans isomerase A (rotamase A) | 100.0 | |
| cd01922 | 146 | cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: c | 100.0 | |
| cd01925 | 171 | cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: | 100.0 | |
| KOG0882 | 558 | consensus Cyclophilin-related peptidyl-prolyl cis- | 100.0 | |
| KOG0883 | 518 | consensus Cyclophilin type, U box-containing pepti | 100.0 | |
| PRK10791 | 164 | peptidyl-prolyl cis-trans isomerase B (rotamase B) | 100.0 | |
| cd01920 | 155 | cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyc | 100.0 | |
| KOG0884 | 161 | consensus Similar to cyclophilin-type peptidyl-pro | 100.0 | |
| KOG0865 | 167 | consensus Cyclophilin type peptidyl-prolyl cis-tra | 100.0 | |
| PF00160 | 155 | Pro_isomerase: Cyclophilin type peptidyl-prolyl ci | 100.0 | |
| cd00317 | 146 | cyclophilin cyclophilin: cyclophilin-type peptidyl | 100.0 | |
| cd01924 | 176 | cyclophilin_TLP40_like cyclophilin_TLP40_like: cyc | 100.0 | |
| KOG0415 | 479 | consensus Predicted peptidyl prolyl cis-trans isom | 100.0 | |
| KOG0885 | 439 | consensus Peptidyl-prolyl cis-trans isomerase [Pos | 100.0 | |
| KOG0882 | 558 | consensus Cyclophilin-related peptidyl-prolyl cis- | 97.42 | |
| TIGR03268 | 503 | methan_mark_3 putative methanogenesis marker prote | 95.47 | |
| PRK00969 | 508 | hypothetical protein; Provisional | 95.36 | |
| TIGR03268 | 503 | methan_mark_3 putative methanogenesis marker prote | 95.0 | |
| COG4070 | 512 | Predicted peptidyl-prolyl cis-trans isomerase (rot | 94.69 | |
| PRK00969 | 508 | hypothetical protein; Provisional | 91.86 | |
| COG4070 | 512 | Predicted peptidyl-prolyl cis-trans isomerase (rot | 91.76 | |
| PF12903 | 147 | DUF3830: Protein of unknown function (DUF3830); In | 86.27 |
| >KOG0880 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.4e-55 Score=378.38 Aligned_cols=172 Identities=34% Similarity=0.643 Sum_probs=162.5
Q ss_pred CCCCCCCCCceEEEEEEeCCccCCCCCCCCCcCCCCccceeEEEEecCCCCchHHHHHHHHhcc---CccccCceeEeec
Q 021845 57 APTPDTTITDSIFMDFSLCPTFFRPEGTDPTLCSSPVPLGRLIIGLYGHLAPITVSNFKAMCSS---RSLYRNTLVHKIF 133 (306)
Q Consensus 57 ~~~~~~~~~~~v~~di~i~~~~~~~~~~~~~~~~~~t~~GrIvIeL~~d~aP~tv~NF~~L~~~---~~~Y~gt~FhRVi 133 (306)
...+.+++|++|||||++ ++...|||+|+||++.+|+||+||++||++ +..|.|++||||+
T Consensus 31 ~~~~~p~vT~kV~fdi~~----------------g~~~~grIvigLfG~~vPKTV~NF~~l~~~~~~~~gY~gS~FhRVi 94 (217)
T KOG0880|consen 31 KYEPGPKVTHKVYFDIEI----------------GGEPVGRIVIGLFGKVVPKTVENFRALATSGEKGYGYKGSKFHRVI 94 (217)
T ss_pred ccCCCCcceeEEEEEEEE----------------CCEeccEEEEEeccccchHHHHHHHHHHccCCCCcccCCceeeeee
Confidence 346778999999999999 789999999999999999999999999993 5789999999999
Q ss_pred CCeEEEcCCCCCcCCCCCCCccCCCCCCCCCCCCCCCCCcccccCCCceEEEEecCCCCCCCCCCCCCCCccceEEEEcC
Q 021845 134 PGQFFLAGRQGLSRRDSKLGELHPPLDFLPPNTDTLRPNAFLLKHSRGGVVSLCLSENDDDPDVKLDPHYRNVEFLITTG 213 (306)
Q Consensus 134 ~~f~iq~Gd~~~~~~~g~~g~s~~~~~~~~~~g~~~~de~~~l~h~~~G~lsma~~~~~~~~~~~~~p~t~gSqFfItl~ 213 (306)
|||||||||. +.++|++|.++| |++|+||||.|+|++||.|||||. |||+||||||||+.
T Consensus 95 ~nfmIQGGd~--t~g~gtGg~SIy--------G~~F~DENf~LkH~rpG~lSMAn~----------GpDtNGsQFfItT~ 154 (217)
T KOG0880|consen 95 PNFMIQGGDF--TKGDGTGGKSIY--------GEKFPDENFKLKHDRPGRLSMANA----------GPDTNGSQFFITTV 154 (217)
T ss_pred cCceeecCcc--ccCCCCCCeEee--------cCCCCCccceeecCCCceEeeecc----------CCCCCCceEEEEec
Confidence 9999999996 789999999998 688999999999999999999998 89999999999999
Q ss_pred CCCCCCCCCCCcEEEEEEcCHHHHHHHHcCCCCCCchhhhhhhhhHhhhcccccccccccCCCCCCcEEEeeeeEeccC
Q 021845 214 PGPCPQLDNKNIVFGTVLQGLDVVAAIASIPTYKPSERIQKYNELAAFIGDKRADTARAIWNRPLKTVYISDCGELKLK 292 (306)
Q Consensus 214 ~~~~p~LDg~~tVFGrVv~GmdVl~kI~~~~t~~~~~~~~~~~~~a~~~gd~~a~~~~~~~~~P~~~V~I~~cg~l~~~ 292 (306)
. ++||||+|+|||+|++|||||.+|+.++||. .++|+++|+|.+||+|+.+
T Consensus 155 ~--t~wLDGkhVVFGqVl~Gmdvv~~Ie~~~TD~--------------------------~dkP~e~v~I~~~g~l~~~ 205 (217)
T KOG0880|consen 155 K--TPWLDGKHVVFGQVLEGMDVVRKIENVKTDE--------------------------RDKPLEDVVIANCGELPVE 205 (217)
T ss_pred C--CccccCceeEEeeehhhHHHHHHHHhcccCC--------------------------CCCccccEEEeecCccccc
Confidence 8 9999999999999999999999999999985 6999999999999999884
|
|
| >KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0879 consensus U-snRNP-associated cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00221 cyclophilin; Provisional | Back alignment and domain information |
|---|
| >PLN03149 peptidyl-prolyl isomerase H (cyclophilin H); Provisional | Back alignment and domain information |
|---|
| >PTZ00060 cyclophilin; Provisional | Back alignment and domain information |
|---|
| >cd01926 cyclophilin_ABH_like cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain | Back alignment and domain information |
|---|
| >COG0652 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01923 cyclophilin_RING cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain | Back alignment and domain information |
|---|
| >KOG0881 consensus Cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01921 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) | Back alignment and domain information |
|---|
| >cd01927 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain | Back alignment and domain information |
|---|
| >cd01928 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like | Back alignment and domain information |
|---|
| >PRK10903 peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional | Back alignment and domain information |
|---|
| >cd01922 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 | Back alignment and domain information |
|---|
| >cd01925 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 | Back alignment and domain information |
|---|
| >KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0883 consensus Cyclophilin type, U box-containing peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10791 peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional | Back alignment and domain information |
|---|
| >cd01920 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E | Back alignment and domain information |
|---|
| >KOG0884 consensus Similar to cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0865 consensus Cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00160 Pro_isomerase: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD; InterPro: IPR002130 Cyclophilin [] is the major high-affinity binding protein in vertebrates for the immunosuppressive drug cyclosporin A (CSA), but is also found in other organisms | Back alignment and domain information |
|---|
| >cd00317 cyclophilin cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases | Back alignment and domain information |
|---|
| >cd01924 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 | Back alignment and domain information |
|---|
| >KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0885 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 | Back alignment and domain information |
|---|
| >PRK00969 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 | Back alignment and domain information |
|---|
| >COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK00969 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12903 DUF3830: Protein of unknown function (DUF3830); InterPro: IPR024532 This is a family of bacterial and archaeal proteins | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 306 | ||||
| 2plu_A | 186 | Crystal Structure Of Cryptosporidium Parvum Cycloph | 2e-11 | ||
| 3ich_A | 188 | Crystal Structure Of Cyclophilin B At 1.2 A Resolut | 2e-11 | ||
| 1cyn_A | 178 | Cyclophilin B Complexed With [d-(Cholinylester)ser8 | 2e-11 | ||
| 1qnh_A | 170 | Plasmodium Falciparum Cyclophilin (Double Mutant) C | 4e-11 | ||
| 1qng_A | 170 | Plasmodium Falciparum Cyclophilin Complexed With Cy | 4e-11 | ||
| 4fru_A | 185 | Crystal Structure Of Horse Wild-Type Cyclophilin B | 5e-11 | ||
| 4frv_A | 185 | Crystal Structure Of Mutated Cyclophilin B That Cau | 6e-11 | ||
| 2haq_A | 172 | Crystal Structure Of Cyclophilin A From Leishmania | 2e-10 | ||
| 1xo7_A | 166 | Crystal Structure Of Cyclophilin From Trypanosoma C | 4e-10 | ||
| 3bt8_A | 172 | Crystal Structure Of Mutant Cyclophilin (R147a) Fro | 4e-10 | ||
| 1ist_A | 162 | Crystal Structure Of Yeast Cyclophilin A, Cpr1 Leng | 2e-09 | ||
| 3k2c_A | 193 | Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isom | 3e-09 | ||
| 4i9y_A | 167 | Structure Of The C-terminal Domain Of Nup358 Length | 3e-09 | ||
| 3pmp_A | 164 | Crystal Structure Of Cyclophilin A From Moniliophth | 3e-09 | ||
| 3o7t_A | 164 | Crystal Structure Of Cyclophilin A From Moniliophth | 4e-09 | ||
| 3k0r_A | 165 | Cryogenic Structure Of Cypa Mutant Arg55lys Length | 2e-08 | ||
| 2alf_A | 164 | Crystal Structure Of Human Cypa Mutant K131a Length | 3e-08 | ||
| 1dyw_A | 173 | Biochemical And Structural Characterization Of A Di | 3e-08 | ||
| 1h0p_A | 182 | Cyclophilin_5 From C. Elegans Length = 182 | 4e-08 | ||
| 2rmc_A | 182 | Crystal Structure Of Murine Cyclophilin C Complexed | 4e-08 | ||
| 2rma_A | 165 | Crystal Structures Of Cyclophilin A Complexed With | 4e-08 | ||
| 2xgy_B | 173 | Complex Of Rabbit Endogenous Lentivirus (Relik)caps | 4e-08 | ||
| 1bck_A | 165 | Human Cyclophilin A Complexed With 2-Thr Cyclospori | 4e-08 | ||
| 5cyh_A | 164 | Cyclophilin A Complexed With Dipeptide Gly-Pro Leng | 4e-08 | ||
| 3rdd_A | 184 | Human Cyclophilin A Complexed With An Inhibitor Len | 4e-08 | ||
| 1m9e_A | 164 | X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- | 5e-08 | ||
| 2he9_A | 192 | Structure Of The Peptidylprolyl Isomerase Domain Of | 6e-08 | ||
| 2hqj_A | 183 | Cyclophilin From Leishmania Major Length = 183 | 6e-08 | ||
| 3k0o_A | 165 | Room Temperature Structure Of Cypa Mutant Ser99thr | 8e-08 | ||
| 2cfe_A | 162 | The 1.5 A Crystal Structure Of The Malassezia Sympo | 8e-08 | ||
| 3r49_A | 166 | Human Cyclophilin D Complexed With Quinolin-8-Amine | 1e-07 | ||
| 2bit_X | 165 | Crystal Structure Of Human Cyclophilin D At 1.7 A R | 1e-07 | ||
| 3qyu_A | 164 | Crystal Structure Of Human Cyclophilin D At 1.54 A | 1e-07 | ||
| 2z6w_A | 165 | Crystal Structure Of Human Cyclophilin D In Complex | 1e-07 | ||
| 2ck1_A | 172 | The Structure Of Oxidised Cyclophilin A From S. Man | 1e-07 | ||
| 2wlw_A | 165 | Structure Of The N-Terminal Capsid Domain Of Hiv-2 | 1e-07 | ||
| 1c5f_A | 177 | Crystal Structure Of The Cyclophilin-Like Domain Fr | 2e-07 | ||
| 2x2c_K | 165 | Acetyl-Cypa:cyclosporine Complex Length = 165 | 2e-07 | ||
| 2x2a_A | 165 | Free Acetyl-Cypa Trigonal Form Length = 165 | 2e-07 | ||
| 2x25_B | 169 | Free Acetyl-Cypa Orthorhombic Form Length = 169 | 3e-07 | ||
| 4dgd_A | 165 | Trimcyp Cyclophilin Domain From Macaca Mulatta: H70 | 3e-07 | ||
| 1ihg_A | 370 | Bovine Cyclophilin 40, Monoclinic Form Length = 370 | 5e-07 | ||
| 2x83_B | 163 | Evolutionary Basis Of Hiv Restriction By The Antire | 5e-07 | ||
| 1aws_A | 164 | Secypa Complexed With Hagpia (Pseudo-Symmetric Mono | 1e-06 | ||
| 2esl_A | 190 | Human Cyclophilin C In Complex With Cyclosporin A L | 2e-06 | ||
| 2wfi_A | 179 | Atomic Resolution Crystal Structure Of The Ppiase D | 5e-06 | ||
| 1qoi_A | 177 | U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = | 5e-06 | ||
| 2wfj_A | 179 | Atomic Resolution Crystal Structure Of The Ppiase D | 5e-06 | ||
| 2r99_A | 173 | Crystal Structure Of Cyclophilin Abh-Like Domain Of | 6e-06 | ||
| 1zmf_A | 165 | C Domain Of Human Cyclophilin-33(Hcyp33) Length = 1 | 7e-06 | ||
| 2gw2_A | 198 | Crystal Structure Of The Peptidyl-Prolyl Isomerase | 9e-06 | ||
| 1z81_A | 229 | Crystal Structure Of Cyclophilin From Plasmodium Yo | 1e-05 | ||
| 2c3b_A | 172 | The Crystal Structure Of Aspergillus Fumigatus Cycl | 2e-05 | ||
| 2b71_A | 196 | Plasmodium Yoelii Cyclophilin-Like Protein Length = | 3e-05 | ||
| 3uch_A | 174 | Crystal Structure Of A Hypotherical Peptidyl-Prolyl | 9e-05 | ||
| 1xyh_A | 161 | Crystal Structure Of Recombinant Human Cyclophilin | 2e-04 | ||
| 2oju_A | 167 | X-Ray Structure Of Complex Of Human Cyclophilin J W | 3e-04 | ||
| 1zkc_A | 197 | Crystal Structure Of The Cyclophiln_ring Domain Of | 3e-04 | ||
| 1xwn_A | 174 | Solution Structure Of Cyclophilin Like 1(Ppil1) And | 6e-04 | ||
| 2x7k_A | 166 | The Crystal Structure Of Ppil1 In Complex With Cycl | 6e-04 | ||
| 2k7n_A | 203 | Solution Structure Of The Ppil1 Bound To A Fragment | 6e-04 | ||
| 1j2a_A | 166 | Structure Of E. Coli Cyclophilin B K163t Mutant Len | 6e-04 | ||
| 1clh_A | 166 | Three-Dimensional Solution Structure Of Escherichia | 6e-04 | ||
| 2fu0_A | 160 | Plasmodium Falciparum Cyclophilin Pfe0505w Putative | 7e-04 |
| >pdb|2PLU|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_4120 Length = 186 | Back alignment and structure |
|
| >pdb|3ICH|A Chain A, Crystal Structure Of Cyclophilin B At 1.2 A Resolution Length = 188 | Back alignment and structure |
| >pdb|1CYN|A Chain A, Cyclophilin B Complexed With [d-(Cholinylester)ser8]-Cyclosporin Length = 178 | Back alignment and structure |
| >pdb|1QNH|A Chain A, Plasmodium Falciparum Cyclophilin (Double Mutant) Complexed With Cyclosporin A Length = 170 | Back alignment and structure |
| >pdb|1QNG|A Chain A, Plasmodium Falciparum Cyclophilin Complexed With Cyclosporin A Length = 170 | Back alignment and structure |
| >pdb|4FRU|A Chain A, Crystal Structure Of Horse Wild-Type Cyclophilin B Length = 185 | Back alignment and structure |
| >pdb|4FRV|A Chain A, Crystal Structure Of Mutated Cyclophilin B That Causes Hyperelastosis Cutis In The American Quarter Horse Length = 185 | Back alignment and structure |
| >pdb|2HAQ|A Chain A, Crystal Structure Of Cyclophilin A From Leishmania Donovani Length = 172 | Back alignment and structure |
| >pdb|1XO7|A Chain A, Crystal Structure Of Cyclophilin From Trypanosoma Cruzi Length = 166 | Back alignment and structure |
| >pdb|3BT8|A Chain A, Crystal Structure Of Mutant Cyclophilin (R147a) From Leishmania Donovani Length = 172 | Back alignment and structure |
| >pdb|1IST|A Chain A, Crystal Structure Of Yeast Cyclophilin A, Cpr1 Length = 162 | Back alignment and structure |
| >pdb|3K2C|A Chain A, Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Encephalitozoon Cuniculi At 1.9 A Resolution Length = 193 | Back alignment and structure |
| >pdb|4I9Y|A Chain A, Structure Of The C-terminal Domain Of Nup358 Length = 167 | Back alignment and structure |
| >pdb|3PMP|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa In Complex With Cyclosporin A Length = 164 | Back alignment and structure |
| >pdb|3O7T|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa Length = 164 | Back alignment and structure |
| >pdb|3K0R|A Chain A, Cryogenic Structure Of Cypa Mutant Arg55lys Length = 165 | Back alignment and structure |
| >pdb|2ALF|A Chain A, Crystal Structure Of Human Cypa Mutant K131a Length = 164 | Back alignment and structure |
| >pdb|1DYW|A Chain A, Biochemical And Structural Characterization Of A Divergent Loop Cyclophilin From Caenorhabditis Elegans Length = 173 | Back alignment and structure |
| >pdb|1H0P|A Chain A, Cyclophilin_5 From C. Elegans Length = 182 | Back alignment and structure |
| >pdb|2RMC|A Chain A, Crystal Structure Of Murine Cyclophilin C Complexed With Immunosuppressive Drug Cyclosporin A Length = 182 | Back alignment and structure |
| >pdb|2RMA|A Chain A, Crystal Structures Of Cyclophilin A Complexed With Cyclosporin A And N-Methyl-4-[(E)-2-Butenyl]-4,4-Dimethylthreonine Cyclosporin A Length = 165 | Back alignment and structure |
| >pdb|2XGY|B Chain B, Complex Of Rabbit Endogenous Lentivirus (Relik)capsid With Cyclophilin A Length = 173 | Back alignment and structure |
| >pdb|1BCK|A Chain A, Human Cyclophilin A Complexed With 2-Thr Cyclosporin Length = 165 | Back alignment and structure |
| >pdb|5CYH|A Chain A, Cyclophilin A Complexed With Dipeptide Gly-Pro Length = 164 | Back alignment and structure |
| >pdb|3RDD|A Chain A, Human Cyclophilin A Complexed With An Inhibitor Length = 184 | Back alignment and structure |
| >pdb|1M9E|A Chain A, X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- Terminal Domain (1-146) M-Type H87a Complex. Length = 164 | Back alignment and structure |
| >pdb|2HE9|A Chain A, Structure Of The Peptidylprolyl Isomerase Domain Of The Human Nk-Tumour Recognition Protein Length = 192 | Back alignment and structure |
| >pdb|2HQJ|A Chain A, Cyclophilin From Leishmania Major Length = 183 | Back alignment and structure |
| >pdb|3K0O|A Chain A, Room Temperature Structure Of Cypa Mutant Ser99thr Length = 165 | Back alignment and structure |
| >pdb|2CFE|A Chain A, The 1.5 A Crystal Structure Of The Malassezia Sympodialis Mala S 6 Allergen, A Member Of The Cyclophilin Pan- Allergen Family Length = 162 | Back alignment and structure |
| >pdb|3R49|A Chain A, Human Cyclophilin D Complexed With Quinolin-8-Amine Length = 166 | Back alignment and structure |
| >pdb|2BIT|X Chain X, Crystal Structure Of Human Cyclophilin D At 1.7 A Resolution Length = 165 | Back alignment and structure |
| >pdb|3QYU|A Chain A, Crystal Structure Of Human Cyclophilin D At 1.54 A Resolution At Room Temperature Length = 164 | Back alignment and structure |
| >pdb|2Z6W|A Chain A, Crystal Structure Of Human Cyclophilin D In Complex With Cyclosporin A Length = 165 | Back alignment and structure |
| >pdb|2CK1|A Chain A, The Structure Of Oxidised Cyclophilin A From S. Mansoni Length = 172 | Back alignment and structure |
| >pdb|2WLW|A Chain A, Structure Of The N-Terminal Capsid Domain Of Hiv-2 Length = 165 | Back alignment and structure |
| >pdb|1C5F|A Chain A, Crystal Structure Of The Cyclophilin-Like Domain From Brugia Malayi Complexed With Cyclosporin A Length = 177 | Back alignment and structure |
| >pdb|2X2C|K Chain K, Acetyl-Cypa:cyclosporine Complex Length = 165 | Back alignment and structure |
| >pdb|2X2A|A Chain A, Free Acetyl-Cypa Trigonal Form Length = 165 | Back alignment and structure |
| >pdb|2X25|B Chain B, Free Acetyl-Cypa Orthorhombic Form Length = 169 | Back alignment and structure |
| >pdb|4DGD|A Chain A, Trimcyp Cyclophilin Domain From Macaca Mulatta: H70c Mutant Length = 165 | Back alignment and structure |
| >pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 | Back alignment and structure |
| >pdb|2X83|B Chain B, Evolutionary Basis Of Hiv Restriction By The Antiretroviral Trimcyp Length = 163 | Back alignment and structure |
| >pdb|1AWS|A Chain A, Secypa Complexed With Hagpia (Pseudo-Symmetric Monomer) Length = 164 | Back alignment and structure |
| >pdb|2ESL|A Chain A, Human Cyclophilin C In Complex With Cyclosporin A Length = 190 | Back alignment and structure |
| >pdb|2WFI|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G Length = 179 | Back alignment and structure |
| >pdb|1QOI|A Chain A, U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 177 | Back alignment and structure |
| >pdb|2WFJ|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G In Complex With Cyclosporin A Length = 179 | Back alignment and structure |
| >pdb|2R99|A Chain A, Crystal Structure Of Cyclophilin Abh-Like Domain Of Human Peptidylprolyl Isomerase E Isoform 1 Length = 173 | Back alignment and structure |
| >pdb|1ZMF|A Chain A, C Domain Of Human Cyclophilin-33(Hcyp33) Length = 165 | Back alignment and structure |
| >pdb|2GW2|A Chain A, Crystal Structure Of The Peptidyl-Prolyl Isomerase Domain Of Human Cyclophilin G Length = 198 | Back alignment and structure |
| >pdb|1Z81|A Chain A, Crystal Structure Of Cyclophilin From Plasmodium Yoelii Length = 229 | Back alignment and structure |
| >pdb|2C3B|A Chain A, The Crystal Structure Of Aspergillus Fumigatus Cyclophilin Reveals 3d Domain Swapping Of A Central Element Length = 172 | Back alignment and structure |
| >pdb|2B71|A Chain A, Plasmodium Yoelii Cyclophilin-Like Protein Length = 196 | Back alignment and structure |
| >pdb|3UCH|A Chain A, Crystal Structure Of A Hypotherical Peptidyl-Prolyl Cis-Trans Isomerase E (Ppie) From Homo Sapiens At 2.50 A Resolution Length = 174 | Back alignment and structure |
| >pdb|1XYH|A Chain A, Crystal Structure Of Recombinant Human Cyclophilin J Length = 161 | Back alignment and structure |
| >pdb|2OJU|A Chain A, X-Ray Structure Of Complex Of Human Cyclophilin J With Cyclosporin A Length = 167 | Back alignment and structure |
| >pdb|1ZKC|A Chain A, Crystal Structure Of The Cyclophiln_ring Domain Of Human Peptidylprolyl Isomerase (Cyclophilin)-Like 2 Isoform B Length = 197 | Back alignment and structure |
| >pdb|1XWN|A Chain A, Solution Structure Of Cyclophilin Like 1(Ppil1) And Insights Into Its Interaction With Skip Length = 174 | Back alignment and structure |
| >pdb|2X7K|A Chain A, The Crystal Structure Of Ppil1 In Complex With Cyclosporine A Suggests A Binding Mode For Skip Length = 166 | Back alignment and structure |
| >pdb|2K7N|A Chain A, Solution Structure Of The Ppil1 Bound To A Fragment Of Skip Length = 203 | Back alignment and structure |
| >pdb|1J2A|A Chain A, Structure Of E. Coli Cyclophilin B K163t Mutant Length = 166 | Back alignment and structure |
| >pdb|1CLH|A Chain A, Three-Dimensional Solution Structure Of Escherichia Coli Periplasmic Cyclophilin Length = 166 | Back alignment and structure |
| >pdb|2FU0|A Chain A, Plasmodium Falciparum Cyclophilin Pfe0505w Putative Cyclosporin- Binding Domain Length = 160 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 306 | |||
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 8e-22 | |
| 2ose_A | 234 | Probable peptidyl-prolyl CIS-trans isomerase; cycl | 2e-20 | |
| 2he9_A | 192 | NK-tumor recognition protein; cyclosporin, isomera | 3e-19 | |
| 1a58_A | 177 | Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala | 7e-19 | |
| 2wfi_A | 179 | Peptidyl-prolyl CIS-trans isomerase G; phosphoprot | 1e-18 | |
| 1mzw_A | 177 | Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc | 6e-18 | |
| 2igv_A | 173 | Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 | 1e-16 | |
| 1qng_A | 170 | Peptidyl-prolyl CIS-trans isomerase; isomerase-imm | 3e-16 | |
| 2fu0_A | 160 | Cyclophilin, putative; PFE0505W, cyclosporin-bindi | 4e-16 | |
| 2poe_A | 185 | Cyclophilin-like protein, putative; cryptosporidiu | 7e-16 | |
| 3ich_A | 188 | Peptidyl-prolyl CIS-trans isomerase B; beta sandwi | 7e-16 | |
| 3bo7_A | 201 | Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; | 1e-15 | |
| 3rdd_A | 184 | Peptidyl-prolyl CIS-trans isomerase A; beta barrel | 1e-15 | |
| 1z81_A | 229 | Cyclophilin; structural genomics, structural genom | 1e-15 | |
| 2k7n_A | 203 | Peptidyl-prolyl CIS-trans isomerase-like 1; beta b | 2e-15 | |
| 2b71_A | 196 | Cyclophilin-like protein; structural genomics, str | 2e-15 | |
| 3pmp_A | 164 | Cyclophilin A; peptidyl prolyl isomerase, isomeras | 2e-15 | |
| 2z6w_A | 165 | Peptidyl-prolyl CIS-trans isomerase; isomerase-imm | 2e-15 | |
| 2cmt_A | 172 | Peptidyl-prolyl CIS-trans isomerase E; rotamase ac | 2e-15 | |
| 2a2n_A | 176 | Peptidylprolyl isomerase domain and WD repeat CON; | 2e-15 | |
| 2x7k_A | 166 | Peptidyl-prolyl CIS-trans isomerase-like 1; isomer | 2e-15 | |
| 2haq_A | 172 | Cyclophilin; rotamase, proline, isomerase, CIS-tra | 3e-15 | |
| 3k2c_A | 193 | Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, | 3e-15 | |
| 2r99_A | 173 | Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i | 4e-15 | |
| 2ok3_A | 161 | Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b | 5e-15 | |
| 2c3b_A | 172 | Ppiase, cyclophilin; isomerase, 3D domain swapping | 2e-14 | |
| 2poy_A | 186 | Peptidyl-prolyl CIS-trans isomerase; isomerase-imm | 4e-14 | |
| 1zkc_A | 197 | Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr | 5e-14 | |
| 3bkp_A | 232 | Cyclophilin; malaria, isomerase, structural GENO s | 6e-14 | |
| 2hq6_A | 185 | Serologically defined colon cancer antigen 10; pro | 1e-12 | |
| 1w74_A | 191 | Peptidyl-prolyl CIS-trans isomerase A; cyclophilin | 3e-09 | |
| 3rfy_A | 369 | Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; | 4e-09 | |
| 1v9t_A | 166 | Cyclophilin B; beta barrel, isomerase-isomerase in | 3e-07 | |
| 1lop_A | 164 | Cyclophilin A; rotamase, isomerase-isomerase inhib | 1e-05 | |
| 3s6m_A | 167 | Peptidyl-prolyl CIS-trans isomerase; seattle struc | 5e-05 |
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 | Back alignment and structure |
|---|
Score = 93.2 bits (232), Expect = 8e-22
Identities = 49/209 (23%), Positives = 82/209 (39%), Gaps = 63/209 (30%)
Query: 94 PLGRLIIGLYGHLAPITVSNFKAMC---------SSRSL-YRNTLVHKIFPGQFFLAGRQ 143
+GR+++ L+ + P T NF+A+C + + L ++ H+I F + Q
Sbjct: 28 RVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKK-FMI---Q 83
Query: 144 G--LSRRDSKLGELHPPLDFLPPNTDTLRPNAFLLKHSRGGVVSLCLSENDDDPDVKLDP 201
G S ++ GE F N F KH + G++S+ N
Sbjct: 84 GGDFSNQNGTGGESIYGEKFEDEN--------FHYKHDKEGLLSMA---NAG-------S 125
Query: 202 HYRNVEFLITTGPGPCPQLDNKNIVFGTVLQGLDVVAAIASIPTYKPSERIQKYNELAAF 261
+ +F ITT P P LD K++VFG V++G+ V + ++
Sbjct: 126 NTNGSQFFITTVP--TPHLDGKHVVFGQVIKGMGVAKILENVEVKG-------------- 169
Query: 262 IGDKRADTARAIWNRPLKTVYISDCGELK 290
+P K I++CGELK
Sbjct: 170 -------------EKPAKLCVIAECGELK 185
|
| >2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Length = 234 | Back alignment and structure |
|---|
| >2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Length = 192 | Back alignment and structure |
|---|
| >1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Length = 177 | Back alignment and structure |
|---|
| >2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Length = 179 | Back alignment and structure |
|---|
| >1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Length = 177 | Back alignment and structure |
|---|
| >2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Length = 173 | Back alignment and structure |
|---|
| >1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Length = 170 | Back alignment and structure |
|---|
| >2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Length = 160 | Back alignment and structure |
|---|
| >2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Length = 185 | Back alignment and structure |
|---|
| >3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Length = 188 | Back alignment and structure |
|---|
| >3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Length = 201 | Back alignment and structure |
|---|
| >3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Length = 184 | Back alignment and structure |
|---|
| >1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Length = 229 | Back alignment and structure |
|---|
| >2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Length = 203 | Back alignment and structure |
|---|
| >2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Length = 196 | Back alignment and structure |
|---|
| >3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} PDB: 3o7t_A Length = 164 | Back alignment and structure |
|---|
| >2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Length = 165 | Back alignment and structure |
|---|
| >2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Length = 172 | Back alignment and structure |
|---|
| >2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 176 | Back alignment and structure |
|---|
| >2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Length = 166 | Back alignment and structure |
|---|
| >2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Length = 172 | Back alignment and structure |
|---|
| >3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Length = 193 | Back alignment and structure |
|---|
| >2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Length = 173 | Back alignment and structure |
|---|
| >2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Length = 161 | Back alignment and structure |
|---|
| >2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Length = 172 | Back alignment and structure |
|---|
| >2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Length = 186 | Back alignment and structure |
|---|
| >1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 197 | Back alignment and structure |
|---|
| >3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 232 | Back alignment and structure |
|---|
| >2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Length = 185 | Back alignment and structure |
|---|
| >1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Length = 191 | Back alignment and structure |
|---|
| >3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Length = 369 | Back alignment and structure |
|---|
| >1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Length = 166 | Back alignment and structure |
|---|
| >1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Length = 164 | Back alignment and structure |
|---|
| >3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} PDB: 3t1u_A* Length = 167 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 306 | |||
| 2wfi_A | 179 | Peptidyl-prolyl CIS-trans isomerase G; phosphoprot | 100.0 | |
| 2r99_A | 173 | Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i | 100.0 | |
| 1a58_A | 177 | Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala | 100.0 | |
| 3ich_A | 188 | Peptidyl-prolyl CIS-trans isomerase B; beta sandwi | 100.0 | |
| 1qng_A | 170 | Peptidyl-prolyl CIS-trans isomerase; isomerase-imm | 100.0 | |
| 1mzw_A | 177 | Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc | 100.0 | |
| 2he9_A | 192 | NK-tumor recognition protein; cyclosporin, isomera | 100.0 | |
| 2haq_A | 172 | Cyclophilin; rotamase, proline, isomerase, CIS-tra | 100.0 | |
| 2z6w_A | 165 | Peptidyl-prolyl CIS-trans isomerase; isomerase-imm | 100.0 | |
| 2cmt_A | 172 | Peptidyl-prolyl CIS-trans isomerase E; rotamase ac | 100.0 | |
| 2igv_A | 173 | Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 | 100.0 | |
| 3pmp_A | 164 | Cyclophilin A; peptidyl prolyl isomerase, isomeras | 100.0 | |
| 4fru_A | 185 | Cyclophilin B, peptidyl-prolyl CIS-trans isomerase | 100.0 | |
| 3rdd_A | 184 | Peptidyl-prolyl CIS-trans isomerase A; beta barrel | 100.0 | |
| 2poy_A | 186 | Peptidyl-prolyl CIS-trans isomerase; isomerase-imm | 100.0 | |
| 3k2c_A | 193 | Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, | 100.0 | |
| 1z81_A | 229 | Cyclophilin; structural genomics, structural genom | 100.0 | |
| 2c3b_A | 172 | Ppiase, cyclophilin; isomerase, 3D domain swapping | 100.0 | |
| 2ose_A | 234 | Probable peptidyl-prolyl CIS-trans isomerase; cycl | 100.0 | |
| 2ok3_A | 161 | Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b | 100.0 | |
| 2poe_A | 185 | Cyclophilin-like protein, putative; cryptosporidiu | 100.0 | |
| 2fu0_A | 160 | Cyclophilin, putative; PFE0505W, cyclosporin-bindi | 100.0 | |
| 2x7k_A | 166 | Peptidyl-prolyl CIS-trans isomerase-like 1; isomer | 100.0 | |
| 1zkc_A | 197 | Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr | 100.0 | |
| 3bo7_A | 201 | Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; | 100.0 | |
| 2b71_A | 196 | Cyclophilin-like protein; structural genomics, str | 100.0 | |
| 2a2n_A | 176 | Peptidylprolyl isomerase domain and WD repeat CON; | 100.0 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 100.0 | |
| 2k7n_A | 203 | Peptidyl-prolyl CIS-trans isomerase-like 1; beta b | 100.0 | |
| 1w74_A | 191 | Peptidyl-prolyl CIS-trans isomerase A; cyclophilin | 100.0 | |
| 2hq6_A | 185 | Serologically defined colon cancer antigen 10; pro | 100.0 | |
| 1lop_A | 164 | Cyclophilin A; rotamase, isomerase-isomerase inhib | 100.0 | |
| 1v9t_A | 166 | Cyclophilin B; beta barrel, isomerase-isomerase in | 100.0 | |
| 3bkp_A | 232 | Cyclophilin; malaria, isomerase, structural GENO s | 100.0 | |
| 3s6m_A | 167 | Peptidyl-prolyl CIS-trans isomerase; seattle struc | 100.0 | |
| 3rfy_A | 369 | Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; | 100.0 | |
| 3kop_A | 188 | Uncharacterized protein; protein with A cyclophili | 90.55 |
| >2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A | Back alignment and structure |
|---|
Probab=100.00 E-value=8.8e-51 Score=355.37 Aligned_cols=163 Identities=28% Similarity=0.531 Sum_probs=150.1
Q ss_pred CCCceEEEEEEeCCccCCCCCCCCCcCCCCccceeEEEEecCCCCchHHHHHHHHhcc----------CccccCceeEee
Q 021845 63 TITDSIFMDFSLCPTFFRPEGTDPTLCSSPVPLGRLIIGLYGHLAPITVSNFKAMCSS----------RSLYRNTLVHKI 132 (306)
Q Consensus 63 ~~~~~v~~di~i~~~~~~~~~~~~~~~~~~t~~GrIvIeL~~d~aP~tv~NF~~L~~~----------~~~Y~gt~FhRV 132 (306)
..+++|||||++ ++|++|+|+||||.+.||+||+||++||++ .++|+|+.||||
T Consensus 7 ~~~~~vf~di~i----------------~~t~~G~i~ieL~~~~aP~t~~NF~~L~~g~~g~~~~~~~~~~Y~g~~FhRv 70 (179)
T 2wfi_A 7 VQRPRCFFDIAI----------------NNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRV 70 (179)
T ss_dssp -CCCEEEEEEEE----------------TTEEEEEEEEEECTTTCHHHHHHHHHHHHCTTCBCTTTCSBSCCTTCBEEEE
T ss_pred CCCCeEEEEEEE----------------CCccceEEEEEEcCCCCChHHHHHHHHhcCCcCcccccccCCeECCCEEEEE
Confidence 358899999999 899999999999999999999999999972 268999999999
Q ss_pred cCCeEEEcCCCCCcCCCCCCCccCCCCCCCCCCCCCCCCCcccccCCCceEEEEecCCCCCCCCCCCCCCCccceEEEEc
Q 021845 133 FPGQFFLAGRQGLSRRDSKLGELHPPLDFLPPNTDTLRPNAFLLKHSRGGVVSLCLSENDDDPDVKLDPHYRNVEFLITT 212 (306)
Q Consensus 133 i~~f~iq~Gd~~~~~~~g~~g~s~~~~~~~~~~g~~~~de~~~l~h~~~G~lsma~~~~~~~~~~~~~p~t~gSqFfItl 212 (306)
+++||||+||+ ..+++.+|.+++ +..|+||++.++|+++|+|||||. +||+|+||||||+
T Consensus 71 i~~f~iQgGd~--~~~~g~gg~si~--------g~~f~dE~~~~~h~~~G~lsMAn~----------gp~tngSQFfIt~ 130 (179)
T 2wfi_A 71 VKDFMVQGGDF--SEGNGRGGESIY--------GGFFEDESFAVKHNKEFLLSMANR----------GKDTNGSQFFITT 130 (179)
T ss_dssp ETTTEEEECCT--TTSSSSCCCCTT--------SSCBCCCCCCSCCCSTTEEEECCS----------STTCBCSCEEEES
T ss_pred ECCCEEEcccc--cCCCCCCCCccc--------CCcccccccCcCcCCCeEEEEEeC----------CCCCcceEEEEEc
Confidence 99999999997 457788888876 466899999999999999999998 7999999999999
Q ss_pred CCCCCCCCCCCCcEEEEEEcCHHHHHHHHcCCCCCCchhhhhhhhhHhhhcccccccccccCCCCCCcEEEeeeeEe
Q 021845 213 GPGPCPQLDNKNIVFGTVLQGLDVVAAIASIPTYKPSERIQKYNELAAFIGDKRADTARAIWNRPLKTVYISDCGEL 289 (306)
Q Consensus 213 ~~~~~p~LDg~~tVFGrVv~GmdVl~kI~~~~t~~~~~~~~~~~~~a~~~gd~~a~~~~~~~~~P~~~V~I~~cg~l 289 (306)
.+ ++|||++|+|||||++|||||++|++++++. +++|.++|+|.+||+|
T Consensus 131 ~~--~~~LDg~~tVFG~Vv~G~dvv~~I~~~~t~~--------------------------~~~P~~~v~I~~~G~l 179 (179)
T 2wfi_A 131 KP--TPHLDGHHVVFGQVISGQEVVREIENQKTDA--------------------------ASKPFAEVRILSCGEL 179 (179)
T ss_dssp SC--CGGGTTTSCEEEEEEECHHHHHHHHTCCBCT--------------------------TSCBSSCEEEEEEEEC
T ss_pred CC--CcccCCCeeEEEEEeCCHHHHHHHHcCCCCC--------------------------CCCCCCCeEEEeCeeC
Confidence 98 9999999999999999999999999999874 5899999999999986
|
| >2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A | Back alignment and structure |
|---|
| >1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* | Back alignment and structure |
|---|
| >3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* | Back alignment and structure |
|---|
| >1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* | Back alignment and structure |
|---|
| >1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A | Back alignment and structure |
|---|
| >2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A | Back alignment and structure |
|---|
| >2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... | Back alignment and structure |
|---|
| >2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A | Back alignment and structure |
|---|
| >2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A | Back alignment and structure |
|---|
| >3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} SCOP: b.62.1.1 PDB: 3o7t_A | Back alignment and structure |
|---|
| >4fru_A Cyclophilin B, peptidyl-prolyl CIS-trans isomerase; cyclophilin-type ppiase, peptidyl-prolyl CIS-trans isomerase chaperone, foldase; HET: ME2 PEG; 1.10A {Equus caballus} PDB: 4frv_A* 3ich_A 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* | Back alignment and structure |
|---|
| >3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} | Back alignment and structure |
|---|
| >2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* | Back alignment and structure |
|---|
| >3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} | Back alignment and structure |
|---|
| >2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* | Back alignment and structure |
|---|
| >2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A | Back alignment and structure |
|---|
| >2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A | Back alignment and structure |
|---|
| >1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A | Back alignment and structure |
|---|
| >1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A | Back alignment and structure |
|---|
| >3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} SCOP: b.62.1.1 PDB: 3t1u_A* | Back alignment and structure |
|---|
| >3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3kop_A Uncharacterized protein; protein with A cyclophilin-like fold, structural genomics, J center for structural genomics, JCSG; 1.90A {Arthrobacter SP} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 306 | ||||
| d2cfea1 | 162 | b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s | 1e-18 | |
| d1ihga2 | 195 | b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain | 8e-18 | |
| d2igva1 | 172 | b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caeno | 8e-18 | |
| d1qnga_ | 170 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium | 3e-17 | |
| d1a33a_ | 174 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode ( | 8e-17 | |
| d2c3ba1 | 171 | b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Asper | 1e-15 | |
| d2z6wa1 | 164 | b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl c | 2e-15 | |
| d2r99a1 | 161 | b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl | 3e-15 | |
| d1h0pa_ | 182 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabd | 4e-15 | |
| d1xo7a_ | 166 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosom | 7e-15 | |
| d1qoia_ | 173 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Hom | 1e-14 | |
| d2rmca_ | 182 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus | 2e-14 | |
| d1z81a1 | 186 | b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plas | 1e-13 | |
| d1zkca1 | 178 | b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans iso | 1e-13 | |
| d2b71a1 | 169 | b.62.1.1 (A:23-191) Cyclophilin-like protein PY006 | 2e-13 | |
| d2ok3a1 | 159 | b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B | 3e-11 | |
| d1xwna1 | 166 | b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isome | 5e-11 | |
| d1v9ta_ | 166 | b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase | 8e-11 | |
| d2fu0a1 | 155 | b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w { | 1e-10 | |
| d2a2na1 | 164 | b.62.1.1 (A:483-646) Peptidylprolyl isomerase doma | 1e-09 | |
| d1w74a_ | 171 | b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase | 2e-09 | |
| d1lopa_ | 164 | b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase | 3e-08 |
| >d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Length = 162 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Cyclophilin-like superfamily: Cyclophilin-like family: Cyclophilin (peptidylprolyl isomerase) domain: Cyclophilin-like allergen Mal s 6 species: Malassezia sympodialis [TaxId: 76777]
Score = 79.4 bits (195), Expect = 1e-18
Identities = 43/196 (21%), Positives = 73/196 (37%), Gaps = 51/196 (26%)
Query: 94 PLGRLIIGLYGHLAPITVSNFKAMCSSRSL--YRNTLVHKIFPGQFFLAGRQGLSRRDSK 151
PLG + L+ + P T +NF+A+C+ Y + H++ P G + +
Sbjct: 14 PLGTIKFKLFDDVVPKTAANFRALCTGEKGFGYAGSHFHRVIPDFMLQGG--DFTAGNGT 71
Query: 152 LGELHPPLDFLPPNTDTLRPNAFLLKHSRGGVVSLCLSENDDDPDVKLDPHYRNVEFLIT 211
G+ F N F LKH++ G++S+ P+ +F IT
Sbjct: 72 GGKSIYGAKFADEN--------FQLKHNKPGLLSM----------ANAGPNTNGSQFFIT 113
Query: 212 TGPGPCPQLDNKNIVFGTVLQGLDVVAAIASIPTYKPSERIQKYNELAAFIGDKRADTAR 271
LD K++VFG V+ G++VV AI + +
Sbjct: 114 --TVVTSWLDGKHVVFGEVIDGMNVVKAIEAEGSGS------------------------ 147
Query: 272 AIWNRPLKTVYISDCG 287
+P + I+ CG
Sbjct: 148 ---GKPRSRIEIAKCG 160
|
| >d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Length = 195 | Back information, alignment and structure |
|---|
| >d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Length = 172 | Back information, alignment and structure |
|---|
| >d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Length = 170 | Back information, alignment and structure |
|---|
| >d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Length = 174 | Back information, alignment and structure |
|---|
| >d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Length = 171 | Back information, alignment and structure |
|---|
| >d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 164 | Back information, alignment and structure |
|---|
| >d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 161 | Back information, alignment and structure |
|---|
| >d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Length = 182 | Back information, alignment and structure |
|---|
| >d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Length = 166 | Back information, alignment and structure |
|---|
| >d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Length = 173 | Back information, alignment and structure |
|---|
| >d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Length = 182 | Back information, alignment and structure |
|---|
| >d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Length = 186 | Back information, alignment and structure |
|---|
| >d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Length = 178 | Back information, alignment and structure |
|---|
| >d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Length = 169 | Back information, alignment and structure |
|---|
| >d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Length = 159 | Back information, alignment and structure |
|---|
| >d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 | Back information, alignment and structure |
|---|
| >d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 166 | Back information, alignment and structure |
|---|
| >d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Length = 155 | Back information, alignment and structure |
|---|
| >d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 164 | Back information, alignment and structure |
|---|
| >d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 | Back information, alignment and structure |
|---|
| >d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 164 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 306 | |||
| d2igva1 | 172 | Cyclophilin (eukaryotic) {Caenorhabditis elegans, | 100.0 | |
| d2z6wa1 | 164 | Mitochondrial peptidyl-prolyl cis-trans isomerase, | 100.0 | |
| d1h0pa_ | 182 | Cyclophilin (eukaryotic) {Caenorhabditis elegans, | 100.0 | |
| d2r99a1 | 161 | Mitochondrial peptidyl-prolyl cis-trans isomerase, | 100.0 | |
| d2rmca_ | 182 | Cyclophilin (eukaryotic) {Mouse (Mus musculus), va | 100.0 | |
| d1xo7a_ | 166 | Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId | 100.0 | |
| d1qoia_ | 173 | Cyclophilin (eukaryotic) {Human (Homo sapiens), U4 | 100.0 | |
| d1ihga2 | 195 | Cyclophilin 40 isomerase domain {Cow (Bos taurus) | 100.0 | |
| d1qnga_ | 170 | Cyclophilin (eukaryotic) {Plasmodium falciparum [T | 100.0 | |
| d2cfea1 | 162 | Cyclophilin-like allergen Mal s 6 {Malassezia symp | 100.0 | |
| d1a33a_ | 174 | Cyclophilin (eukaryotic) {Nematode (Brugia malayi) | 100.0 | |
| d1z81a1 | 186 | Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId | 100.0 | |
| d2ok3a1 | 159 | Cyclophilin-like protein PPIL3B {Human (Homo sapie | 100.0 | |
| d2c3ba1 | 171 | Cyclophilin (eukaryotic) {Aspergillus fumigatus [T | 100.0 | |
| d1zkca1 | 178 | Peptidyl-prolyl cis-trans isomerase-like 2, Cyclop | 100.0 | |
| d2fu0a1 | 155 | Putative cyclophilin PFE0505w {Plasmodium falcipar | 100.0 | |
| d1xwna1 | 166 | Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 | 100.0 | |
| d2b71a1 | 169 | Cyclophilin-like protein PY00693 {Plasmodium yoeli | 100.0 | |
| d1v9ta_ | 166 | Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche | 100.0 | |
| d1w74a_ | 171 | Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycob | 100.0 | |
| d2a2na1 | 164 | Peptidylprolyl isomerase domain and WD repeat-cont | 100.0 | |
| d1lopa_ | 164 | Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche | 100.0 |
| >d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Cyclophilin-like superfamily: Cyclophilin-like family: Cyclophilin (peptidylprolyl isomerase) domain: Cyclophilin (eukaryotic) species: Caenorhabditis elegans, isoform 3 [TaxId: 6239]
Probab=100.00 E-value=2.6e-45 Score=316.28 Aligned_cols=161 Identities=31% Similarity=0.583 Sum_probs=144.8
Q ss_pred CceEEEEEEeCCccCCCCCCCCCcCCCCccceeEEEEecCCCCchHHHHHHHHhcc---------CccccCceeEeecCC
Q 021845 65 TDSIFMDFSLCPTFFRPEGTDPTLCSSPVPLGRLIIGLYGHLAPITVSNFKAMCSS---------RSLYRNTLVHKIFPG 135 (306)
Q Consensus 65 ~~~v~~di~i~~~~~~~~~~~~~~~~~~t~~GrIvIeL~~d~aP~tv~NF~~L~~~---------~~~Y~gt~FhRVi~~ 135 (306)
+++|||||+| +++++|+|+||||.+.||+||+||++||++ .++|+++.||||+++
T Consensus 3 ~~~v~~Di~i----------------~~~~~G~i~ieL~~~~aP~tv~nF~~L~~~~~~~~~~~k~~~y~~~~f~rv~~~ 66 (172)
T d2igva1 3 RSKVFFDITI----------------GGKASGRIVMELYDDVVPKTAGNFRALCTGENGIGKSGKPLHFKGSKFHRIIPN 66 (172)
T ss_dssp CCEEEEEEEE----------------TTEEEEEEEEEECTTTCHHHHHHHHHHHHTTTCBCTTSSBSCCTTCBCCEEETT
T ss_pred CCEEEEEEEE----------------CCEeccEEEEEEcCCCCcHHHHHHHHHHhccccccccCcccccCCcceeEEEec
Confidence 6899999999 899999999999999999999999999974 268999999999999
Q ss_pred eEEEcCCCCCcCCCCCCCccCCCCCCCCCCCCCCCCCcccccCCCceEEEEecCCCCCCCCCCCCCCCccceEEEEcCCC
Q 021845 136 QFFLAGRQGLSRRDSKLGELHPPLDFLPPNTDTLRPNAFLLKHSRGGVVSLCLSENDDDPDVKLDPHYRNVEFLITTGPG 215 (306)
Q Consensus 136 f~iq~Gd~~~~~~~g~~g~s~~~~~~~~~~g~~~~de~~~l~h~~~G~lsma~~~~~~~~~~~~~p~t~gSqFfItl~~~ 215 (306)
+++|+|+. ..+++.++..++ +..+++|.....|+.+|+|+|++. ++++++|||||++++
T Consensus 67 ~~i~~G~~--~~~~~~~~~~~~--------~~~~~~e~~~~~~~~~G~lsma~~----------~~~~~~sqFfIt~~~- 125 (172)
T d2igva1 67 FMIQGGDF--TRGNGTGGESIY--------GEKFPDENFKEKHTGPGVLSMANA----------GPNTNGSQFFLCTVK- 125 (172)
T ss_dssp TEEEECCT--TTSSSSCCCBTT--------BSCBCCCCCCSCCCSTTEEEECCS----------STTCBSSCEEEESSC-
T ss_pred ceEEcCCc--cCCCCCCCcccC--------CCccCccccccccCCCcEEEEeec----------CCCCcCceeEeeecC-
Confidence 99999997 355555555443 456788888889999999999997 799999999999998
Q ss_pred CCCCCCCCCcEEEEEEcCHHHHHHHHcCCCCCCchhhhhhhhhHhhhcccccccccccCCCCCCcEEEeeeeEec
Q 021845 216 PCPQLDNKNIVFGTVLQGLDVVAAIASIPTYKPSERIQKYNELAAFIGDKRADTARAIWNRPLKTVYISDCGELK 290 (306)
Q Consensus 216 ~~p~LDg~~tVFGrVv~GmdVl~kI~~~~t~~~~~~~~~~~~~a~~~gd~~a~~~~~~~~~P~~~V~I~~cg~l~ 290 (306)
.++||++|+|||||++|||||++|++++++ .++|+++|+|++||+|+
T Consensus 126 -~~~ld~~~~vFG~Vv~Gmdvl~~I~~~~~~---------------------------~g~P~~~i~I~~cG~l~ 172 (172)
T d2igva1 126 -TEWLDGKHVVFGRVVEGLDVVKAVESNGSQ---------------------------SGKPVKDCMIADCGQLK 172 (172)
T ss_dssp -CGGGTTTSCEEEEEEECHHHHHHHHTTCCT---------------------------TSCCSSCEEEEEEEEEC
T ss_pred -CcccCCceeEEEEEeccHHHHHHHHcCCCC---------------------------CCCCCCCeEEEeccccC
Confidence 999999999999999999999999998775 48999999999999985
|
| >d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} | Back information, alignment and structure |
|---|
| >d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} | Back information, alignment and structure |
|---|
| >d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} | Back information, alignment and structure |
|---|
| >d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} | Back information, alignment and structure |
|---|
| >d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} | Back information, alignment and structure |
|---|
| >d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|