Citrus Sinensis ID: 021875

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300------
MSNSLYSFENDSLPKVRKPYTITKQREKWTEEEHQRFLDALKMYGRGWRQIEEHVGTKTAVQIRSHAQKFFSKVVRESNGSSESSIMPIEIPPPRPKRKPVHPYPRKSVDSLKATSVSNQQENFTSSNALVSDKDRQSPTSVVSAFNSDTLGCAASDQQNGCSSPTSCTTEMHSVNLLPIEKENEYVTSISFPKEEKISTLPAHLSASSNVEELASVSKDSVYPKGDAAAAPSCTSIKLFGRTVLVSDSWKPYSLGADSYKSPISKSSQENLDVDKKILSSQPHQSIWIHIYYLGWFLAIVIHPHI
ccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccEEcccEEEEccccccccccccccccccccccccccccccccccccccccccccEEccccEEEEEEcccc
cccccccccccccccccccEEEccccccccHHHHHHHHHHHHHHccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccEEEEEcEEEEEcccccccccccccccccccccccccccccccccccccccccEEEEccccEEEEEEEcccc
msnslysfendslpkvrkpytitkQREKWTEEEHQRFLDALKMYGRGWRQIEEHVGTKTAVQIRSHAQKFFSKVVresngssessimpieippprpkrkpvhpyprksvdslkatsvsnqqenftssnalvsdkdrqsptsvvsafnsdtlgcaasdqqngcssptscttemhsvnllpiekeneyvtsisfpkeekistlpahlsassNVEELasvskdsvypkgdaaaapsctsiklfgrtvlvsdswkpyslgadsykspiskssqenldvdkkilssqphqsiWIHIYYLGWFLAIVIHPHI
msnslysfendslpkvrkpytitkqrekwteeeHQRFLDALKMYGRGWRQIEEHVGTKTAVQIRSHAQKFFSKVvresngssessimpieippprpkrkpvhPYPRKSVDSlkatsvsnqqenftssnalvsdkdrqSPTSVVSAFNSDTLGCAASDQQNGCSSPTSCTTEMHSVNLLPIEKENEYVTSISFPKEEKISTLPAHLSASSNVEELASVSKDSVYPKGDaaaapsctsiklFGRTVLVSDSWKPYSLGADSYKSPISKSSQENLDVDKKILSSQPHQSIWIHIYYLGWFLAIVIHPHI
MSNSLYSFENDSLPKVRKPYTITKQREKWTEEEHQRFLDALKMYGRGWRQIEEHVGTKTAVQIRSHAQKFFSKVVRESNGSSESSimpieippprpkrkpvhpyprkSVDSLKATSVSNQQENFTSSNALVSDKDRQSPTSVVSAFNSDTLGCAASDQQNGCSSPTSCTTEMHSVNLLPIEKENEYVTSISFPKEEKISTLPAHLSASSNVEELASVSKDSVYPKGDAAAAPSCTSIKLFGRTVLVSDSWKPYSLGADSYKSPISKSSQENLDVDKKILSSQPHQSIWIHIYYLGWFLAIVIHPHI
****************************W***EHQRFLDALKMYGRGWRQIEEHVGTKTAVQIRSHAQKFFS********************************************************************************************************LL*****************************************************PSCTSIKLFGRTVLVSDSWKPYSL*****************************QSIWIHIYYLGWFLAIVIH***
*********************************HQRFLDALKMYGRGWRQIEEHVGTKTAVQIRSHAQKFF***************************************************************************************************************************************************************************************************************************IYYLGWFLAIVIHP**
********ENDSLPKVRKPYTITKQREKWTEEEHQRFLDALKMYGRGWRQIEEHVGTKTAVQIRSHAQKFFSK************IMPIEIPPPR************SVDSLKATSVSNQQENFTSSNA************VVSAFNSDTLGCA**************TTEMHSVNLLPIEKENEYVTSISFPKEEKISTLPAHLSASSNVEELASVSKDSVYPKGDAAAAPSCTSIKLFGRTVLVSDSWKPYSLGADSYKSPISKSSQENLDVDKKILSSQPHQSIWIHIYYLGWFLAIVIHPHI
****************RKPYTITKQREKWTEEEHQRFLDALKMYGRGWRQIEEHVGTKTAVQIRSHAQKFFSKVVRES**********IEIPPPR******************************************************************************************************************************************CTSIKLFGRTVLVSDS**********************************HQSIWIHIYYLGWFLAIVIHPH*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNSLYSFENDSLPKVRKPYTITKQREKWTEEEHQRFLDALKMYGRGWRQIEEHVGTKTAVQIRSHAQKFFSKVVRESNGSSESSIMPIEIPPPRPKRKPVHPYPRKSVDSLKATSVSNQQENFTSSNALVSDKDRQSPTSVVSAFNSDTLGCAASDQQNGCSSPTSCTTEMHSVNLLPIEKENEYVTSISFPKEEKISTLPAHLSASSNVEELASVSKDSVYPKGDAAAAPSCTSIKLFGRTVLVSDSWKPYSLGADSYKSPISKSSQENLDVDKKILSSQPHQSIWIHIYYLGWFLAIVIHPHI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query306 2.2.26 [Sep-21-2011]
Q6R0H1 645 Protein LHY OS=Arabidopsi no no 0.310 0.147 0.690 2e-28
Q6R0H0287 Transcription factor ASG4 no no 0.323 0.344 0.560 4e-28
P92973 608 Protein CCA1 OS=Arabidops no no 0.415 0.208 0.562 1e-27
Q54IF9 423 Myb-like protein G OS=Dic yes no 0.277 0.200 0.580 2e-27
Q869R9734 Myb-like protein J OS=Dic no no 0.183 0.076 0.438 5e-10
Q54Z40 1217 Myb-like protein H OS=Dic no no 0.173 0.043 0.509 6e-09
Q54HX6 977 Myb-like protein I OS=Dic no no 0.199 0.062 0.435 5e-08
Q8S9H7307 Transcription factor DIVA N/A no 0.245 0.244 0.4 6e-07
Q5RGA4 822 Histone H2A deubiquitinas yes no 0.241 0.090 0.337 5e-06
Q2V9B0297 Transcription factor MYB1 N/A no 0.156 0.161 0.5 2e-05
>sp|Q6R0H1|LHY_ARATH Protein LHY OS=Arabidopsis thaliana GN=LHY PE=1 SV=2 Back     alignment and function desciption
 Score =  126 bits (316), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 81/97 (83%), Gaps = 2/97 (2%)

Query: 13  LPKVRKPYTITKQREKWTEEEHQRFLDALKMYGRGWRQIEEHVGTKTAVQIRSHAQKFFS 72
           L K RKPYTITKQRE+WTE+EH+RFL+AL++YGR W++IEEH+GTKTAVQIRSHAQKFF+
Sbjct: 11  LAKARKPYTITKQRERWTEDEHERFLEALRLYGRAWQRIEEHIGTKTAVQIRSHAQKFFT 70

Query: 73  KVVRES--NGSSESSIMPIEIPPPRPKRKPVHPYPRK 107
           K+ +E+   G      + IEIPPPRPKRKP  PYPRK
Sbjct: 71  KLEKEAEVKGIPVCQALDIEIPPPRPKRKPNTPYPRK 107
Transcription factor involved in the circadian clock. Binds to the promoter region of APRR1/TOC1 and TCP21/CHE to repress their transcription. Represses both CCA1 and itself.
Arabidopsis thaliana (taxid: 3702)
>sp|Q6R0H0|ASG4_ARATH Transcription factor ASG4 OS=Arabidopsis thaliana GN=ASG4 PE=2 SV=1 Back     alignment and function description
>sp|P92973|CCA1_ARATH Protein CCA1 OS=Arabidopsis thaliana GN=CCA1 PE=1 SV=1 Back     alignment and function description
>sp|Q54IF9|MYBG_DICDI Myb-like protein G OS=Dictyostelium discoideum GN=mybG PE=3 SV=1 Back     alignment and function description
>sp|Q869R9|MYBJ_DICDI Myb-like protein J OS=Dictyostelium discoideum GN=mybJ PE=3 SV=1 Back     alignment and function description
>sp|Q54Z40|MYBH_DICDI Myb-like protein H OS=Dictyostelium discoideum GN=mybH PE=3 SV=1 Back     alignment and function description
>sp|Q54HX6|MYBI_DICDI Myb-like protein I OS=Dictyostelium discoideum GN=mybI PE=3 SV=1 Back     alignment and function description
>sp|Q8S9H7|DIV_ANTMA Transcription factor DIVARICATA OS=Antirrhinum majus GN=DIVARICATA PE=2 SV=1 Back     alignment and function description
>sp|Q5RGA4|MYSM1_DANRE Histone H2A deubiquitinase MYSM1 OS=Danio rerio GN=mysm1 PE=2 SV=2 Back     alignment and function description
>sp|Q2V9B0|MY1R1_SOLTU Transcription factor MYB1R1 OS=Solanum tuberosum PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query306
224125856 472 predicted protein [Populus trichocarpa] 0.918 0.595 0.587 6e-75
224118068 487 predicted protein [Populus trichocarpa] 0.892 0.560 0.593 2e-73
110931850321 MYB transcription factor MYB131 [Glycine 0.774 0.738 0.617 4e-72
356560061 477 PREDICTED: uncharacterized protein LOC77 0.944 0.605 0.55 8e-70
302398987 461 MYBR domain class transcription factor [ 0.947 0.629 0.556 2e-66
356531046 466 PREDICTED: uncharacterized protein LOC10 0.862 0.566 0.584 8e-65
356531048 450 PREDICTED: uncharacterized protein LOC10 0.859 0.584 0.578 1e-63
449507174 480 PREDICTED: uncharacterized LOC101217341 0.813 0.518 0.578 2e-60
449439603 490 PREDICTED: uncharacterized protein LOC10 0.813 0.508 0.578 2e-60
255570631 463 conserved hypothetical protein [Ricinus 0.839 0.555 0.498 8e-49
>gi|224125856|ref|XP_002329734.1| predicted protein [Populus trichocarpa] gi|222870642|gb|EEF07773.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  286 bits (733), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 172/293 (58%), Positives = 209/293 (71%), Gaps = 12/293 (4%)

Query: 3   NSLYSFENDSLPKVRKPYTITKQREKWTEEEHQRFLDALKMYGRGWRQIEEHVGTKTAVQ 62
           N L SF +D++PKVRKPYTITKQREKWTEEEHQRFL+ALK+YGRGWR+I+EHVGTKTAVQ
Sbjct: 38  NELNSFGSDNIPKVRKPYTITKQREKWTEEEHQRFLEALKLYGRGWRKIQEHVGTKTAVQ 97

Query: 63  IRSHAQKFFSKVVRESNGSSESSIMPIEIPPPRPKRKPVHPYPRKSVDSLKATSVSNQQE 122
           IRSHAQK FSKVV ES+G +ESS+ PIEIPPPRPKRKP HPYPRKSVD  K T  S+Q +
Sbjct: 98  IRSHAQKIFSKVVWESSGGNESSLKPIEIPPPRPKRKPAHPYPRKSVDIRKGTPASSQLD 157

Query: 123 NFTSSNALVSDKDRQSPTSVVSAFNSDTLGCAASDQQNGCSSPTSCTTEMHSVNLLPIEK 182
              S N+  S+KD  SPTSV+SA  SDTLG A S+Q N CSSPTSCTT+MHS++L P  K
Sbjct: 158 GSPSPNSSASEKDNLSPTSVLSALASDTLGTALSEQHNACSSPTSCTTDMHSISLPPSVK 217

Query: 183 ENEYVTSISFPKEEKISTLPAHLSAS------SNVEELASVSKDSVYPKGDAAAAPSCTS 236
           E E++TS S  +E+K +     +S S      S   EL   S D+V  +GDA    S TS
Sbjct: 218 EAEHLTSNSSREEDKETFSLIEMSCSPLEKFLSKKFELG--SDDTVCAEGDATKEASSTS 275

Query: 237 IKLFGRTVLVSDSWKPYSLGADSYKSPISKSSQENLDVDKKILSSQPHQSIWI 289
           IKLFG TV+V+ S K    GA+   S  S  +Q+N D DK+    +P Q++ +
Sbjct: 276 IKLFGMTVMVAASHKKSPPGAEFVLSMTSNENQDNADTDKE----KPAQTLLL 324

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224118068|ref|XP_002317724.1| predicted protein [Populus trichocarpa] gi|222858397|gb|EEE95944.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|110931850|gb|ABH02924.1| MYB transcription factor MYB131 [Glycine max] Back     alignment and taxonomy information
>gi|356560061|ref|XP_003548314.1| PREDICTED: uncharacterized protein LOC778089 [Glycine max] Back     alignment and taxonomy information
>gi|302398987|gb|ADL36788.1| MYBR domain class transcription factor [Malus x domestica] Back     alignment and taxonomy information
>gi|356531046|ref|XP_003534089.1| PREDICTED: uncharacterized protein LOC100101861 isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356531048|ref|XP_003534090.1| PREDICTED: uncharacterized protein LOC100101861 isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|449507174|ref|XP_004162953.1| PREDICTED: uncharacterized LOC101217341 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449439603|ref|XP_004137575.1| PREDICTED: uncharacterized protein LOC101217341 [Cucumis sativus] Back     alignment and taxonomy information
>gi|255570631|ref|XP_002526271.1| conserved hypothetical protein [Ricinus communis] gi|223534402|gb|EEF36108.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query306
TAIR|locus:2014114372 EPR1 "EARLY-PHYTOCHROME-RESPON 0.245 0.201 0.733 6.7e-43
TAIR|locus:2169135287 RVE2 "REVEILLE 2" [Arabidopsis 0.271 0.289 0.698 3.1e-35
TAIR|locus:2167210387 RVE1 "REVEILLE 1" [Arabidopsis 0.248 0.196 0.75 5e-35
TAIR|locus:504955668336 AT3G10113 [Arabidopsis thalian 0.245 0.223 0.733 4.3e-32
TAIR|locus:2200970 645 LHY "LATE ELONGATED HYPOCOTYL" 0.215 0.102 0.742 7.8e-26
TAIR|locus:2044345 608 CCA1 "circadian clock associat 0.222 0.111 0.75 4e-24
TAIR|locus:2151251293 LCL1 "LHY/CCA1-like 1" [Arabid 0.212 0.221 0.611 2.3e-22
TAIR|locus:2025411287 ASG4 "ALTERED SEED GERMINATION 0.261 0.278 0.573 2.4e-21
TAIR|locus:2075049298 RVE8 "REVEILLE 8" [Arabidopsis 0.222 0.228 0.628 2.1e-20
TAIR|locus:2124928303 AT4G01280 [Arabidopsis thalian 0.254 0.257 0.55 3.5e-20
TAIR|locus:2014114 EPR1 "EARLY-PHYTOCHROME-RESPONSIVE1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 316 (116.3 bits), Expect = 6.7e-43, Sum P(2) = 6.7e-43
 Identities = 55/75 (73%), Positives = 69/75 (92%)

Query:    11 DSLPKVRKPYTITKQREKWTEEEHQRFLDALKMYGRGWRQIEEHVGTKTAVQIRSHAQKF 70
             +++ KVRKPYT+TKQREKW+EEEH RFL+A+K+YGRGWRQI+EH+GTKTAVQIRSHAQKF
Sbjct:    61 ENVVKVRKPYTVTKQREKWSEEEHDRFLEAIKLYGRGWRQIQEHIGTKTAVQIRSHAQKF 120

Query:    71 FSKVVRESNGSSESS 85
             FSK+ +E++  SE S
Sbjct:   121 FSKMAQEADSRSEGS 135
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
GO:0009651 "response to salt stress" evidence=IEP
GO:0009723 "response to ethylene stimulus" evidence=IEP
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0007623 "circadian rhythm" evidence=IEP
TAIR|locus:2169135 RVE2 "REVEILLE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167210 RVE1 "REVEILLE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955668 AT3G10113 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200970 LHY "LATE ELONGATED HYPOCOTYL" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2044345 CCA1 "circadian clock associated 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151251 LCL1 "LHY/CCA1-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025411 ASG4 "ALTERED SEED GERMINATION 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075049 RVE8 "REVEILLE 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2124928 AT4G01280 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_scaffold_122000043
hypothetical protein (472 aa)
(Populus trichocarpa)
Predicted Functional Partners:
PtpRR9
pseudo response regulator (541 aa)
      • 0.702
estExt_fgenesh4_pm.C_LG_VI0700
hypothetical protein (664 aa)
      • 0.702
estExt_fgenesh4_pg.C_LG_X0958
hypothetical protein (587 aa)
      • 0.702
estExt_fgenesh4_pg.C_LG_V1131
hypothetical protein (1171 aa)
      • 0.702
estExt_fgenesh4_pg.C_LG_III0902
hypothetical protein (662 aa)
      • 0.683
estExt_fgenesh4_pg.C_1680018
hypothetical protein (922 aa)
      • 0.683

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query306
TIGR0155757 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domai 2e-13
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 9e-12
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 5e-11
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 5e-10
cd1166050 cd11660, SANT_TRF, Telomere repeat binding factor- 1e-04
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 6e-04
>gnl|CDD|130620 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information 
 Score = 63.6 bits (155), Expect = 2e-13
 Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 6/57 (10%)

Query: 24 KQREKWTEEEHQRFLDALKMYGRG-W---RQI-EEHVGTK-TAVQIRSHAQKFFSKV 74
          K R  WTE+ H RFL A++  G   W   ++I E  V    T  Q+ SH QK+  K 
Sbjct: 1  KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLKQ 57

This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif. Length = 57
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|212558 cd11660, SANT_TRF, Telomere repeat binding factor-like DNA-binding domains of the SANT/myb-like family Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 306
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 99.58
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.54
KOG0457438 consensus Histone acetyltransferase complex SAGA/A 99.31
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.23
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.19
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.12
PLN03212249 Transcription repressor MYB5; Provisional 98.91
COG5114432 Histone acetyltransferase complex SAGA/ADA, subuni 98.81
KOG0724335 consensus Zuotin and related molecular chaperones 98.78
PLN03091 459 hypothetical protein; Provisional 98.76
PLN03212249 Transcription repressor MYB5; Provisional 98.7
PLN03091 459 hypothetical protein; Provisional 98.61
KOG0048238 consensus Transcription factor, Myb superfamily [T 98.6
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 98.45
KOG0048238 consensus Transcription factor, Myb superfamily [T 98.43
KOG1279506 consensus Chromatin remodeling factor subunit and 98.31
KOG0049 939 consensus Transcription factor, Myb superfamily [T 97.67
KOG0049 939 consensus Transcription factor, Myb superfamily [T 97.09
PLN03162526 golden-2 like transcription factor; Provisional 96.98
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 96.72
KOG0051607 consensus RNA polymerase I termination factor, Myb 96.59
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 96.53
KOG0051607 consensus RNA polymerase I termination factor, Myb 95.98
KOG4468 782 consensus Polycomb-group transcriptional regulator 95.82
KOG3554 693 consensus Histone deacetylase complex, MTA1 compon 95.61
COG5147 512 REB1 Myb superfamily proteins, including transcrip 95.44
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 95.36
KOG4329445 consensus DNA-binding protein [General function pr 94.89
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 94.79
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 94.76
KOG4167907 consensus Predicted DNA-binding protein, contains 94.53
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 94.04
COG5147 512 REB1 Myb superfamily proteins, including transcrip 93.73
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 93.62
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 93.45
PLN031421033 Probable chromatin-remodeling complex ATPase chain 93.02
smart0042668 TEA TEA domain. 92.75
KOG1194534 consensus Predicted DNA-binding protein, contains 92.46
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 91.75
KOG0724335 consensus Zuotin and related molecular chaperones 91.42
PF01285431 TEA: TEA/ATTS domain family; InterPro: IPR000818 T 90.88
KOG3841455 consensus TEF-1 and related transcription factor, 90.73
PRK13923170 putative spore coat protein regulator protein YlbO 90.07
KOG4282345 consensus Transcription factor GT-2 and related pr 86.23
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information 
Probab=99.58  E-value=3.4e-15  Score=111.06  Aligned_cols=50  Identities=42%  Similarity=0.632  Sum_probs=45.5

Q ss_pred             cCCCCCCHHHHHHHHHHHHHhCcc-h---HHHHHHhC-CC-CHHHHHHHHHHHHHH
Q 021875           24 KQREKWTEEEHQRFLDALKMYGRG-W---RQIEEHVG-TK-TAVQIRSHAQKFFSK   73 (306)
Q Consensus        24 k~r~~WT~EEh~lFLEaLe~yGrg-W---k~IAe~Vg-TR-T~~QVRSHaQKYF~k   73 (306)
                      |.|..||+|||.+||+||+.||.+ |   +.|+++++ +| |..||++|+||||.+
T Consensus         1 k~r~~WT~eeh~~Fl~ai~~~G~g~~a~pk~I~~~~~~~~lT~~qV~SH~QKy~~k   56 (57)
T TIGR01557         1 KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLK   56 (57)
T ss_pred             CCCCCCCHHHHHHHHHHHHHhCCCcccchHHHHHHcCCCCCCHHHHHHHHHHHHcc
Confidence            356789999999999999999995 9   99998776 67 999999999999986

This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by Pfam model pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif.
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03162 golden-2 like transcription factor; Provisional Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] Back     alignment and domain information
>KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>KOG4329 consensus DNA-binding protein [General function prediction only] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>smart00426 TEA TEA domain Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01285 TEA: TEA/ATTS domain family; InterPro: IPR000818 Transcriptional enhancer activators are nuclear proteins that contain a TEA/ATTSdomain, a DNA-binding region of 66-68 amino acids Back     alignment and domain information
>KOG3841 consensus TEF-1 and related transcription factor, TEAD family [Transcription] Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query306
2cu7_A72 Solution Structure Of The Sant Domain Of Human Kiaa 2e-05
>pdb|2CU7|A Chain A, Solution Structure Of The Sant Domain Of Human Kiaa1915 Protein Length = 72 Back     alignment and structure 
Iteration: 1

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/49 (36%), Positives = 33/49 (67%)
Query: 28 KWTEEEHQRFLDALKMYGRGWRQIEEHVGTKTAVQIRSHAQKFFSKVVR 76
          KWT EE + F   L  +GR W +I + +G++T +Q++S+A+++F   V+
Sbjct: 11 KWTIEEKELFEQGLAKFGRRWTKISKLIGSRTVLQVKSYARQYFKNKVK 59

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query306
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 1e-23
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 2e-18
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 1e-17
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 3e-17
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 1e-15
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 2e-14
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 6e-14
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 8e-11
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 4e-09
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 4e-07
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 4e-07
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 3e-06
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 3e-06
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 6e-06
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 7e-06
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 1e-05
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 2e-05
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 4e-05
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 1e-04
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 1e-04
2cjj_A93 Radialis; plant development, DNA-binding protein, 1e-04
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 2e-04
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 3e-04
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 5e-04
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 5e-04
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 6e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 8e-04
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
 Score = 91.0 bits (226), Expect = 1e-23
 Identities = 18/63 (28%), Positives = 35/63 (55%)

Query: 23 TKQREKWTEEEHQRFLDALKMYGRGWRQIEEHVGTKTAVQIRSHAQKFFSKVVRESNGSS 82
          +    KWT EE + F   L  +GR W +I + +G++T +Q++S+A+++F   V+      
Sbjct: 6  SGYSVKWTIEEKELFEQGLAKFGRRWTKISKLIGSRTVLQVKSYARQYFKNKVKCGLDKE 65

Query: 83 ESS 85
            +
Sbjct: 66 TPN 68
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Length = 64 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Length = 482 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Length = 74 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Length = 93 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query306
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.69
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.65
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.63
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.56
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.54
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.49
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 99.45
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.45
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.44
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.43
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.38
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.37
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.36
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.36
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.33
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.01
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 99.3
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.28
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.27
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.22
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.19
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.17
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.16
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.16
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.16
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.16
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.16
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.09
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.08
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.04
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 99.04
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.04
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.98
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 98.98
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 98.97
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.97
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.96
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 98.95
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 98.91
2crg_A70 Metastasis associated protein MTA3; transcription 98.89
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 98.89
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.81
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 98.74
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.64
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 98.62
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.06
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.72
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 97.58
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 97.3
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 96.98
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 95.71
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 96.43
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 96.43
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 96.25
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 95.87
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 94.95
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 94.66
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 94.42
1ig6_A107 MRF-2, modulator recognition factor 2; DNA binding 94.18
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 91.19
2hzd_A82 Transcriptional enhancer factor TEF-1; DNA-binding 90.98
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 85.87
2li6_A116 SWI/SNF chromatin-remodeling complex subunit SWI1; 83.7
2jxj_A96 Histone demethylase jarid1A; ARID domain, chromati 83.58
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
Probab=99.69  E-value=2e-17  Score=128.11  Aligned_cols=63  Identities=25%  Similarity=0.419  Sum_probs=56.9

Q ss_pred             CCCCCCCCCCcccccCCCCCCHHHHHHHHHHHHHhCcchHHHHHHhCCCCHHHHHHHHHHHHH
Q 021875           10 NDSLPKVRKPYTITKQREKWTEEEHQRFLDALKMYGRGWRQIEEHVGTKTAVQIRSHAQKFFS   72 (306)
Q Consensus        10 ~~~~~K~RKPytitk~r~~WT~EEh~lFLEaLe~yGrgWk~IAe~VgTRT~~QVRSHaQKYF~   72 (306)
                      ....+|.++++.....+..||+|||++||+||++||.+|..||++||+||+.|||.||++|+.
T Consensus         2 ssg~~~~~~~~~~~~~~~~WT~eEd~~Ll~~v~~~G~~W~~IA~~v~~RT~~qcr~r~~~~~i   64 (79)
T 2yus_A            2 SSGSSGTLAKSKGASAGREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPI   64 (79)
T ss_dssp             CCSSSCCCCCCCSSCCSCCCCHHHHHHHHHHHHHSSSCHHHHHHHHSSCCHHHHHHHHTTSCC
T ss_pred             CCcccCccCCccccccCCCcCHHHHHHHHHHHHHhCCCHHHHHHHcCCCCHHHHHHHHHHhcc
Confidence            444568888988888999999999999999999999779999999999999999999998743
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>1ig6_A MRF-2, modulator recognition factor 2; DNA binding protein, DNA-binding motif, protein-DNA interaction; NMR {Homo sapiens} SCOP: a.4.3.1 PDB: 2oeh_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2hzd_A Transcriptional enhancer factor TEF-1; DNA-binding, helix-turn-helix, gene regulation; NMR {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>2li6_A SWI/SNF chromatin-remodeling complex subunit SWI1; ligand binding, DNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2jxj_A Histone demethylase jarid1A; ARID domain, chromatin regulator, developmental protein, dioxygenase, iron, metal-binding, nucleus, oxidoreductase; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 306
d1irza_64 a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis th 2e-15
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 8e-14
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 2e-13
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 2e-12
d2crga157 a.4.1.3 (A:8-64) Metastasis associated protein MTA 5e-11
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 5e-11
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 4e-09
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 3e-07
d2cqqa159 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 2e-06
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 8e-06
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 4e-05
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 7e-05
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 1e-04
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 2e-04
d1ofcx152 a.4.1.3 (X:799-850) SANT domain of the nucleosome 0.002
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 0.003
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: GARP response regulators
domain: Arr10-B
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 67.3 bits (164), Expect = 2e-15
 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 5/60 (8%)

Query: 24 KQREKWTEEEHQRFLDALKMYGRGWR---QIEEH--VGTKTAVQIRSHAQKFFSKVVRES 78
          K R  WT E H +FL A+   G       +I +   V   T   + SH QKF   + + S
Sbjct: 5  KPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVALKKVS 64
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 52 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query306
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.61
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.61
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.47
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 99.46
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.45
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.42
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.41
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.39
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.38
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.3
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.24
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.22
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.15
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 99.07
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 98.92
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.63
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.53
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 97.56
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 96.68
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 95.34
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 94.13
d1kkxa_102 Transcription regulator Adr6 (Swi1) {Baker's yeast 89.49
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 86.29
d1ig6a_107 MRF-2 DNA-binding domain {Human (Homo sapiens) [Ta 86.2
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Transcriptional adaptor 2-like, TADA2L, isoform b
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.61  E-value=2.9e-16  Score=109.23  Aligned_cols=45  Identities=31%  Similarity=0.629  Sum_probs=43.0

Q ss_pred             CCCCHHHHHHHHHHHHHhCcc-hHHHHHHhCCCCHHHHHHHHHHHH
Q 021875           27 EKWTEEEHQRFLDALKMYGRG-WRQIEEHVGTKTAVQIRSHAQKFF   71 (306)
Q Consensus        27 ~~WT~EEh~lFLEaLe~yGrg-Wk~IAe~VgTRT~~QVRSHaQKYF   71 (306)
                      ..||.||+.+|+++|++||.+ |..||++||+||+.|||.||++||
T Consensus         2 ~~Wt~eEd~~L~~~v~~~G~~nW~~Ia~~~~~Rt~~Qcr~r~~~~f   47 (47)
T d1x41a1           2 PSWTAQEEMALLEAVMDCGFGNWQDVANQMCTKTKEECEKHYMKYF   47 (47)
T ss_dssp             SSSCHHHHHHHHHHHHHTCTTCHHHHHHHHTTSCHHHHHHHHHHHT
T ss_pred             cCCCHHHHHHHHHHHHHHCCccHHHHHHHcCCCCHHHHHHHHHHhC
Confidence            359999999999999999986 999999999999999999999998
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kkxa_ a.4.3.1 (A:) Transcription regulator Adr6 (Swi1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ig6a_ a.4.3.1 (A:) MRF-2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure