Citrus Sinensis ID: 021948

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-----
MATLGDIGVAATINILSAFAFLSAFAILRIQPINDRVYFPKWYLKGLRSSPLQTGTLVSKFVNLDFRSYLRFLSWMPAALQMPEPELIDHAGLDSAVYLRIYLIGLKIFIPIACLGFAVMVPVNWTNKTLEHSKLKYSNIDLLSISNVPLGSNRFWTHLVMAYVFTFWTCYVLKREYEIVAAMRLHFLASEHRRPDQFTVLVRNVPPDPDESVTQLVEHFFLVNHPDHYLTHQVVNNANKLSELVNKKKKMQNWLDFYQLKYSRNPARKPSTKTGFLGLWGKTVDAIDFYTSKIETLKKEVSGFS
cccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEcccccccccccccccccccccccccccccccccccccHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccccHHHHHHHHHHHHccccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHcccc
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEccHHHHcccccccccccccccEEEcccHHHccccHHHHHHHHcccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEcccccccccccccccccEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccccccHHHHHHHHHHHcccccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcc
matlgdigVAATINILSAFAFLSAFAILRiqpindrvyfpkwylkglrssplqtgtlvSKFVNLDFRSYLRFLSwmpaalqmpepelidhagldSAVYLRIYLIGLKIFIPIACLGFAVMvpvnwtnktlehsklkysnidllsisnvplgsnrFWTHLVMAYVFTFWTCYVLKREYEIVAAMRLHFLasehrrpdqftvlvrnvppdpdesVTQLVEHFFLvnhpdhylthQVVNNANKLSELVNKKKKMQNWLDFYQLkysrnparkpstktgflglwgktvdaIDFYTSKIETLKKEVSGFS
MATLGDIGVAATINILSAFAFLSAFAILRIQPINDRVYFPKWYLKGlrssplqtgTLVSKFVNLDFRSYLRFLSWMPAALQMPEPELIDHAGLDSAVYLRIYLIGLKIFIPIACLGFAVMVPVNWTNKTLEHSKLKYSNIDLLSISNVPLGSNRFWTHLVMAYVFTFWTCYVLKREYEIVAAMRLHFLASEHRRPDQFTVLVRNVPPDPDESVTQLVEHFFLVNHPDHYLTHQVVNNANKLSELVNKKKKMQNWLDFYQLkysrnparkpstktgflglwgkTVDAIDFYTSKIETLkkevsgfs
MATLGDIGVAATINilsafaflsafailRIQPINDRVYFPKWYLKGLRSSPLQTGTLVSKFVNLDFRSYLRFLSWMPAALQMPEPELIDHAGLDSAVYLRIYLIGLKIFIPIACLGFAVMVPVNWTNKTLEHSKLKYSNIDLLSISNVPLGSNRFWTHLVMAYVFTFWTCYVLKREYEIVAAMRLHFLASEHRRPDQFTVLVRNVPPDPDESVTQLVEHFFLVNHPDHYLTHQVVNNANKLSELVNKKKKMQNWLDFYQLKYSRNPARKPSTKTGFLGLWGKTVDAIDFYTSKIETLKKEVSGFS
***LGDIGVAATINILSAFAFLSAFAILRIQPINDRVYFPKWYLKGLRSSPLQTGTLVSKFVNLDFRSYLRFLSWMPAALQMPEPELIDHAGLDSAVYLRIYLIGLKIFIPIACLGFAVMVPVNWTNKTLEHSKLKYSNIDLLSISNVPLGSNRFWTHLVMAYVFTFWTCYVLKREYEIVAAMRLHFLASEHRRPDQFTVLVRNVP****ESVTQLVEHFFLVNHPDHYLTHQVVNNANKLSELVNKKKKMQNWLDFYQLKYSR*******TKTGFLGLWGKTVDAIDFYTSKIET*********
*ATLGDIGVAATINILSAFAFLSAFAILRIQPINDRVYFPKWYL**********************RSYLRFLSWMPAALQMPEPELIDHAGLDSAVYLRIYLIGLKIFIPIACLGFAVMVPVNWTNKTLEHSKLKYSNIDLLSISNVPLGSNRFWTHLVMAYVFTFWTCYVLKREYEIVAAMRLHFLASEHRRPDQFTVLVRNVPPDPDESVTQLVEHFFLVNHPDHYLTHQVVNNANKLSELVNKKKKMQNWLDFYQLKYSRNPARKPSTKTGFLGLWGKTVDAIDFYTSKIETLKKEVSGF*
MATLGDIGVAATINILSAFAFLSAFAILRIQPINDRVYFPKWYLKGLRSSPLQTGTLVSKFVNLDFRSYLRFLSWMPAALQMPEPELIDHAGLDSAVYLRIYLIGLKIFIPIACLGFAVMVPVNWTNKTLEHSKLKYSNIDLLSISNVPLGSNRFWTHLVMAYVFTFWTCYVLKREYEIVAAMRLHFLASEHRRPDQFTVLVRNVPPDPDESVTQLVEHFFLVNHPDHYLTHQVVNNANKLSELVNKKKKMQNWLDFYQLKYSRNPARKPSTKTGFLGLWGKTVDAIDFYTSKIETLKKEVSGFS
**TLGDIGVAATINILSAFAFLSAFAILRIQPINDRVYFPKWYLKGLRSSP*QTGTLVSKFVNLDFRSYLRFLSWMPAALQMPEPELIDHAGLDSAVYLRIYLIGLKIFIPIACLGFAVMVPVNWTNKTLEHSKLKYSNIDLLSISNVPLGSNRFWTHLVMAYVFTFWTCYVLKREYEIVAAMRLHFLASEHRRPDQFTVLVRNVPPDPDESVTQLVEHFFLVNHPDHYLTHQVVNNANKLSELVNKKKKMQNWLDFYQLKYSRNPARKPSTKTGFLGLWGKTVDAIDFYTSKIETLKKEVSGFS
oooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATLGDIGVAATINILSAFAFLSAFAILRIQPINDRVYFPKWYLKGLRSSPLQTGTLVSKFVNLDFRSYLRFLSWMPAALQMPEPELIDHAGLDSAVYLRIYLIGLKIFIPIACLGFAVMVPVNWTNKTLEHSKLKYSNIDLLSISNVPLGSNRFWTHLVMAYVFTFWTCYVLKREYEIVAAMRLHFLASEHRRPDQFTVLVRNVPPDPDESVTQLVEHFFLVNHPDHYLTHQVVNNANKLSELVNKKKKMQNWLDFYQLKYSRNPARKPSTKTGFLGLWGKTVDAIDFYTSKIETLKKEVSGFS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query305 2.2.26 [Sep-21-2011]
O43022 865 Uncharacterized protein C yes no 0.695 0.245 0.252 4e-10
O94886 807 Transmembrane protein 63A yes no 0.714 0.270 0.223 1e-07
Q5R826 807 Transmembrane protein 63A yes no 0.714 0.270 0.215 3e-07
Q9P1W3 806 Transmembrane protein 63C no no 0.704 0.266 0.235 4e-07
Q09809 793 Uncharacterized membrane no no 0.744 0.286 0.207 1e-05
Q91YT8 804 Transmembrane protein 63A yes no 0.721 0.273 0.227 1e-05
Q8CBX0 802 Transmembrane protein 63C no no 0.704 0.268 0.219 0.0001
Q3TWI9 832 Transmembrane protein 63B no no 0.750 0.275 0.233 0.0001
Q5T3F8 832 Transmembrane protein 63B no no 0.380 0.139 0.266 0.0003
>sp|O43022|YGV8_SCHPO Uncharacterized protein C354.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.08c PE=4 SV=1 Back     alignment and function desciption
 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 107/234 (45%), Gaps = 22/234 (9%)

Query: 75  WMPAALQMPEPELIDHAGLDSAVYLRIYLIGLKIFIPIACLGFAVMVPVN--WTNKTLEH 132
           W+     +   + + + G D+ + L        +F+ +A +   +++P+N   TNKTL +
Sbjct: 74  WIEPLWSIKVEDCLYNMGADAVISLLFSRFCRDVFLILAAICCTILIPINIVATNKTLAN 133

Query: 133 SKLKYSNIDLLSISNVPLGSNRFWTHLVMAYVFTFWTCYVLKREYEIVAAMRLHFLASE- 191
           S  + +   L SI NV    N  W H+V+ YVF     ++L R Y+IV  +R  +  S  
Sbjct: 134 SDSQNAYAKL-SIQNVT--GNWTWAHVVICYVFNVLVLFLLARYYQIVMRIRQRYYRSPT 190

Query: 192 -HRRPDQFTVLVRNVPPD--PDESVTQLVEHFFLVNHPDH-YLTHQVVNNANKLSELVNK 247
             +     ++L+ ++P     +  ++ L         P H ++ H + N    L +++ K
Sbjct: 191 YQQSMSSRSLLIMDIPTTMRSNNGLSILASRLKSSEAPMHVHICHAIKN----LPKILKK 246

Query: 248 KKKMQNWLDFYQLKYSRNPARKPS------TKTGFLGLWGKTVDAIDFYTSKIE 295
                  L+    K+ +NP + P        K G L    + VDAID+Y++KIE
Sbjct: 247 HDNAVRSLEAVLAKFFKNPKKLPDDRPVRRVKQGLLT--SEKVDAIDYYSAKIE 298

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
>sp|O94886|TM63A_HUMAN Transmembrane protein 63A OS=Homo sapiens GN=TMEM63A PE=2 SV=3 Back     alignment and function description
>sp|Q5R826|TM63A_PONAB Transmembrane protein 63A OS=Pongo abelii GN=TMEM63A PE=2 SV=1 Back     alignment and function description
>sp|Q9P1W3|TM63C_HUMAN Transmembrane protein 63C OS=Homo sapiens GN=TMEM63C PE=2 SV=1 Back     alignment and function description
>sp|Q09809|YAB9_SCHPO Uncharacterized membrane protein C2G11.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 Back     alignment and function description
>sp|Q91YT8|TM63A_MOUSE Transmembrane protein 63A OS=Mus musculus GN=Tmem63a PE=2 SV=1 Back     alignment and function description
>sp|Q8CBX0|TM63C_MOUSE Transmembrane protein 63C OS=Mus musculus GN=Tmem63c PE=2 SV=1 Back     alignment and function description
>sp|Q3TWI9|TM63B_MOUSE Transmembrane protein 63B OS=Mus musculus GN=Tmem63b PE=1 SV=1 Back     alignment and function description
>sp|Q5T3F8|TM63B_HUMAN Transmembrane protein 63B OS=Homo sapiens GN=TMEM63B PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query305
356501300 760 PREDICTED: uncharacterized membrane prot 0.990 0.397 0.824 1e-148
164605531 755 CM0545.360.nc [Lotus japonicus] 0.990 0.4 0.801 1e-145
224131634 768 predicted protein [Populus trichocarpa] 0.990 0.393 0.807 1e-145
449468470 768 PREDICTED: uncharacterized protein RSN1- 0.990 0.393 0.778 1e-145
449490363 768 PREDICTED: uncharacterized protein RSN1- 0.990 0.393 0.774 1e-145
255576911 726 conserved hypothetical protein [Ricinus 0.990 0.415 0.821 1e-144
357493417 766 Transmembrane protein [Medicago truncatu 0.990 0.394 0.784 1e-142
62319233 756 hypothetical protein [Arabidopsis thalia 0.990 0.399 0.749 1e-137
224064953 763 predicted protein [Populus trichocarpa] 0.983 0.393 0.793 1e-136
225444327 766 PREDICTED: uncharacterized membrane prot 0.990 0.394 0.75 1e-135
>gi|356501300|ref|XP_003519463.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Glycine max] Back     alignment and taxonomy information
 Score =  529 bits (1362), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 249/302 (82%), Positives = 270/302 (89%)

Query: 1   MATLGDIGVAATINILSAFAFLSAFAILRIQPINDRVYFPKWYLKGLRSSPLQTGTLVSK 60
           MA+LGDIG+AA INILSAFAFL AFAILRIQPINDRVYFPKWYLKGLRSSPLQ G  VSK
Sbjct: 3   MASLGDIGLAAAINILSAFAFLLAFAILRIQPINDRVYFPKWYLKGLRSSPLQAGIFVSK 62

Query: 61  FVNLDFRSYLRFLSWMPAALQMPEPELIDHAGLDSAVYLRIYLIGLKIFIPIACLGFAVM 120
           FVNLDF+SY+RFLSWMPAALQMPEPELIDHAGLDSAVYLRIYL+GLKIF+PIA L F+VM
Sbjct: 63  FVNLDFKSYIRFLSWMPAALQMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIAVLAFSVM 122

Query: 121 VPVNWTNKTLEHSKLKYSNIDLLSISNVPLGSNRFWTHLVMAYVFTFWTCYVLKREYEIV 180
           VPVNWTN TLE S L YS ID LSISN+P GSNRFWTHLVMAY FTFWTCY+LKREY+IV
Sbjct: 123 VPVNWTNSTLERSNLTYSQIDKLSISNIPTGSNRFWTHLVMAYAFTFWTCYILKREYQIV 182

Query: 181 AAMRLHFLASEHRRPDQFTVLVRNVPPDPDESVTQLVEHFFLVNHPDHYLTHQVVNNANK 240
           A MRLHFLASE RRPDQFTVLVRNVPPDPDESV++LVEHFFLVNHPDHYLT QVV NA K
Sbjct: 183 ATMRLHFLASERRRPDQFTVLVRNVPPDPDESVSELVEHFFLVNHPDHYLTQQVVYNAKK 242

Query: 241 LSELVNKKKKMQNWLDFYQLKYSRNPARKPSTKTGFLGLWGKTVDAIDFYTSKIETLKKE 300
           LS LV+KKKK QNWLD+Y+LKYSRN + +PS KTGFLGL G  VDAIDFYT +I+ L +E
Sbjct: 243 LSSLVSKKKKRQNWLDYYELKYSRNQSTRPSKKTGFLGLCGNRVDAIDFYTDEIKRLSEE 302

Query: 301 VS 302
           + 
Sbjct: 303 IE 304

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|164605531|dbj|BAF98597.1| CM0545.360.nc [Lotus japonicus] Back     alignment and taxonomy information
>gi|224131634|ref|XP_002321139.1| predicted protein [Populus trichocarpa] gi|222861912|gb|EEE99454.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449468470|ref|XP_004151944.1| PREDICTED: uncharacterized protein RSN1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449490363|ref|XP_004158583.1| PREDICTED: uncharacterized protein RSN1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255576911|ref|XP_002529341.1| conserved hypothetical protein [Ricinus communis] gi|223531212|gb|EEF33058.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|357493417|ref|XP_003616997.1| Transmembrane protein [Medicago truncatula] gi|355518332|gb|AES99955.1| Transmembrane protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|62319233|dbj|BAD94445.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224064953|ref|XP_002301612.1| predicted protein [Populus trichocarpa] gi|222843338|gb|EEE80885.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225444327|ref|XP_002264591.1| PREDICTED: uncharacterized membrane protein C24H6.13 isoform 2 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query305
TAIR|locus:2089850 756 AT3G21620 "AT3G21620" [Arabido 0.990 0.399 0.716 2e-120
TAIR|locus:2008860 771 AT1G11960 "AT1G11960" [Arabido 0.986 0.390 0.710 9.1e-116
TAIR|locus:2027119 769 AT1G62320 "AT1G62320" [Arabido 0.980 0.388 0.690 2.2e-112
TAIR|locus:2120673 771 AT4G22120 [Arabidopsis thalian 0.990 0.391 0.676 9.7e-112
TAIR|locus:2140210 785 AT4G02900 [Arabidopsis thalian 0.983 0.382 0.631 9.2e-107
TAIR|locus:2134882 772 AT4G04340 [Arabidopsis thalian 0.990 0.391 0.654 2.5e-106
TAIR|locus:2130130 761 AT4G15430 "AT4G15430" [Arabido 0.990 0.396 0.639 4e-106
TAIR|locus:2031735 806 AT1G32090 "AT1G32090" [Arabido 0.990 0.374 0.544 6e-87
TAIR|locus:2102117 703 HYP1 "hypothetical protein 1" 0.855 0.371 0.328 4.6e-33
TAIR|locus:2096991 712 AT3G54510 [Arabidopsis thalian 0.786 0.337 0.298 8.1e-29
TAIR|locus:2089850 AT3G21620 "AT3G21620" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1185 (422.2 bits), Expect = 2.0e-120, P = 2.0e-120
 Identities = 217/303 (71%), Positives = 252/303 (83%)

Query:     1 MATLGDIGVAATINXXXXXXXXXXXXXXRIQPINDRVYFPKWYLKGLRSSPLQTGTLVSK 60
             MATL DIGVAATIN              R+QP+NDRVYFPKWYLKGLRSSP++TG   SK
Sbjct:     1 MATLTDIGVAATINILTAFAFFIAFAILRLQPVNDRVYFPKWYLKGLRSSPIKTGGFASK 60

Query:    61 FVNLDFRSYLRFLSWMPAALQMPEPELIDHAGLDSAVYLRIYLIGLKIFIPIACLGFAVM 120
             FVNLDFRSY+RFL+WMP AL+MPEPELIDHAGLDS VYLRIYL+GLKIF PIAC+ F VM
Sbjct:    61 FVNLDFRSYIRFLNWMPQALRMPEPELIDHAGLDSVVYLRIYLLGLKIFFPIACIAFTVM 120

Query:   121 VPVNWTNKTLEHSK-LKYSNIDLLSISNVPLGSNRFWTHLVMAYVFTFWTCYVLKREYEI 179
             VPVNWTN TL+  K L +S+ID LSISN+P GS+RFW HL MAYV TFWTC+VL+REY+ 
Sbjct:   121 VPVNWTNSTLDQLKNLTFSDIDKLSISNIPTGSSRFWVHLCMAYVITFWTCFVLQREYKH 180

Query:   180 VAAMRLHFLASEHRRPDQFTVLVRNVPPDPDESVTQLVEHFFLVNHPDHYLTHQVVNNAN 239
             +A+MRL FLASEHRRPDQFTVLVRN+PPDPDESV++LVEHFF VNHPD+YLT+Q V NAN
Sbjct:   181 IASMRLQFLASEHRRPDQFTVLVRNIPPDPDESVSELVEHFFKVNHPDYYLTYQAVYNAN 240

Query:   240 KLSELVNKKKKMQNWLDFYQLKYSRNPARKPSTKTGFLGLWGKTVDAIDFYTSKIETLKK 299
             KLSELV K+ K+QNWLD+YQ K+SRNP+++P  K GFLG WG+ VDAID Y  KIE L +
Sbjct:   241 KLSELVQKRMKLQNWLDYYQNKHSRNPSKRPLIKIGFLGCWGEEVDAIDHYIEKIEGLTR 300

Query:   300 EVS 302
             ++S
Sbjct:   301 KIS 303
GO:0003674 "molecular_function" evidence=ND
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0008150 "biological_process" evidence=ND
GO:0016020 "membrane" evidence=IEA
TAIR|locus:2008860 AT1G11960 "AT1G11960" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027119 AT1G62320 "AT1G62320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120673 AT4G22120 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2140210 AT4G02900 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2134882 AT4G04340 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130130 AT4G15430 "AT4G15430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031735 AT1G32090 "AT1G32090" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102117 HYP1 "hypothetical protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096991 AT3G54510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query305
pfam13967151 pfam13967, RSN1_TM, Late exocytosis, associated wi 6e-49
COG5594 827 COG5594, COG5594, Uncharacterized integral membran 1e-21
>gnl|CDD|222479 pfam13967, RSN1_TM, Late exocytosis, associated with Golgi transport Back     alignment and domain information 
 Score =  159 bits (405), Expect = 6e-49
 Identities = 62/171 (36%), Positives = 91/171 (53%), Gaps = 20/171 (11%)

Query: 6   DIGVAATINILSAFAFLSAFAILRIQPINDRVYFPKWYLKGLRSSPLQTGTLVSKFVNLD 65
               +  IN++ A  F   F+ILR +  N RVY P+ YL G                   
Sbjct: 1   AFLTSLVINLVLALVFFLLFSILRPK--NKRVYAPRTYLAGPEEER---------TPPPP 49

Query: 66  FRSYLRFLSWMPAALQMPEPELIDHAGLDSAVYLRIYLIGLKIFIPIACLGFAVMVPVNW 125
            R       W+P  L++ + E++ HAGLD+ V+LR   +G+KIF+    +G+ +++PVN 
Sbjct: 50  PRG---LFGWIPPLLKISDEEILQHAGLDAYVFLRFLKMGIKIFLVGCVIGWPILLPVNA 106

Query: 126 TNKTLEHSKLKYSNIDLLSISNVPLGSNRFWTHLVMAYVFTFWTCYVLKRE 176
           T    E      + +D LSISNV  GSNR W H+V+AY+FT + CY+L RE
Sbjct: 107 TGGNGE------TGLDKLSISNVVEGSNRLWAHVVVAYIFTGFVCYLLYRE 151

This family represents the first three transmembrane regions of 11-TM proteins involved in vesicle transport. In S. cerevisiae these proteins are members of the yeast facilitator superfamily and are integral membrane proteins localised to the cell periphery, in particular to the bud-neck region. The distribution is consistent with a role in late exocytosis which is in agreement with the proteins' ability to substitute for the function of Sro7p, required for the sorting of the protein Enap1 into Golgi-derived vesicles destined for the cell surface. Length = 151
>gnl|CDD|227881 COG5594, COG5594, Uncharacterized integral membrane protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 305
COG5594 827 Uncharacterized integral membrane protein [Functio 100.0
KOG1134 728 consensus Uncharacterized conserved protein [Gener 100.0
PF13967157 RSN1_TM: Late exocytosis, associated with Golgi tr 100.0
PF1470385 DUF4463: Domain of unknown function (DUF4463) 99.54
PF0729288 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 84.65
PLN03121 243 nucleic acid binding protein; Provisional 84.46
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 81.94
PLN03120 260 nucleic acid binding protein; Provisional 80.18
>COG5594 Uncharacterized integral membrane protein [Function unknown] Back     alignment and domain information 
Probab=100.00  E-value=4.8e-49  Score=387.35  Aligned_cols=283  Identities=24%  Similarity=0.410  Sum_probs=242.8

Q ss_pred             chhhHHHHHHHHHHHHHHHHHHHHHHhcCCCCCceecccccccCCC-CCCCCCCcccccccccccccccccccchHhhcC
Q 021948            3 TLGDIGVAATINILSAFAFLSAFAILRIQPINDRVYFPKWYLKGLR-SSPLQTGTLVSKFVNLDFRSYLRFLSWMPAALQ   81 (305)
Q Consensus         3 ~~~~~~t~l~~~~~i~~~~l~lF~~lR~~~~~~~iY~pr~~~~~~~-~~p~~~~~~~~~~~~l~~~~~~~~f~Wi~~~~~   81 (305)
                      +.++++|++.++..++++++++|++||+|  ++++|+||+..++.. +.|.              +.++|+|||+.++++
T Consensus        20 s~~~~~t~l~f~~~~~~~~l~~f~iLR~r--~k~lY~pr~~~~~~~~~~P~--------------~~~ss~~gWl~~L~~   83 (827)
T COG5594          20 STSAVITQLVFAGLIFLVFLILFLILRKR--WKRLYAPRTNFDGQNECLPE--------------PNPSSYWGWLEPLVK   83 (827)
T ss_pred             chhhhHHHHHHHHHHHHHHHHHHHHHHHH--HhHhcCcceeecCCCcccCC--------------CCccchHHHHHHHHh
Confidence            57899999999999999999999999975  999999999877543 3332              367899999999999


Q ss_pred             CChhHHHHhcCchHHHHHHHHHHHHHHHHHHHHhhheeeeeeeeeCCcccCCC-CCCCCcccccccCCCCCCchHHHHHH
Q 021948           82 MPEPELIDHAGLDSAVYLRIYLIGLKIFIPIACLGFAVMVPVNWTNKTLEHSK-LKYSNIDLLSISNVPLGSNRFWTHLV  160 (305)
Q Consensus        82 ~~d~~i~~~~GlDa~~flrflr~~~~lf~~~~v~~~~iLlPin~~~~~~~~~~-~~~~~l~~~Ti~Nv~~~s~~lw~h~v  160 (305)
                      ++|+.+++++|+|||+||||+|||+.++++.|++++|||+|||++.+..++.+ ...++++++|++|+.+ ++++|+|++
T Consensus        84 i~d~~~l~~aGlD~y~fLrflkm~~~~~~i~sl~~ipIL~Pvn~~~~~~~~gn~~s~s~l~~Ls~~Nv~~-~n~~~aHvf  162 (827)
T COG5594          84 IPDEFLLQYAGLDGYFFLRFLKMLIKLLFILSLILIPILLPVNYHFQKATNGNSDSESGLDKLSISNVSP-SNRLYAHVF  162 (827)
T ss_pred             CCHHHHHHHcCcchhhHHHHHHHHHHHHHHHHHHHhHEeeeeeecccccccCCccchhhhhHhhhhcccC-CCceeeeee
Confidence            99999999999999999999999999999999999999999998885543221 2568999999999986 799999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHccCCC---------CCcceEEEEecCCCCCchhHHHHHHHhccccCCCccee
Q 021948          161 MAYVFTFWTCYVLKREYEIVAAMRLHFLASEHR---------RPDQFTVLVRNVPPDPDESVTQLVEHFFLVNHPDHYLT  231 (305)
Q Consensus       161 ~~~l~~~~~~~~l~~e~~~~~~~R~~~l~~~~~---------~~~~~Tvlv~~IP~~~~~~l~~~l~~~F~~~~p~~v~~  231 (305)
                      ..|++.++++|.+++|++.|..+||++++++..         ..++||++++++|.+..+  .+.+..+|+++.-+.+.+
T Consensus       163 ~~~~f~~~vlfii~~el~~y~~lr~a~~~~p~y~qs~~~~~~~~ssRTvlis~LP~~~~~--~e~L~~~~~kl~~~~i~~  240 (827)
T COG5594         163 LSWFFFGYVLFIIFRELRFYVVLRQAYLRSPLYQQSLLTLQNNLSSRTVLISGLPSELRS--DEELKELFDKLKVGEIDS  240 (827)
T ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHhhccCCCCceEEeecCChhhcC--chhHHHHHhhcCeeeecc
Confidence            999999999999999999999999999999852         348899999999997432  133666777777777777


Q ss_pred             EEeEcccchHHHHHHHHHHHHHHHHHHHhh-------h-----cc--------------------CCCCCCccccCCc--
Q 021948          232 HQVVNNANKLSELVNKKKKMQNWLDFYQLK-------Y-----SR--------------------NPARKPSTKTGFL--  277 (305)
Q Consensus       232 v~i~~d~~~L~~L~~~r~~~~~~Le~~~~k-------~-----~~--------------------~~~~rP~~r~~~~--  277 (305)
                      ..+|||.+.|++++.+|++..+++|.+.++       .     .+                    +.++||+||.+-.  
T Consensus       241 ~~l~~~~~~l~~l~k~R~ki~~klE~~~~~~~~~~~K~~~~~~~K~~~~L~~~~~k~~~~~~~y~~~~~Rp~~~i~k~~~  320 (827)
T COG5594         241 DVLCRDLGTLQELYKERDKILKKLEKALNELLNKLLKKSHLKTNKKSGKLTPSRKKEFEILPEYVPDKKRPKHRIKKLNK  320 (827)
T ss_pred             chhhhhhHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHhhHhhccCCCCCCCcccccchhhhhhccccccchhhhhhhhh
Confidence            889999999999999999999999965321       1     01                    1246999998755  


Q ss_pred             CCCCCcccHHHHHHHHHHHHHHhhccc
Q 021948          278 GLWGKTVDAIDFYTSKIETLKKEVSGF  304 (305)
Q Consensus       278 ~~~g~kvDai~yy~~~l~~l~~~i~~~  304 (305)
                      +++||||||||||++++++++++|++.
T Consensus       321 ~i~gKkVdaI~y~s~~l~~l~~~i~~~  347 (827)
T COG5594         321 GIFGKKVDAIDYYSAKLTKLDAEIENA  347 (827)
T ss_pred             hhccceecHHHHHHHHHHHHHHHHHHH
Confidence            678999999999999999999999864

>KOG1134 consensus Uncharacterized conserved protein [General function prediction only] Back     alignment and domain information
>PF13967 RSN1_TM: Late exocytosis, associated with Golgi transport Back     alignment and domain information
>PF14703 DUF4463: Domain of unknown function (DUF4463) Back     alignment and domain information
>PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi) Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query305
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 91.74
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 91.0
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 90.89
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 90.83
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 90.76
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 90.6
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 90.59
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 90.38
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 90.34
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 90.3
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 90.28
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 90.18
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 90.06
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 90.05
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 89.91
1x4e_A85 RNA binding motif, single-stranded interacting pro 89.84
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 89.78
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 89.56
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 89.55
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 89.52
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 89.48
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 89.48
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 89.36
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 89.31
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 89.28
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 89.22
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 89.18
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 89.07
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 89.06
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 89.02
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 88.95
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 88.82
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 88.78
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 88.75
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 88.75
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 88.74
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 88.67
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 88.57
2cqd_A116 RNA-binding region containing protein 1; RNA recog 88.39
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 88.34
2div_A99 TRNA selenocysteine associated protein; structural 88.3
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 88.2
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 88.18
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 88.07
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 87.9
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 87.9
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 87.88
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 87.84
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 87.82
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 87.8
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 87.75
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 87.75
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 87.74
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 87.71
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 87.68
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 87.67
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 87.64
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 87.56
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 87.43
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 87.42
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 87.25
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 87.24
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 87.22
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 87.16
2cpj_A99 Non-POU domain-containing octamer-binding protein; 87.11
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 87.05
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 87.0
2cph_A107 RNA binding motif protein 19; RNA recognition moti 86.93
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 86.88
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 86.67
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 86.49
1x5o_A114 RNA binding motif, single-stranded interacting pro 86.42
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 86.35
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 86.25
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 86.03
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 85.98
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 85.92
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 85.65
3p5t_L90 Cleavage and polyadenylation specificity factor S; 85.62
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 85.6
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 85.6
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 85.49
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 85.4
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 84.95
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 84.91
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 84.55
2la6_A99 RNA-binding protein FUS; structural genomics, nort 84.39
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 84.13
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 84.01
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 83.93
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 83.85
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 83.78
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 83.76
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 83.65
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 83.46
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 83.38
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 83.3
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 83.25
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 83.25
2kt5_A124 RNA and export factor-binding protein 2; chaperone 83.22
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 83.15
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 83.1
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 83.0
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 82.87
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 82.76
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 82.54
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 82.37
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 82.23
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 82.05
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 81.79
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 81.65
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 81.52
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 80.89
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 80.84
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 80.84
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 80.81
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 80.64
2krb_A81 Eukaryotic translation initiation factor 3 subunit 80.3
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 80.19
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 80.18
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 80.07
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
Probab=91.74  E-value=0.2  Score=36.96  Aligned_cols=41  Identities=10%  Similarity=0.101  Sum_probs=30.4

Q ss_pred             CCcceEEEEecCCCCCchhHHHHHHHhccccCCCcceeEEeEcc
Q 021948          194 RPDQFTVLVRNVPPDPDESVTQLVEHFFLVNHPDHYLTHQVVNN  237 (305)
Q Consensus       194 ~~~~~Tvlv~~IP~~~~~~l~~~l~~~F~~~~p~~v~~v~i~~d  237 (305)
                      .....||.|.|||.+.++   +.|.++|++..+-.+.+|.+++|
T Consensus         6 ~~~m~tlfV~nL~~~~te---e~L~~~F~~~G~i~v~~v~i~~d   46 (95)
T 2lkz_A            6 HHHMDTIILRNIAPHTVV---DSIMTALSPYASLAVNNIRLIKD   46 (95)
T ss_dssp             SCCCCEEEEESCCTTCCH---HHHHHHSTTTCCCCGGGEECCCC
T ss_pred             CCccCEEEEeCCCCcCCH---HHHHHHHHhhCCccEEEEEEEec
Confidence            345679999999998764   67888888765545667777665
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query305
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 94.09
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 93.97
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 93.32
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 92.8
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 92.53
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 92.26
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 92.21
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 92.12
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 92.07
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 91.75
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 91.71
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 91.62
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 91.57
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 91.18
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 90.78
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 90.78
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 90.54
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 90.51
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 90.48
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 90.44
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 90.35
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 89.64
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 89.31
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 89.27
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 89.0
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 88.92
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 88.56
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 88.48
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 88.47
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 88.33
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 88.2
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 87.95
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 87.71
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 87.63
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 87.5
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 87.5
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 87.45
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 87.32
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 87.02
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 86.57
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 86.19
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 86.12
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 86.09
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 85.78
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 85.53
d2cpja186 Non-POU domain-containing octamer-binding protein, 85.35
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 84.89
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 84.7
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 84.53
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 84.49
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 84.42
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 83.78
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 83.72
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 83.7
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 83.7
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 83.45
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 82.85
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 82.05
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 81.71
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 81.03
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 80.79
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 80.46
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: RNA-binding protein 8
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

Probab=94.09  E-value=0.039  Score=38.35  Aligned_cols=41  Identities=10%  Similarity=0.172  Sum_probs=30.6

Q ss_pred             CCCcceEEEEecCCCCCchhHHHHHHHhccccCCCcceeEEeEccc
Q 021948          193 RRPDQFTVLVRNVPPDPDESVTQLVEHFFLVNHPDHYLTHQVVNNA  238 (305)
Q Consensus       193 ~~~~~~Tvlv~~IP~~~~~~l~~~l~~~F~~~~p~~v~~v~i~~d~  238 (305)
                      .+...++|.|.|||.+.++   +.|.++|++.  |.|.++.+.+|-
T Consensus         3 ~s~~~~~l~V~nL~~~~t~---~~l~~~F~~~--G~i~~v~i~~d~   43 (88)
T d1rk8a_           3 RSVEGWILFVTSIHEEAQE---DEIQEKFCDY--GEIKNIHLNLDR   43 (88)
T ss_dssp             CCC-CEEEEEESCCTTCCH---HHHHHHHGGG--SCEEEEEEEECT
T ss_pred             CCCCCCEEEEeCCCCCCCH---HHHHHHHHHc--CCcccccccccc
Confidence            3556789999999998764   5677788765  468888888763
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure