Citrus Sinensis ID: 021972

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300----
MVSKIPNPAEGFYLDPNGMALPGLGPFASSATTPTAAAAAAGTSTVSTSEDPSKKIRKPYTITKSRESWTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKNGTAEHLPPPRPKRKAAHPYPQKASKNAPMLSQVSGSFQSSSAQLEPGHFLRPDSSSMLMIPMASAATSWTNNVQTVSLSPASKGPEVANNRSNSTDSTPKARVSGELTDQGGELTDQGNNSHPLRVLPDFAQVYTFIGSVFDPNASDHVQKLKKMDPIDVETVCYIKNSTFFFHSLRIKVKLYWLYN
cccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccHHHHHHHHcccccHHHHHHHHHccccccccHHHHHHHHHccc
ccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccEEEccccccccHHHHHHHHHHHHHHcHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccHHHHHHHcccccHHHHHHHHHcccccccccHHHEEEHHcc
mvskipnpaegfyldpngmalpglgpfassattptaaaaaagtstvstsedpskkirkpytitksreswtepehDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVqkngtaehlppprpkrkaahpypqkasknapmlsqvsgsfqsssaqlepghflrpdsssmlmipmasaatswtnnvqtvslspaskgpevannrsnstdstpkarvsgeltdqggeltdqgnnshplrvlpdfAQVYTFigsvfdpnasdhvqklkkmdpidveTVCYIKNSTFFFHSLRIKVKLYWLYN
mvskipnpaEGFYLDPNGMALPGLGPFASSATTPTAAAAAagtstvstsedpskkirkpytitksreswtepehDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQkngtaehlppprpkrkaAHPYPQKASKNAPMLSQVSGSFQSSSAQLEPGHFLRPDSSSMLMIPMASAATSWTNNVQTVSLSpaskgpevannrsnstdstpkarvSGELTDQGGELTDQGNNSHPLRVLPDFAQVYTFIGSVFDPNASDHVQKLKKMDPIDVETVCYIKNstfffhslrikvklYWLYN
MVSKIPNPAEGFYLDPNGMALPGLGPFassattptaaaaaagtstvstsEDPSKKIRKPYTITKSRESWTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKNGTAEHLppprpkrkaahpypQKASKNAPMLsqvsgsfqsssaqLEPGHFLRPDSSSMLMIPMASAATSWTNNVQTVSLSPASKGPEVANNRSNSTDSTPKARVSGELTDQGGELTDQGNNSHPLRVLPDFAQVYTFIGSVFDPNASDHVQKLKKMDPIDVETVCYIKNSTFFFHSLRIKVKLYWLYN
**************************************************************************DKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKV******************************************************************************************************************************LRVLPDFAQVYTFIGSVFDPNASDHVQKLKKMDPIDVETVCYIKNSTFFFHSLRIKVKLYWLY*
************************************************************************EHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYF**************************************************************************************************************************************DFAQVYTFIGSVFD***************IDVETVCYIKNSTFFFHSLRIKVKLYWLYN
MVSKIPNPAEGFYLDPNGMALPGLGPFASS************************KIRKPYTITKSRESWTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKNGTAEHLP******************NAPMLSQ************EPGHFLRPDSSSMLMIPMASAATSWTNNVQTVSLSP**************************LTDQGGELTDQGNNSHPLRVLPDFAQVYTFIGSVFDPNASDHVQKLKKMDPIDVETVCYIKNSTFFFHSLRIKVKLYWLYN
****IPNPAEGFYL**NGMALPG*******************************KIRKPYTITKSRESWTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKNGT*EHLP*******************************************************************************************************************PLRVLPDFAQVYTFIGSVFDPNASDHVQKLKKMDPIDVETVCYIKNSTFFFHSLRIKVKLYWLYN
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSKIPNPAEGFYLDPNGMALPGLGPFASSATTPTAAAAAAGTSTVSTSEDPSKKIRKPYTITKSRESWTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKNGTAEHLPPPRPKRKAAHPYPQKASKNAPMLSQVSGSFQSSSAQLEPGHFLRPDSSSMLMIPMASAATSWTNNVQTVSLSPASKGPEVANNRSNSTDSTPKARVSGELTDQGGELTDQGNNSHPLRVLPDFAQVYTFIGSVFDPNASDHVQKLKKMDPIDVETVCYIKNSTFFFHSLRIKVKLYWLYN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query304 2.2.26 [Sep-21-2011]
Q6R0H0287 Transcription factor ASG4 no no 0.832 0.881 0.501 4e-65
Q54IF9 423 Myb-like protein G OS=Dic yes no 0.743 0.534 0.387 3e-40
Q6R0H1 645 Protein LHY OS=Arabidopsi no no 0.358 0.168 0.470 5e-22
P92973 608 Protein CCA1 OS=Arabidops no no 0.25 0.125 0.592 8e-21
Q54Z40 1217 Myb-like protein H OS=Dic no no 0.171 0.042 0.518 6e-11
Q869R9 734 Myb-like protein J OS=Dic no no 0.167 0.069 0.442 8e-08
Q5VVJ2 828 Histone H2A deubiquitinas yes no 0.203 0.074 0.393 6e-06
Q54HX6 977 Myb-like protein I OS=Dic no no 0.174 0.054 0.388 9e-06
Q5RGA4 822 Histone H2A deubiquitinas yes no 0.187 0.069 0.379 1e-05
Q5F3F2 832 Histone H2A deubiquitinas yes no 0.174 0.063 0.415 2e-05
>sp|Q6R0H0|ASG4_ARATH Transcription factor ASG4 OS=Arabidopsis thaliana GN=ASG4 PE=2 SV=1 Back     alignment and function desciption
 Score =  248 bits (633), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 141/281 (50%), Positives = 179/281 (63%), Gaps = 28/281 (9%)

Query: 7   NPAEGFYLDPNGMALPGLGPFASSATTPTAAAAAAGTSTVSTSEDPSKKIRKPYTITKSR 66
           NP++   L P  M+LPG      +ATT     +     T+S  EDP+KK+RKPYTITKSR
Sbjct: 5   NPSQAHCL-PMKMSLPGFNTLPHTATT--IPVSIRSNRTMSFFEDPTKKVRKPYTITKSR 61

Query: 67  ESWTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKNGTAEHLPPP 126
           E+WTE EHDKFLEAL LFDRDWKKI+AF+GSKTVIQIRSHAQKYFLKVQKNGT EHLPPP
Sbjct: 62  ENWTEQEHDKFLEALHLFDRDWKKIKAFVGSKTVIQIRSHAQKYFLKVQKNGTKEHLPPP 121

Query: 127 RPKRKAAHPYPQKASKNAPMLSQVSGSFQSSSAQLEPGHFLRPDSSSMLMIPMASAATSW 186
           RPKRKA HPYPQKA K          +  SS+A  +  +    +S  ++       +T+ 
Sbjct: 122 RPKRKANHPYPQKAPK---------FTLSSSNALFQHDYLYNTNSHPVI-------STTR 165

Query: 187 TNNVQTVSLS-PASKGPE---VANNRSNSTDSTPKARVSGELTDQGGELTDQGNNSHPLR 242
            + +    +S P+S   E   V+ N  +++ S  K R     T    E  DQ +   P R
Sbjct: 166 KHGLVHCDVSIPSSVIKEEFGVSENCCSTSSSRDKQR-----TRIVTETNDQESCGKPHR 220

Query: 243 VLPDFAQVYTFIGSVFDPNASDHVQKLKKMDPIDVETVCYI 283
           V P+FA+VY FIGSVFDP  + HV++LK+MDPI++ETV  +
Sbjct: 221 VAPNFAEVYNFIGSVFDPKTTGHVKRLKEMDPINLETVLLL 261
Probable transcription factor.
Arabidopsis thaliana (taxid: 3702)
>sp|Q54IF9|MYBG_DICDI Myb-like protein G OS=Dictyostelium discoideum GN=mybG PE=3 SV=1 Back     alignment and function description
>sp|Q6R0H1|LHY_ARATH Protein LHY OS=Arabidopsis thaliana GN=LHY PE=1 SV=2 Back     alignment and function description
>sp|P92973|CCA1_ARATH Protein CCA1 OS=Arabidopsis thaliana GN=CCA1 PE=1 SV=1 Back     alignment and function description
>sp|Q54Z40|MYBH_DICDI Myb-like protein H OS=Dictyostelium discoideum GN=mybH PE=3 SV=1 Back     alignment and function description
>sp|Q869R9|MYBJ_DICDI Myb-like protein J OS=Dictyostelium discoideum GN=mybJ PE=3 SV=1 Back     alignment and function description
>sp|Q5VVJ2|MYSM1_HUMAN Histone H2A deubiquitinase MYSM1 OS=Homo sapiens GN=MYSM1 PE=1 SV=1 Back     alignment and function description
>sp|Q54HX6|MYBI_DICDI Myb-like protein I OS=Dictyostelium discoideum GN=mybI PE=3 SV=1 Back     alignment and function description
>sp|Q5RGA4|MYSM1_DANRE Histone H2A deubiquitinase MYSM1 OS=Danio rerio GN=mysm1 PE=2 SV=2 Back     alignment and function description
>sp|Q5F3F2|MYSM1_CHICK Histone H2A deubiquitinase MYSM1 OS=Gallus gallus GN=MYSM1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query304
255545170318 DNA binding protein, putative [Ricinus c 0.884 0.845 0.739 1e-107
224079756317 predicted protein [Populus trichocarpa] 0.891 0.854 0.706 1e-102
295883125324 putative MYB transcription factor [Rosa 0.901 0.845 0.712 1e-100
307135909280 MYB transcription factor [Cucumis melo s 0.848 0.921 0.687 1e-100
358248018301 uncharacterized protein LOC100783949 [Gl 0.861 0.870 0.681 1e-99
359490474337 PREDICTED: transcription factor ASG4-lik 0.884 0.798 0.675 4e-99
449456325311 PREDICTED: transcription factor ASG4-lik 0.848 0.829 0.677 5e-98
356576006304 PREDICTED: transcription factor ASG4 [Gl 0.868 0.868 0.672 7e-98
388501910306 unknown [Lotus japonicus] 0.842 0.836 0.670 8e-98
356534101314 PREDICTED: LOW QUALITY PROTEIN: transcri 0.865 0.837 0.650 1e-96
>gi|255545170|ref|XP_002513646.1| DNA binding protein, putative [Ricinus communis] gi|223547554|gb|EEF49049.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  395 bits (1016), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 210/284 (73%), Positives = 227/284 (79%), Gaps = 15/284 (5%)

Query: 1   MVSKIPNPAEGFYLDPNGMALPGLGPFASSATTPTAAAAAAGTSTVSTSEDPSKKIRKPY 60
           MVSK PNP EGFYLDPNGMALPGLGPFA         A    TST S+SEDPSKKIRKPY
Sbjct: 1   MVSKNPNPPEGFYLDPNGMALPGLGPFA-------TTAPTTTTSTTSSSEDPSKKIRKPY 53

Query: 61  TITKSRESWTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKNGTA 120
           TITKSRESWTEPEHDKFLEALQLFDRDWKKIEAF+GSKTVIQIRSHAQKYFLKVQK+G  
Sbjct: 54  TITKSRESWTEPEHDKFLEALQLFDRDWKKIEAFVGSKTVIQIRSHAQKYFLKVQKSGAN 113

Query: 121 EHLPPPRPKRKAAHPYPQKASKNAPMLSQVSGSFQSSSAQLEPGHFLRPDSSSMLMIPMA 180
           EHLPPPRPKRKAAHPYPQKASKNA ML Q S SFQSSSA LEPG+  RPDSSSM   P+ 
Sbjct: 114 EHLPPPRPKRKAAHPYPQKASKNAQMLLQPSVSFQSSSALLEPGYIRRPDSSSMPTNPIT 173

Query: 181 S-AATSWTNNVQTVSLSPASKGPEVANNRSNSTDSTPKARVSGELTDQGGELTDQGNNSH 239
           S AA SWTNN+  VS S  +KGP V NN  +ST+STP+       T   GE  + GN+SH
Sbjct: 174 SAAAASWTNNLPAVSFSNQAKGPIVTNNCCSSTESTPR-------TKPIGETAELGNHSH 226

Query: 240 PLRVLPDFAQVYTFIGSVFDPNASDHVQKLKKMDPIDVETVCYI 283
           PLRVLPDF QVY+FIGSVFDPNA+ H+Q+LKKMDPIDVETV  +
Sbjct: 227 PLRVLPDFVQVYSFIGSVFDPNATGHLQRLKKMDPIDVETVLLL 270

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224079756|ref|XP_002305938.1| predicted protein [Populus trichocarpa] gi|222848902|gb|EEE86449.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|295883125|gb|ADG56764.1| putative MYB transcription factor [Rosa rugosa] Back     alignment and taxonomy information
>gi|307135909|gb|ADN33772.1| MYB transcription factor [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|358248018|ref|NP_001240048.1| uncharacterized protein LOC100783949 [Glycine max] gi|255634506|gb|ACU17617.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|359490474|ref|XP_002273319.2| PREDICTED: transcription factor ASG4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449456325|ref|XP_004145900.1| PREDICTED: transcription factor ASG4-like [Cucumis sativus] gi|449497272|ref|XP_004160358.1| PREDICTED: transcription factor ASG4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356576006|ref|XP_003556126.1| PREDICTED: transcription factor ASG4 [Glycine max] Back     alignment and taxonomy information
>gi|388501910|gb|AFK39021.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|356534101|ref|XP_003535596.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor ASG4-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query304
TAIR|locus:2149589331 AT5G52660 [Arabidopsis thalian 0.881 0.809 0.553 2.9e-71
TAIR|locus:2124928303 AT4G01280 [Arabidopsis thalian 0.871 0.874 0.454 1.9e-51
TAIR|locus:2025411287 ASG4 "ALTERED SEED GERMINATION 0.375 0.397 0.632 4.2e-49
TAIR|locus:2075049298 RVE8 "REVEILLE 8" [Arabidopsis 0.756 0.771 0.502 1.4e-48
TAIR|locus:2151251293 LCL1 "LHY/CCA1-like 1" [Arabid 0.763 0.791 0.485 1.1e-46
DICTYBASE|DDB_G0288783 423 mybG "myb domain-containing pr 0.233 0.167 0.774 2.4e-33
TAIR|locus:2044345 608 CCA1 "circadian clock associat 0.236 0.118 0.597 3e-21
TAIR|locus:2200970 645 LHY "LATE ELONGATED HYPOCOTYL" 0.220 0.103 0.626 4.9e-21
TAIR|locus:2167210387 RVE1 "REVEILLE 1" [Arabidopsis 0.226 0.178 0.608 1.1e-19
TAIR|locus:2169135287 RVE2 "REVEILLE 2" [Arabidopsis 0.207 0.219 0.634 2.5e-19
TAIR|locus:2149589 AT5G52660 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 721 (258.9 bits), Expect = 2.9e-71, P = 2.9e-71
 Identities = 161/291 (55%), Positives = 182/291 (62%)

Query:     1 MVSKIPNPAEGFYLDPNGMALPGLGP-FXXXXXXXXXXXXXXXXXX--------XXXXED 51
             MVS+  N ++G++LDP GM +PGLGP F                              ED
Sbjct:     1 MVSR--N-SDGYFLDPTGMTVPGLGPSFTAAVSSSSSPTTSSTAVAVADVTAMVSSSEED 57

Query:    52 PSKKIRKPYTITKSRESWTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYF 111
              SKKIRKPYTITKSRESWTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYF
Sbjct:    58 LSKKIRKPYTITKSRESWTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYF 117

Query:   112 LKVQKNGTAEHLXXXXXXXXXXXXXXQKASKNAPMLXXXXXXXXXXXXXLEPGHFLRPDS 171
             LKVQK+GT EHL              QKA KN  +               +P    RP+S
Sbjct:   118 LKVQKSGTGEHLPPPRPKRKAAHPYPQKAHKNVQLQVPGSFKSTSEPN--DPSFMFRPES 175

Query:   172 SSMLMI-PMASAATSWTNNVQTVSLSPASKGPEVANNR-SNSTDSTPKARVSGELTDQGG 229
             SSMLM  P  +AA  WTNN QT+S +P  K    ANN  S+S+++TP+ R          
Sbjct:   176 SSMLMTSPTTAAAAPWTNNAQTISFTPLPKAGAGANNNCSSSSENTPRPR-------SNR 228

Query:   230 ELTDQGNNSHPLRVLPDFAQVYTFIGSVFDPNASDHVQKLKKMDPIDVETV 280
             +  D GN  H LRVLPDFAQVY FIGSVFDP AS+H+QKLKKMDPIDVETV
Sbjct:   229 DARDHGNVGHSLRVLPDFAQVYGFIGSVFDPYASNHLQKLKKMDPIDVETV 279
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0009651 "response to salt stress" evidence=IEP
GO:0009723 "response to ethylene stimulus" evidence=IEP
GO:0009737 "response to abscisic acid stimulus" evidence=IEP
GO:0009739 "response to gibberellin stimulus" evidence=IEP
GO:0009751 "response to salicylic acid stimulus" evidence=IEP
GO:0009753 "response to jasmonic acid stimulus" evidence=IEP
GO:0046686 "response to cadmium ion" evidence=IEP
TAIR|locus:2124928 AT4G01280 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025411 ASG4 "ALTERED SEED GERMINATION 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075049 RVE8 "REVEILLE 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151251 LCL1 "LHY/CCA1-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0288783 mybG "myb domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2044345 CCA1 "circadian clock associated 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200970 LHY "LATE ELONGATED HYPOCOTYL" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167210 RVE1 "REVEILLE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169135 RVE2 "REVEILLE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query304
TIGR0155757 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domai 3e-16
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 9e-10
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 4e-08
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 1e-07
>gnl|CDD|130620 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information 
 Score = 71.3 bits (175), Expect = 3e-16
 Identities = 25/57 (43%), Positives = 31/57 (54%), Gaps = 6/57 (10%)

Query: 64  KSRESWTEPEHDKFLEALQLFDR-DW---KKI-EAFIGSK-TVIQIRSHAQKYFLKV 114
           K R  WTE  HD+FL+A+Q     DW   K+I E  +    T  Q+ SH QKY LK 
Sbjct: 1   KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLKQ 57

This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif. Length = 57
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 304
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 99.65
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.48
KOG0724335 consensus Zuotin and related molecular chaperones 99.4
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.16
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.13
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 98.97
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 98.95
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 98.89
KOG1279506 consensus Chromatin remodeling factor subunit and 98.7
PLN03212249 Transcription repressor MYB5; Provisional 98.51
PLN03212249 Transcription repressor MYB5; Provisional 98.5
PLN03091 459 hypothetical protein; Provisional 98.41
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 98.36
PLN03091 459 hypothetical protein; Provisional 98.31
KOG0048238 consensus Transcription factor, Myb superfamily [T 98.2
KOG0048238 consensus Transcription factor, Myb superfamily [T 97.8
PLN03162526 golden-2 like transcription factor; Provisional 97.43
KOG0049 939 consensus Transcription factor, Myb superfamily [T 97.34
KOG4468 782 consensus Polycomb-group transcriptional regulator 96.88
KOG4329445 consensus DNA-binding protein [General function pr 96.56
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 96.14
KOG0724335 consensus Zuotin and related molecular chaperones 95.64
KOG0051607 consensus RNA polymerase I termination factor, Myb 95.34
KOG0049 939 consensus Transcription factor, Myb superfamily [T 95.03
KOG0051607 consensus RNA polymerase I termination factor, Myb 94.89
KOG3841 455 consensus TEF-1 and related transcription factor, 94.59
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 94.31
PLN031421033 Probable chromatin-remodeling complex ATPase chain 94.13
KOG3554 693 consensus Histone deacetylase complex, MTA1 compon 93.96
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 93.43
KOG4167907 consensus Predicted DNA-binding protein, contains 93.32
smart0042668 TEA TEA domain. 92.25
KOG1194 534 consensus Predicted DNA-binding protein, contains 92.11
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 91.86
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 90.79
PF01285 431 TEA: TEA/ATTS domain family; InterPro: IPR000818 T 87.27
COG5147 512 REB1 Myb superfamily proteins, including transcrip 86.29
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 85.55
COG5147 512 REB1 Myb superfamily proteins, including transcrip 85.48
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 83.69
KOG4282345 consensus Transcription factor GT-2 and related pr 80.65
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information 
Probab=99.65  E-value=2.3e-16  Score=117.25  Aligned_cols=50  Identities=48%  Similarity=0.716  Sum_probs=46.1

Q ss_pred             cCCCCCCHHHHHHHHHHHHHhCh-hh---HHHHhhcC-CC-CHHHHHHHHHHHHHH
Q 021972           64 KSRESWTEPEHDKFLEALQLFDR-DW---KKIEAFIG-SK-TVIQIRSHAQKYFLK  113 (304)
Q Consensus        64 k~r~~WTeEEh~lFLeaLe~yGr-dW---kkIA~~Vg-TR-T~~QVrSHAQKYf~k  113 (304)
                      |.|..||+|||.+||+||+.||+ +|   ++|+++++ ++ |..||+||+||||++
T Consensus         1 k~r~~WT~eeh~~Fl~ai~~~G~g~~a~pk~I~~~~~~~~lT~~qV~SH~QKy~~k   56 (57)
T TIGR01557         1 KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLK   56 (57)
T ss_pred             CCCCCCCHHHHHHHHHHHHHhCCCcccchHHHHHHcCCCCCCHHHHHHHHHHHHcc
Confidence            46789999999999999999998 99   99998765 77 999999999999986

This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by Pfam model pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif.
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03162 golden-2 like transcription factor; Provisional Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] Back     alignment and domain information
>KOG4329 consensus DNA-binding protein [General function prediction only] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG3841 consensus TEF-1 and related transcription factor, TEAD family [Transcription] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>smart00426 TEA TEA domain Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PF01285 TEA: TEA/ATTS domain family; InterPro: IPR000818 Transcriptional enhancer activators are nuclear proteins that contain a TEA/ATTSdomain, a DNA-binding region of 66-68 amino acids Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query304
2cu7_A72 Solution Structure Of The Sant Domain Of Human Kiaa 7e-06
>pdb|2CU7|A Chain A, Solution Structure Of The Sant Domain Of Human Kiaa1915 Protein Length = 72 Back     alignment and structure 
Iteration: 1

 Score = 47.8 bits (112), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 31/50 (62%)
Query: 69  WTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKNG 118
           WT  E + F + L  F R W KI   IGS+TV+Q++S+A++YF    K G
Sbjct: 12  WTIEEKELFEQGLAKFGRRWTKISKLIGSRTVLQVKSYARQYFKNKVKCG 61

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query304
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 8e-26
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 2e-19
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 5e-19
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 2e-15
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 4e-13
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 7e-13
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 3e-10
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 4e-09
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 1e-08
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 2e-06
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 2e-06
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 9e-06
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 3e-05
2cjj_A93 Radialis; plant development, DNA-binding protein, 2e-04
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
 Score = 96.8 bits (241), Expect = 8e-26
 Identities = 23/65 (35%), Positives = 35/65 (53%)

Query: 63  TKSRESWTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKNGTAEH 122
           +     WT  E + F + L  F R W KI   IGS+TV+Q++S+A++YF    K G  + 
Sbjct: 6   SGYSVKWTIEEKELFEQGLAKFGRRWTKISKLIGSRTVLQVKSYARQYFKNKVKCGLDKE 65

Query: 123 LPPPR 127
            P  +
Sbjct: 66  TPNQK 70
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Length = 64 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Length = 482 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Length = 74 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Length = 93 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query304
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.67
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.63
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.59
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.49
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 99.48
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.46
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 99.37
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.35
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.31
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.3
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.3
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.29
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.27
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.9
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.24
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.22
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.22
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 99.21
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.2
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.14
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.09
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 99.09
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 99.08
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.04
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.03
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.02
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.02
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.01
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.98
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 98.96
2crg_A70 Metastasis associated protein MTA3; transcription 98.96
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 98.94
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 98.9
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 98.9
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 98.89
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 98.81
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 98.76
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 98.73
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 98.71
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 98.7
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 98.69
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 98.68
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.68
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.63
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 98.29
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.39
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 97.36
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 97.26
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.14
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 97.07
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 96.2
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 96.16
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 95.9
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 95.64
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 95.62
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 94.52
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 93.46
1ig6_A107 MRF-2, modulator recognition factor 2; DNA binding 92.2
2hzd_A82 Transcriptional enhancer factor TEF-1; DNA-binding 89.04
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 87.07
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 85.14
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 84.46
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 82.2
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
Probab=99.67  E-value=4.4e-17  Score=126.25  Aligned_cols=61  Identities=26%  Similarity=0.381  Sum_probs=57.0

Q ss_pred             CCCCCCCCCcccccCCCCCCHHHHHHHHHHHHHhChhhHHHHhhcCCCCHHHHHHHHHHHH
Q 021972           51 DPSKKIRKPYTITKSRESWTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYF  111 (304)
Q Consensus        51 d~~kk~rKPytitk~r~~WTeEEh~lFLeaLe~yGrdWkkIA~~VgTRT~~QVrSHAQKYf  111 (304)
                      .+++|.+++++....+..||+||+++||+||++||++|++||++|++||..||+.||++|+
T Consensus         3 sg~~~~~~~~~~~~~~~~WT~eEd~~Ll~~v~~~G~~W~~IA~~v~~RT~~qcr~r~~~~~   63 (79)
T 2yus_A            3 SGSSGTLAKSKGASAGREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLP   63 (79)
T ss_dssp             CSSSCCCCCCCSSCCSCCCCHHHHHHHHHHHHHSSSCHHHHHHHHSSCCHHHHHHHHTTSC
T ss_pred             CcccCccCCccccccCCCcCHHHHHHHHHHHHHhCCCHHHHHHHcCCCCHHHHHHHHHHhc
Confidence            4678889999999999999999999999999999999999999999999999999998763
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>1ig6_A MRF-2, modulator recognition factor 2; DNA binding protein, DNA-binding motif, protein-DNA interaction; NMR {Homo sapiens} SCOP: a.4.3.1 PDB: 2oeh_A Back     alignment and structure
>2hzd_A Transcriptional enhancer factor TEF-1; DNA-binding, helix-turn-helix, gene regulation; NMR {Homo sapiens} Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 304
d1irza_64 a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis th 3e-14
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 4e-13
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 4e-12
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 9e-12
d2crga157 a.4.1.3 (A:8-64) Metastasis associated protein MTA 2e-10
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 3e-08
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 8e-06
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 5e-04
d2cqqa159 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 5e-04
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 0.003
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: GARP response regulators
domain: Arr10-B
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 64.2 bits (156), Expect = 3e-14
 Identities = 15/58 (25%), Positives = 25/58 (43%), Gaps = 5/58 (8%)

Query: 64  KSRESWTEPEHDKFLEALQLFDRDWKKIEA-----FIGSKTVIQIRSHAQKYFLKVQK 116
           K R  WT   H+KFL A+     +    +       +   T   + SH QK+ + ++K
Sbjct: 5   KPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVALKK 62
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query304
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.58
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 99.57
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.53
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.37
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.34
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.32
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.32
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.3
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.23
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.21
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 99.12
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.04
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.01
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 98.84
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 98.52
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.49
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.45
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 97.85
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 96.92
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 93.01
d1ig6a_107 MRF-2 DNA-binding domain {Human (Homo sapiens) [Ta 86.31
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 85.86
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 83.6
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: MYSM1 (KIAA1915)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.58  E-value=2e-15  Score=109.43  Aligned_cols=53  Identities=42%  Similarity=0.720  Sum_probs=49.8

Q ss_pred             CCCCHHHHHHHHHHHHHhChhhHHHHhhcCCCCHHHHHHHHHHHHHHHhhcCC
Q 021972           67 ESWTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKNGT  119 (304)
Q Consensus        67 ~~WTeEEh~lFLeaLe~yGrdWkkIA~~VgTRT~~QVrSHAQKYf~kl~k~g~  119 (304)
                      ..||+||+++|++++++||++|..||.+|++||..||++|+++|+.+..+.+.
T Consensus         3 ~~WT~eEd~~l~~~~~~~G~~W~~Ia~~~~~Rt~~q~k~ry~~~~~~~~k~~~   55 (65)
T d2cu7a1           3 VKWTIEEKELFEQGLAKFGRRWTKISKLIGSRTVLQVKSYARQYFKNKVKCGL   55 (65)
T ss_dssp             CCCCHHHHHHHHHHHHHTCSCHHHHHHHHSSSCHHHHHHHHHHHHHHHSCSCT
T ss_pred             CCCCHHHHHHHHHHHHHhcchHHHHHHHcCCCCHHHHHHHHHHHHHHHHhcCC
Confidence            57999999999999999999999999999999999999999999998876653
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ig6a_ a.4.3.1 (A:) MRF-2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure