Citrus Sinensis ID: 022029
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 304 | ||||||
| 297745663 | 376 | unnamed protein product [Vitis vinifera] | 1.0 | 0.808 | 0.884 | 1e-156 | |
| 225469908 | 304 | PREDICTED: nitric oxide synthase-interac | 1.0 | 1.0 | 0.884 | 1e-155 | |
| 224078772 | 304 | predicted protein [Populus trichocarpa] | 1.0 | 1.0 | 0.884 | 1e-153 | |
| 224145334 | 304 | predicted protein [Populus trichocarpa] | 1.0 | 1.0 | 0.881 | 1e-152 | |
| 224116278 | 304 | predicted protein [Populus trichocarpa] | 1.0 | 1.0 | 0.891 | 1e-152 | |
| 356554961 | 304 | PREDICTED: nitric oxide synthase-interac | 1.0 | 1.0 | 0.875 | 1e-150 | |
| 388497328 | 304 | unknown [Medicago truncatula] | 1.0 | 1.0 | 0.868 | 1e-149 | |
| 449445640 | 304 | PREDICTED: nitric oxide synthase-interac | 1.0 | 1.0 | 0.871 | 1e-149 | |
| 217074052 | 304 | unknown [Medicago truncatula] gi|3885066 | 1.0 | 1.0 | 0.865 | 1e-149 | |
| 388516035 | 304 | unknown [Medicago truncatula] | 1.0 | 1.0 | 0.865 | 1e-149 |
| >gi|297745663|emb|CBI40874.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 555 bits (1431), Expect = e-156, Method: Compositional matrix adjust.
Identities = 269/304 (88%), Positives = 288/304 (94%)
Query: 1 MPQRHSKNNNDLAFFTYDEKRKLGYGTQKERLGKDSIKPFDACCLCLKPFIDPLCCQKGH 60
MPQRHSKNNNDLAFFTYDEKRKLGYGTQKERLG+DSIKPFDACCLCLKPFIDPLCCQKGH
Sbjct: 73 MPQRHSKNNNDLAFFTYDEKRKLGYGTQKERLGRDSIKPFDACCLCLKPFIDPLCCQKGH 132
Query: 61 IYCKECILECLLSQKKDIQRKLVAHAAQQKQEKEEEEERLMLQKARELDAFDQQNHGAVP 120
++CKECILECLL+QKKDIQRKL AHAAQ KQEKEEEEERL LQKARELDAFDQQNHGAVP
Sbjct: 133 VFCKECILECLLAQKKDIQRKLAAHAAQLKQEKEEEEERLTLQKARELDAFDQQNHGAVP 192
Query: 121 QYNDRNHSQDKNGFHGANSVKVTSYEEEALRTMKAFWLPSATPEAPVKVEAPSASTICPE 180
QY+D+NH++DKNGFHGANSVKVTSYEEEALR MKAFWLPSATPEAPVKVEAPS ST+CPE
Sbjct: 193 QYSDKNHTRDKNGFHGANSVKVTSYEEEALRNMKAFWLPSATPEAPVKVEAPSTSTVCPE 252
Query: 181 GKEKLKLKSLFPVYFTEDKSEEKKSSSNDKSFICPSCKVTLTNTLSLVALSSCGHVFCKK 240
G EKLKLK+LFP++ TED+SE+KKS S DK++ICPSCKVTLTNT+SLVALSSCGHVFCKK
Sbjct: 253 GNEKLKLKTLFPIHLTEDRSEQKKSKSLDKTYICPSCKVTLTNTMSLVALSSCGHVFCKK 312
Query: 241 CADKFMAVDKVCLVCNKPCKERNLVNVEKGGTGFAAHGDRLEARDFKHLGSGSGLGLVRP 300
CA KFMAVDKVCLVCNK CK+RNLV +EKGGTGFA HGD LEA DFKHLGSGSGLGLVRP
Sbjct: 313 CAGKFMAVDKVCLVCNKGCKDRNLVPLEKGGTGFAGHGDHLEATDFKHLGSGSGLGLVRP 372
Query: 301 AAKT 304
A KT
Sbjct: 373 AMKT 376
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225469908|ref|XP_002272953.1| PREDICTED: nitric oxide synthase-interacting protein [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224078772|ref|XP_002305622.1| predicted protein [Populus trichocarpa] gi|222848586|gb|EEE86133.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224145334|ref|XP_002336220.1| predicted protein [Populus trichocarpa] gi|222832676|gb|EEE71153.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224116278|ref|XP_002317258.1| predicted protein [Populus trichocarpa] gi|222860323|gb|EEE97870.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356554961|ref|XP_003545809.1| PREDICTED: nitric oxide synthase-interacting protein homolog [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388497328|gb|AFK36730.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449445640|ref|XP_004140580.1| PREDICTED: nitric oxide synthase-interacting protein-like [Cucumis sativus] gi|449529519|ref|XP_004171747.1| PREDICTED: nitric oxide synthase-interacting protein-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|217074052|gb|ACJ85386.1| unknown [Medicago truncatula] gi|388506672|gb|AFK41402.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|388516035|gb|AFK46079.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 304 | ||||||
| TAIR|locus:2200898 | 310 | AT1G61620 [Arabidopsis thalian | 0.996 | 0.977 | 0.713 | 3.9e-124 | |
| DICTYBASE|DDB_G0270882 | 333 | nosip "putative nitric oxide s | 0.437 | 0.399 | 0.347 | 9.5e-42 | |
| ZFIN|ZDB-GENE-041114-146 | 304 | nosip "nitric oxide synthase i | 0.927 | 0.927 | 0.318 | 1.7e-36 | |
| UNIPROTKB|F1RHW0 | 301 | NOSIP "Uncharacterized protein | 0.269 | 0.272 | 0.476 | 9.5e-33 | |
| UNIPROTKB|Q9Y314 | 301 | NOSIP "Nitric oxide synthase-i | 0.904 | 0.913 | 0.311 | 7.7e-32 | |
| RGD|1309992 | 301 | Nosip "nitric oxide synthase i | 0.269 | 0.272 | 0.465 | 2.7e-31 | |
| UNIPROTKB|Q3SWY5 | 302 | NOSIP "Nitric oxide synthase-i | 0.911 | 0.917 | 0.306 | 3.3e-31 | |
| MGI|MGI:1913644 | 301 | Nosip "nitric oxide synthase i | 0.269 | 0.272 | 0.465 | 4.5e-31 | |
| FB|FBgn0030915 | 307 | CG6179 [Drosophila melanogaste | 0.927 | 0.918 | 0.258 | 1.3e-29 | |
| UNIPROTKB|E2R5E4 | 417 | NOSIP "Uncharacterized protein | 0.904 | 0.659 | 0.301 | 1.6e-29 |
| TAIR|locus:2200898 AT1G61620 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1220 (434.5 bits), Expect = 3.9e-124, P = 3.9e-124
Identities = 222/311 (71%), Positives = 256/311 (82%)
Query: 1 MPQRHSKNNNDLAFFTYDEKRKLGYGTQKERLGKDSIKPFDACCLCLKPFIDPLCCQKGH 60
MPQRHSKNNNDLA+FTYDEK+KLGYGTQ+ERLG+DSIKPFDAC LCLKPFIDP+CC KGH
Sbjct: 1 MPQRHSKNNNDLAYFTYDEKKKLGYGTQRERLGRDSIKPFDACSLCLKPFIDPMCCHKGH 60
Query: 61 IYCKECILECLLSQKKDIQRKLVAHAAXXXXXXXXXXXRLMLQKARELDAFDQQNHGAVP 120
++C+ECILEC L+QKKDIQR+L AH++ RLMLQKARELD FDQQNH A+P
Sbjct: 61 VFCRECILECFLAQKKDIQRRLAAHSSQKKQDKDEEEERLMLQKARELDEFDQQNHSAMP 120
Query: 121 QYNDRNHSQDKNGFHGANSVKVTSYEEEALRTMKAFWLPSATPEAPVKVEAPSASTICPE 180
+ +D+NH++DKNGFHGANSVK TS+EEEALRTMKAFWLPSATP A V+V+AP T+CPE
Sbjct: 121 RNSDKNHNEDKNGFHGANSVKTTSFEEEALRTMKAFWLPSATPAASVRVDAPETHTVCPE 180
Query: 181 GKEKLKLKSLFPVYFTX-------XXXXXXXXXXXXXXFICPSCKVTLTNTLSLVALSSC 233
GKEKLKLK+LF + FT +ICPSCKVTLTNT+SLVALSSC
Sbjct: 181 GKEKLKLKNLFAIRFTEDNSEEEETKTKSASSSSYDKSYICPSCKVTLTNTMSLVALSSC 240
Query: 234 GHVFCKKCADKFMAVDKVCLVCNKPCKERNLVNVEKGGTGFAAHGDRLEARDFKHLGSGS 293
GHVFCKKCA+KFM VDKVCLVC+KPCK+RNLV ++KGGTGFA H D LEA+++KHLGSGS
Sbjct: 241 GHVFCKKCAEKFMPVDKVCLVCDKPCKDRNLVGLKKGGTGFAEHDDHLEAKEYKHLGSGS 300
Query: 294 GLGLVRPAAKT 304
GLGLVRP KT
Sbjct: 301 GLGLVRPV-KT 310
|
|
| DICTYBASE|DDB_G0270882 nosip "putative nitric oxide synthase-interacting protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-041114-146 nosip "nitric oxide synthase interacting protein" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RHW0 NOSIP "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9Y314 NOSIP "Nitric oxide synthase-interacting protein" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|1309992 Nosip "nitric oxide synthase interacting protein" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3SWY5 NOSIP "Nitric oxide synthase-interacting protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1913644 Nosip "nitric oxide synthase interacting protein" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0030915 CG6179 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R5E4 NOSIP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 304 | |||
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 2e-06 | |
| pfam04641 | 254 | pfam04641, Rtf2, Replication termination factor 2 | 2e-04 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 0.002 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 0.002 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 0.002 | |
| pfam13445 | 55 | pfam13445, zf-RING_LisH, RING-type zinc-finger, Li | 0.002 | |
| COG5222 | 427 | COG5222, COG5222, Uncharacterized conserved protei | 0.003 |
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
Score = 43.6 bits (103), Expect = 2e-06
Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 3/48 (6%)
Query: 210 KSFICPSCKVTLTNTLSLVALSSCGHVFCKKCADKFMAVDKVCLVCNK 257
+ CP C L + V L+ CGHVFC++C +++ C +C
Sbjct: 1 EELECPICLDLLRDP---VVLTPCGHVFCRECILRYLKKKSKCPICRT 45
|
Length = 45 |
| >gnl|CDD|218188 pfam04641, Rtf2, Replication termination factor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif | Back alignment and domain information |
|---|
| >gnl|CDD|227547 COG5222, COG5222, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 304 | |||
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 100.0 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 99.97 | |
| KOG0883 | 518 | consensus Cyclophilin type, U box-containing pepti | 99.96 | |
| KOG3113 | 293 | consensus Uncharacterized conserved protein [Funct | 99.82 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 99.15 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.14 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 99.12 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 98.85 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 98.85 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.84 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 98.77 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.74 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.72 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 98.67 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.62 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.6 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 98.56 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 98.55 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 98.53 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.49 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.48 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.48 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.41 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.4 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 98.33 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.23 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.21 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 98.21 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.13 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.08 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 98.03 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 98.02 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 98.0 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 97.94 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 97.87 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 97.87 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 97.8 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 97.75 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 97.75 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.62 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.6 | |
| KOG3800 | 300 | consensus Predicted E3 ubiquitin ligase containing | 97.58 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.57 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.5 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.39 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 97.36 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 97.32 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 97.31 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.26 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 97.16 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.11 | |
| KOG2817 | 394 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.0 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 96.89 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 96.77 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 96.75 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 96.69 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 96.67 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 96.65 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.57 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 96.54 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.53 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 96.35 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 96.35 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 96.34 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.27 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 96.24 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 96.17 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 96.12 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.08 | |
| COG5109 | 396 | Uncharacterized conserved protein, contains RING Z | 96.0 | |
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 95.78 | |
| KOG0289 | 506 | consensus mRNA splicing factor [General function p | 95.72 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.67 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 95.65 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 95.59 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 95.25 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 95.23 | |
| KOG0289 | 506 | consensus mRNA splicing factor [General function p | 95.18 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.12 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 95.09 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 95.08 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.02 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 94.91 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 94.82 | |
| KOG4367 | 699 | consensus Predicted Zn-finger protein [Function un | 94.72 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 94.46 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 94.42 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 94.07 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 94.05 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 94.0 | |
| KOG2932 | 389 | consensus E3 ubiquitin ligase involved in ubiquiti | 93.82 | |
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 93.51 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 93.39 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.11 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 93.09 | |
| PF02891 | 50 | zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 | 93.08 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 92.69 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.07 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 92.06 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 91.66 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 91.41 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.22 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 90.85 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 90.34 | |
| KOG1940 | 276 | consensus Zn-finger protein [General function pred | 90.15 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 89.86 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 89.09 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 88.49 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 88.43 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 88.05 | |
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 87.98 | |
| KOG2979 | 262 | consensus Protein involved in DNA repair [General | 87.97 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 87.93 | |
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 87.88 | |
| PHA02524 | 498 | 43A DNA polymerase subunit A; Provisional | 86.81 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 86.73 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 86.39 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 85.53 | |
| KOG2169 | 636 | consensus Zn-finger transcription factor [Transcri | 85.16 | |
| PF06936 | 190 | Selenoprotein_S: Selenoprotein S (SelS); InterPro: | 84.69 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 84.04 | |
| PF03854 | 50 | zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc | 83.32 | |
| cd00350 | 33 | rubredoxin_like Rubredoxin_like; nonheme iron bind | 82.95 | |
| PF05605 | 54 | zf-Di19: Drought induced 19 protein (Di19), zinc-b | 82.55 | |
| KOG2930 | 114 | consensus SCF ubiquitin ligase, Rbx1 component [Po | 80.93 | |
| smart00064 | 68 | FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 | 80.62 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 80.6 | |
| PF06906 | 57 | DUF1272: Protein of unknown function (DUF1272); In | 80.55 | |
| KOG2979 | 262 | consensus Protein involved in DNA repair [General | 80.31 |
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.3e-92 Score=628.79 Aligned_cols=292 Identities=47% Similarity=0.768 Sum_probs=264.8
Q ss_pred CCCccccCCCCCccccHHHHhh----cCCCCcccccCCCCcCCCcceecccCCCCCceecCCCceeehhhHHHHHHHhhH
Q 022029 1 MPQRHSKNNNDLAFFTYDEKRK----LGYGTQKERLGKDSIKPFDACCLCLKPFIDPLCCQKGHIYCKECILECLLSQKK 76 (304)
Q Consensus 1 m~~rHsKn~ta~~~~Ty~Er~~----~~~Gt~~~Rlg~ds~~~F~~C~LcL~p~~dPV~t~~G~lyckEcIle~ll~qkk 76 (304)
|| ||+|||||++||||||+++ +|||||.+|||+||+++||||+|||+|++||||||+||||||||||||||+|||
T Consensus 1 mt-RH~kN~ta~avyTY~EkkkdaaasGYGTq~~RLgrDsiK~FdcCsLtLqPc~dPvit~~GylfdrEaILe~ilaqKk 79 (303)
T KOG3039|consen 1 MT-RHGKNCTAGAVYTYHEKKKDAAASGYGTQRERLGRDSIKPFDCCSLTLQPCRDPVITPDGYLFDREAILEYILAQKK 79 (303)
T ss_pred CC-ccccCCccceeEeehhhcchhhhcCcchhhhhhcccccCCcceeeeecccccCCccCCCCeeeeHHHHHHHHHHHHH
Confidence 87 9999999999999999999 799999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCCCCCCC--C--CCCCCCCCCcCCCCccccchHHHHHhh
Q 022029 77 DIQRKLVAHAAQQKQEKEEEEERLMLQKARELDAFDQQNHGAVPQYND--R--NHSQDKNGFHGANSVKVTSYEEEALRT 152 (304)
Q Consensus 77 ei~r~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~F~~~~~~~~~~~~~--~--~~~~~~~~~~~~~~~~~~~~~~~~~k~ 152 (304)
+|+|++++||+|.++++.++++++..+.++.+++|.+.+....+.... + ...-++..+++.+.......++++++.
T Consensus 80 e~arrlkayekqrr~eed~e~qra~~q~~~~~~eF~~~e~~~~s~al~r~~~~~~ae~~a~~~~~~~~~~sn~~~d~~k~ 159 (303)
T KOG3039|consen 80 EIARRLKAYEKQRRAEEDKEEQRAMSQKARRLDEFDQQESTPESSALPRNPDTNSAEDAASFHGANSVSTSNMEEDKLKT 159 (303)
T ss_pred HHHHHHHHHHHHHHhhhhHHHHHHHhhhHHHHHHHHhhccccccccccCCCCcchhhhccCccccCCccccCcccccccc
Confidence 999999999999999999999999999999999999988865533221 2 122234556666666677778889999
Q ss_pred ccccccCCCCCCCC-ccccCCCCCccCCCCCCcCCCCCceeeecccCCCc--ccccCCCCCceeccCccccccCCcceEE
Q 022029 153 MKAFWLPSATPEAP-VKVEAPSASTICPEGKEKLKLKSLFPVYFTEDKSE--EKKSSSNDKSFICPSCKVTLTNTLSLVA 229 (304)
Q Consensus 153 l~sFWlps~tp~a~-~~~~kp~~~~~CP~sg~~l~lKDLi~l~f~~~~~~--~~~~~~~~~~~~CPIc~k~~~~~~~~v~ 229 (304)
||||||||+||+|. +++++|+.+++||++|+||+||||++|+|++.+++ ...+.+...+|+||||.++++|.+.+++
T Consensus 160 lpsFWlPs~tP~A~atklekP~~~v~CP~s~kplklkdL~~VkFT~l~s~~~et~l~a~s~ryiCpvtrd~LtNt~~ca~ 239 (303)
T KOG3039|consen 160 LPSFWLPSLTPTAAATKLEKPSTTVVCPVSGKPLKLKDLFAVKFTPLNSEETETKLIAASKRYICPVTRDTLTNTTPCAV 239 (303)
T ss_pred ccceecCccCchhhhhcccCCCceeeccCCCCccchhhcceeeeeecCCchhhhhhhhhccceecccchhhhcCccceEE
Confidence 99999999999988 78999999999999999999999999999997653 3334455678999999999999999999
Q ss_pred EccCCccchHHHHHHHhhcCCCCCCCCCCCCCCCceEecCCCccccccCCeeeeeecccccccc
Q 022029 230 LSSCGHVFCKKCADKFMAVDKVCLVCNKPCKERNLVNVEKGGTGFAAHGDRLEARDFKHLGSGS 293 (304)
Q Consensus 230 l~~CGhVfc~~Ci~~~~k~~~~CPvC~~~f~~~diI~L~~~gtgfaa~g~~~eak~~~~~~~~~ 293 (304)
+++||||||++|+++||..++.||+|+++++++|||.||++|||||.+|..++||.+||+|.+|
T Consensus 240 Lr~sg~Vv~~ecvEklir~D~v~pv~d~plkdrdiI~LqrGGTGfa~tndhlqAke~rp~lq~~ 303 (303)
T KOG3039|consen 240 LRPSGHVVTKECVEKLIRKDMVDPVTDKPLKDRDIIGLQRGGTGFAETNDHLQAKEYRPLLQAS 303 (303)
T ss_pred eccCCcEeeHHHHHHhccccccccCCCCcCcccceEeeecccccccccchhhhhhhhcccccCC
Confidence 9999999999999999999999999999999999999999999999999999999999999775
|
|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG0883 consensus Cyclophilin type, U box-containing peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3113 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >KOG0289 consensus mRNA splicing factor [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >KOG0289 consensus mRNA splicing factor [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4367 consensus Predicted Zn-finger protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1940 consensus Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >KOG2979 consensus Protein involved in DNA repair [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
| >PHA02524 43A DNA polymerase subunit A; Provisional | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2169 consensus Zn-finger transcription factor [Transcription] | Back alignment and domain information |
|---|
| >PF06936 Selenoprotein_S: Selenoprotein S (SelS); InterPro: IPR009703 This family consists of several mammalian selenoprotein S (SelS) sequences | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center | Back alignment and domain information |
|---|
| >PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins | Back alignment and domain information |
|---|
| >KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF06906 DUF1272: Protein of unknown function (DUF1272); InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length | Back alignment and domain information |
|---|
| >KOG2979 consensus Protein involved in DNA repair [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 304 | |||
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 6e-07 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 6e-04 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 2e-06 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 7e-05 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 3e-06 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 1e-04 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 4e-06 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 5e-06 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 2e-04 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 6e-06 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 1e-04 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 8e-06 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 2e-05 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 2e-05 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 3e-04 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 2e-05 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 7e-04 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 3e-05 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 3e-05 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 6e-05 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 7e-05 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 3e-04 | |
| 3k1f_M | 197 | Transcription initiation factor IIB; RNA polymeras | 1e-04 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 2e-04 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 2e-04 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 2e-04 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 6e-04 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 3e-04 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 4e-04 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 5e-04 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 5e-04 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 5e-04 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 6e-04 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 7e-04 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 6e-04 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 6e-04 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 6e-04 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 7e-04 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 7e-04 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 7e-04 |
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
Score = 45.9 bits (109), Expect = 6e-07
Identities = 14/58 (24%), Positives = 20/58 (34%), Gaps = 3/58 (5%)
Query: 209 DKSFICPSCKVTLTNTLSLVALSSCGHVFCKKCADKFMAVDKVCLVCNKPCKERNLVN 266
D C C + + C H +C C KF++ C C E +L N
Sbjct: 20 DDLLRCGICFEYFNIA---MIIPQCSHNYCSLCIRKFLSYKTQCPTCCVTVTEPDLKN 74
|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Length = 197 | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Length = 61 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 304 | |||
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.69 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.27 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 99.24 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 99.19 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 99.19 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.16 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 99.13 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 99.12 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.1 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.09 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.09 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.09 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 99.08 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.07 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.06 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.05 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 99.02 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.02 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 99.02 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 99.02 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.01 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 99.01 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.01 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 98.99 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 98.98 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 98.98 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 98.95 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 98.95 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 98.95 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 98.93 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.93 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 98.93 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 98.92 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.88 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 98.87 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 98.86 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 98.86 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 98.86 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 98.85 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 98.83 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 98.82 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 98.82 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 98.81 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 98.8 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.78 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 98.76 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 98.75 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 98.75 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 98.74 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 98.7 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 98.69 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 98.67 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 98.65 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 98.63 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.62 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.61 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 98.6 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.6 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 98.59 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.58 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.56 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.53 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 98.51 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 98.5 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.49 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.49 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.42 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.4 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.36 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.36 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 98.28 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.1 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 98.03 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 97.98 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 97.95 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 97.9 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 97.89 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 97.86 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 97.86 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 97.85 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 97.84 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 97.82 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 97.79 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 97.75 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 97.75 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 97.74 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 97.74 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 97.72 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 97.66 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 97.64 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 97.61 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 97.59 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 97.56 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 97.56 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 97.55 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 97.52 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 97.52 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 97.49 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 97.47 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 97.42 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 97.41 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 97.39 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 97.32 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 97.25 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 97.18 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 97.1 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 97.1 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 96.97 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 96.92 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 96.86 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 96.81 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 96.77 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 96.76 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 96.75 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 96.73 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 96.7 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 96.68 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 96.51 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 96.32 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 96.24 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 96.17 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 96.14 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 96.02 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 95.88 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 95.77 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 95.71 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 95.39 | |
| 1joc_A | 125 | EEA1, early endosomal autoantigen 1; FYVE domain, | 95.28 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 95.19 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 95.02 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 94.97 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 94.71 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 94.12 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 93.84 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 93.63 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 93.45 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 93.15 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 92.98 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 92.97 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 92.95 | |
| 4fo9_A | 360 | E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom | 92.89 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 92.78 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 91.95 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 91.28 | |
| 1weo_A | 93 | Cellulose synthase, catalytic subunit (IRX3); stru | 88.55 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 85.77 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 85.49 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 84.84 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 83.91 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 81.77 | |
| 1y02_A | 120 | CARP2, FYVE-ring finger protein sakura; zinc-bindi | 81.15 | |
| 1wfk_A | 88 | Zinc finger, FYVE domain containing 19; riken stru | 81.13 | |
| 1z2q_A | 84 | LM5-1; membrane protein, FYVE domain, zinc-finger; | 80.41 |
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
Probab=99.69 E-value=1.4e-17 Score=135.81 Aligned_cols=81 Identities=25% Similarity=0.632 Sum_probs=68.5
Q ss_pred ccCCCCCCcCCCCCceeeecccCCCcccccCCCCCceeccCccccccCC---cceEEEccCCccchHHHHHHHhhcCCCC
Q 022029 176 TICPEGKEKLKLKSLFPVYFTEDKSEEKKSSSNDKSFICPSCKVTLTNT---LSLVALSSCGHVFCKKCADKFMAVDKVC 252 (304)
Q Consensus 176 ~~CP~sg~~l~lKDLi~l~f~~~~~~~~~~~~~~~~~~CPIc~k~~~~~---~~~v~l~~CGhVfc~~Ci~~~~k~~~~C 252 (304)
..||+-..++..+++.++.+.. ....|+||++.|.+. .+.+++.+|||+||..||.+|+.....|
T Consensus 49 ~~CP~Cr~~~~~~~l~~l~i~~------------~~~~C~iC~~~~~~~~~~~~~~~~~~CgH~fc~~Ci~~~~~~~~~C 116 (133)
T 4ap4_A 49 NTCPTCRKKINHKRYHPIYIGS------------GTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTC 116 (133)
T ss_dssp SBCTTTCCBCTTTCEEECBCSS------------SSCBCTTTCCBHHHHHHTTCCEEEETTSBEEEHHHHHHHHHHCSBC
T ss_pred CCCCCCCCcCccccccccccCC------------CCCCCCCCCCccccccccCcceEeCCCCChhhHHHHHHHHHcCCCC
Confidence 4799999999999998876532 346899999999764 2344678999999999999999888999
Q ss_pred CCCCCCCCCCCceEec
Q 022029 253 LVCNKPCKERNLVNVE 268 (304)
Q Consensus 253 PvC~~~f~~~diI~L~ 268 (304)
|+|+.++..+++++|.
T Consensus 117 P~Cr~~~~~~~~~~~~ 132 (133)
T 4ap4_A 117 PTCRKKINHKRYHPIY 132 (133)
T ss_dssp TTTCCBCCGGGEEEEC
T ss_pred CCCCCcCChhcceeee
Confidence 9999999999998874
|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} | Back alignment and structure |
|---|
| >1y02_A CARP2, FYVE-ring finger protein sakura; zinc-binding module, phosphoinositide binding, caspase regulation, metal binding protein; 1.80A {Homo sapiens} SCOP: a.140.2.1 g.50.1.1 | Back alignment and structure |
|---|
| >1wfk_A Zinc finger, FYVE domain containing 19; riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Mus musculus} SCOP: g.50.1.1 | Back alignment and structure |
|---|
| >1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 304 | ||||
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 4e-06 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 0.001 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 6e-05 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 9e-05 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 1e-04 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 1e-04 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 5e-04 | |
| d2baya1 | 56 | g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { | 2e-04 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 4e-04 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 8e-04 | |
| d3dplr1 | 88 | g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S | 5e-04 | |
| d1t1ha_ | 78 | g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre | 0.002 |
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: V(D)J recombination activating protein 1 (RAG1), dimerization domain species: Mouse (Mus musculus) [TaxId: 10090]
Score = 42.2 bits (99), Expect = 4e-06
Identities = 16/58 (27%), Positives = 24/58 (41%), Gaps = 5/58 (8%)
Query: 209 DKSFICPSCKVTLTNTLSLVALSSCGHVFCKKCADKFMAV-DKVCLVCNKPCKERNLV 265
KS C C+ L + + C H+FC+ C + + V C C PC +L
Sbjct: 21 VKSISCQICEHILADPVETS----CKHLFCRICILRCLKVMGSYCPSCRYPCFPTDLE 74
|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 304 | |||
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.39 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.19 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.07 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.06 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 99.0 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 98.99 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 98.97 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 98.96 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 98.96 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.95 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.9 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 98.83 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.8 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.56 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 98.54 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 98.52 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 98.45 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 98.42 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 98.3 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.17 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 98.1 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 98.05 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 97.98 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 97.98 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 97.35 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 97.1 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 96.85 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 96.45 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 96.09 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 95.33 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 94.83 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 94.34 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 94.17 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 92.89 | |
| d1dx8a_ | 70 | Rubredoxin {Guillardia theta [TaxId: 55529]} | 91.12 | |
| d1weoa_ | 93 | Cellulose synthase A catalytic subunit 7, IRX3 {Th | 87.99 | |
| d1ibia2 | 31 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 85.48 |
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: U-box domain: Pre-mRNA splicing factor Prp19 species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.39 E-value=6.1e-14 Score=97.82 Aligned_cols=56 Identities=13% Similarity=0.216 Sum_probs=50.6
Q ss_pred eeccCccccccCCcceEEEccCCccchHHHHHHHhhcCCCCCCCCCCCCCCCceEecCC
Q 022029 212 FICPSCKVTLTNTLSLVALSSCGHVFCKKCADKFMAVDKVCLVCNKPCKERNLVNVEKG 270 (304)
Q Consensus 212 ~~CPIc~k~~~~~~~~v~l~~CGhVfc~~Ci~~~~k~~~~CPvC~~~f~~~diI~L~~~ 270 (304)
+.||||++.|.++ |++..|||+||.+||.+|+..+..||+|+.+++.+|+|+|.+.
T Consensus 1 l~C~Ic~~~~~~P---v~~~~cGh~fc~~cI~~~l~~~~~CP~c~~~l~~~dLipik~~ 56 (56)
T d2baya1 1 MLCAISGKVPRRP---VLSPKSRTIFEKSLLEQYVKDTGNDPITNEPLSIEEIVEIVPS 56 (56)
T ss_dssp CCCTTTCSCCSSE---EEETTTTEEEEHHHHHHHHHHHSBCTTTCCBCCGGGCEECCCC
T ss_pred CCCccCCchHHhc---CccCCCCCcccHHHHHHHHhhccCCCccCCcCCHHhceeCCCC
Confidence 3799999999998 4566799999999999999988899999999999999999763
|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1dx8a_ g.41.5.1 (A:) Rubredoxin {Guillardia theta [TaxId: 55529]} | Back information, alignment and structure |
|---|
| >d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|