Citrus Sinensis ID: 022069


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300---
MEEEQEALNIDACEGMDVVFENCGSSSRFFSPIVFLDAIWNMAFVVVSVIVLFSTLKEKPATPLRVWVSGYALQCFLHVGFVFFEYRRKNYCGHRVALVVNGLSPSQTSLSVVKRLGAMNTMISSIWWVIGFYWIVVGGQALVRDSPRLYWVTVVFLAFDVSFVIFCIGMVCIFFFAIFCCIPIVALVYAVATRQGASADDIRNLPKYRYRLASHLRASNNSEKQDVFGTETEMSNSNSTDELALHPEDSDCCICLSQYVDGAELYTLPCNHHFHCGCISKWLRINATCPLCKYNIRRGDTLV
cHHHHHHccccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHEEEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHEEEEEEEEccccccccccccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHcccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccHHHHHcccccccccccccccccccc
cHHHHHHHcccHHHHHHHHHHHHHccHccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHEEEEEHHHHHHEEHHHEHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcEEEEEccccccHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccEEEEccccccccccccccccccEEEcEccccccccccccccccEEEEEEEcccccccEEEccccccHHHHHHHHHHHHHccccHcHHHHccccccc
MEEEQEAlnidacegmdvvfencgsssrffspiVFLDAIWNMAFVVVSVIVLFStlkekpatplrvWVSGYALQCFLHVGFVFFEYRRKNYCGHRVALVVnglspsqtSLSVVKRLGAMNTMISSIWWVIGFYWIVVGgqalvrdsprlYWVTVVFLAFDVSFVIFCIGMVCIFFFAIFCCIPIVALVYAVATrqgasaddirnLPKYRYRLASHLrasnnsekqdvfgtetemsnsnstdelalhpedsdcciclsqyvdgaelytlpcnhhfhcgciskwlrinatcplckynirrgdtlv
MEEEQEAlnidacegMDVVFENCGSSSRFFSPIVFLDAIWNMAFVVVSVIVLFSTLKEKPATPLRVWVSGYALQCFLHVGFVFFEYRRKNYCGHRVALVvnglspsqTSLSVVKRLGAMNTMISSIWWVIGFYWIVVGGQALVRDSPRLYWVTVVFLAFDVSFVIFCIGMVCIFFFAIFCCIPIVALVYAVATRqgasaddirnlPKYRYRLAshlrasnnsekqdVFGTETEMSNSNSTDELALHPEDSDCCICLSQYVDGAELYTLPCNHHFHCGCISKWLRINATCplckynirrgdtlv
MEEEQEALNIDACEGMDVVFENCGSSSRFFSPIVFLDAIWNMAFVVVSVIVLFSTLKEKPATPLRVWVSGYALQCFLHVGFVFFEYRRKNYCGHRVALVVNGLSPSQTSLSVVKRLGAMNTMISSIWWVIGFYWIVVGGQALVRDSPRLYWVTVVFLAFDVSFVIFCIGMVcifffaifccipiVALVYAVATRQGASADDIRNLPKYRYRLASHLRASNNSEKQDVFGTETEMSNSNSTDELALHPEDSDCCICLSQYVDGAELYTLPCNHHFHCGCISKWLRINATCPLCKYNIRRGDTLV
********NIDACEGMDVVFENCGSSSRFFSPIVFLDAIWNMAFVVVSVIVLFSTLKEKPATPLRVWVSGYALQCFLHVGFVFFEYRRKNYCGHRVALVVNGLSPSQTSLSVVKRLGAMNTMISSIWWVIGFYWIVVGGQALVRDSPRLYWVTVVFLAFDVSFVIFCIGMVCIFFFAIFCCIPIVALVYAVATRQGASADDIRNLPKYRYRLA************************************SDCCICLSQYVDGAELYTLPCNHHFHCGCISKWLRINATCPLCKYNIR******
***************************RFFSPIVFLDAIWNMAFVVVSVIVLFSTLKEKPATPLRVWVSGYALQCFLHVGFVFFEYR*************************VKRLGAMNTMISSIWWVIGFYWIVVGGQALVRDSPRLYWVTVVFLAFDVSFVIFCIGMVCIFFFAIFCCIPIVALVYAVATR*****************************************************EDSDCCICLSQYVDGAELYTLPCNHHFHCGCISKWLRINATCPLCKYNIR******
MEEEQEALNIDACEGMDVVFENCGSSSRFFSPIVFLDAIWNMAFVVVSVIVLFSTLKEKPATPLRVWVSGYALQCFLHVGFVFFEYRRKNYCGHRVALVVNGLSPSQTSLSVVKRLGAMNTMISSIWWVIGFYWIVVGGQALVRDSPRLYWVTVVFLAFDVSFVIFCIGMVCIFFFAIFCCIPIVALVYAVATRQGASADDIRNLPKYRYRLASHLRASNNSEKQDV***************LALHPEDSDCCICLSQYVDGAELYTLPCNHHFHCGCISKWLRINATCPLCKYNIRRGDTLV
****QEALNIDACEGMDVVFENCGSSSRFFSPIVFLDAIWNMAFVVVSVIVLFSTLKEKPATPLRVWVSGYALQCFLHVGFVFFEYRRKNY****************TSLSVVKRLGAMNTMISSIWWVIGFYWIVVGGQALVRDSPRLYWVTVVFLAFDVSFVIFCIGMVCIFFFAIFCCIPIVALVYAVATRQGASADDIRNLPKYRYRLA***************GTETEMSNSNSTDELALHPEDSDCCICLSQYVDGAELYTLPCNHHFHCGCISKWLRINATCPLCKYNIRR*****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEEEQEALNIDACEGMDVVFENCGSSSRFFSPIVFLDAIWNMAFVVVSVIVLFSTLKEKPATPLRVWVSGYALQCFLHVGFVFFEYRRKNYCGHRVALVVNGLSPSQTSLSVVKRLGAMNTMISSIWWVIGFYWIVVGGQALVRDSPRLYWVTVVFLAFDVSFVIFCIGMVCIFFFAIFCCIPIVALVYAVATRQGASADDIRNLPKYRYRLASHLRASNNSEKQDVFGTETEMSNSNSTDELALHPEDSDCCICLSQYVDGAELYTLPCNHHFHCGCISKWLRINATCPLCKYNIRRGDTLV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query303 2.2.26 [Sep-21-2011]
Q93Z92390 E3 ubiquitin-protein liga no no 0.874 0.679 0.463 4e-65
Q8GUU2359 E3 ubiquitin protein liga no no 0.891 0.752 0.432 6e-64
Q9LN71408 E3 ubiquitin-protein liga no no 0.904 0.671 0.438 2e-62
Q8LDB8381 E3 ubiquitin-protein liga no no 0.887 0.706 0.458 6e-55
Q5SSZ7 913 E3 ubiquitin-protein liga yes no 0.155 0.051 0.531 4e-11
Q9M2S6273 E3 ubiquitin-protein liga no no 0.310 0.344 0.339 4e-11
Q4KLR8 784 E3 ubiquitin-protein liga N/A no 0.155 0.059 0.553 2e-10
Q9ULT6 936 E3 ubiquitin-protein liga yes no 0.148 0.048 0.511 6e-10
Q9WTV7600 E3 ubiquitin-protein liga no no 0.138 0.07 0.452 2e-09
Q7T037757 E3 ubiquitin-protein liga N/A no 0.138 0.055 0.452 2e-09
>sp|Q93Z92|RING4_ARATH E3 ubiquitin-protein ligase At4g11680 OS=Arabidopsis thaliana GN=At4g11680 PE=2 SV=1 Back     alignment and function desciption
 Score =  248 bits (633), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 132/285 (46%), Positives = 180/285 (63%), Gaps = 20/285 (7%)

Query: 29  FFSPIVFLDAIWNMAFVVVSVIVLFSTLKEKPATPLRVWVSGYALQCFLHVGFVFFEYRR 88
           +  P+VFLD +WN+AFV + V VL  +  EKP  PLRVWV GY +QC+LH+  V  EYRR
Sbjct: 105 YSKPVVFLDILWNLAFVAIGVAVLILSRDEKPNMPLRVWVVGYGIQCWLHMACVCVEYRR 164

Query: 89  KNYCGHRVALVVNGLSPSQTSLSV--------------VKRLGAMNTMISSIWWVIGFYW 134
           +    H      +GL+ S +   V               K L + NTM S IWW+IGFYW
Sbjct: 165 RRRRRHPEDGGGSGLTNSSSQQYVSLAQLEDRGETSNPAKHLESANTMFSFIWWIIGFYW 224

Query: 135 IVVGGQALVRDSPRLYWVTVVFLAFDVSFVIFCIGMVCIFFFAIFCCIP-IVALVYAVAT 193
           +  GGQ L  DSP+LYW+ ++FL FDV FV+FC+ + C+   A+ CC+P I+A++YAVA 
Sbjct: 225 VSAGGQTLSSDSPQLYWLCIIFLGFDVFFVVFCVALACVIGLAVCCCLPCIIAILYAVAD 284

Query: 194 RQGASADDIRNLPKYRYRLASHLRASNNSEKQDVFGTETEMSNSNSTDELALHPEDSDCC 253
           ++GAS +DI  +PK+R+    ++   +   +    G  TE   ++S  E +L PED++CC
Sbjct: 285 QEGASKNDIDQMPKFRFTKTGNVEKLSGKAR----GIMTE-CGTDSPIERSLSPEDAECC 339

Query: 254 ICLSQYVDGAELYTLPCNHHFHCGCISKWLRINATCPLCKYNIRR 298
           ICL +Y DG EL  LPCNHHFHC CI KWL IN+ CPLCK+NI +
Sbjct: 340 ICLCEYEDGVELRELPCNHHFHCTCIDKWLHINSRCPLCKFNILK 384




Mediates E2-dependent protein ubiquitination in vitro.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q8GUU2|RIE1_ARATH E3 ubiquitin protein ligase RIE1 OS=Arabidopsis thaliana GN=RIE1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LN71|RING1_ARATH E3 ubiquitin-protein ligase At1g12760 OS=Arabidopsis thaliana GN=At1g12760 PE=2 SV=1 Back     alignment and function description
>sp|Q8LDB8|RING2_ARATH E3 ubiquitin-protein ligase At1g63170 OS=Arabidopsis thaliana GN=At1g63170 PE=2 SV=2 Back     alignment and function description
>sp|Q5SSZ7|ZNRF3_MOUSE E3 ubiquitin-protein ligase ZNRF3 OS=Mus musculus GN=Znrf3 PE=2 SV=1 Back     alignment and function description
>sp|Q9M2S6|SDIR1_ARATH E3 ubiquitin-protein ligase SDIR1 OS=Arabidopsis thaliana GN=SDIR1 PE=1 SV=1 Back     alignment and function description
>sp|Q4KLR8|ZNRF3_XENLA E3 ubiquitin-protein ligase ZNRF3 OS=Xenopus laevis GN=znrf3 PE=2 SV=1 Back     alignment and function description
>sp|Q9ULT6|ZNRF3_HUMAN E3 ubiquitin-protein ligase ZNRF3 OS=Homo sapiens GN=ZNRF3 PE=1 SV=3 Back     alignment and function description
>sp|Q9WTV7|RNF12_MOUSE E3 ubiquitin-protein ligase RLIM OS=Mus musculus GN=Rlim PE=1 SV=2 Back     alignment and function description
>sp|Q7T037|RF12B_XENLA E3 ubiquitin-protein ligase RNF12-B OS=Xenopus laevis GN=rnf12-b PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query303
225440256331 PREDICTED: E3 ubiquitin-protein ligase A 0.861 0.788 0.629 8e-99
449437970336 PREDICTED: E3 ubiquitin protein ligase R 0.897 0.809 0.624 2e-98
449516611264 PREDICTED: LOW QUALITY PROTEIN: E3 ubiqu 0.867 0.996 0.639 2e-97
356570399327 PREDICTED: E3 ubiquitin protein ligase R 0.854 0.792 0.590 2e-91
297741734241 unnamed protein product [Vitis vinifera] 0.795 1.0 0.623 7e-91
356504625325 PREDICTED: E3 ubiquitin protein ligase R 0.854 0.796 0.571 5e-88
357509161297 E3 ubiquitin-protein ligase [Medicago tr 0.854 0.872 0.579 1e-85
148908123373 unknown [Picea sitchensis] 0.891 0.723 0.488 7e-81
148910158373 unknown [Picea sitchensis] 0.891 0.723 0.484 1e-80
449453127347 PREDICTED: E3 ubiquitin protein ligase R 0.927 0.809 0.541 2e-80
>gi|225440256|ref|XP_002283980.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  366 bits (939), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 173/275 (62%), Positives = 212/275 (77%), Gaps = 14/275 (5%)

Query: 29  FFSPIVFLDAIWNMAFVVVSVIVLFSTLKEKPATPLRVWVSGYALQCFLHVGFVFFEYRR 88
           F  PIV LD IWN+AFV VS++VL ST +E+P+ PLRVW+ GYALQC LHVGFV F++RR
Sbjct: 71  FSKPIVVLDVIWNLAFVSVSMVVLLSTFQERPSRPLRVWIFGYALQCLLHVGFVCFQFRR 130

Query: 89  KNYCGHRVALVVNGLSPSQTSLSVVKRLGAMNTMISSIWWVIGFYWIVVGGQALVRDSPR 148
           +N    R +             S+VKRL +MNTM SS+WWV GF WI+ GGQ L++DSPR
Sbjct: 131 RNGNEDRHS-------------SIVKRLESMNTMFSSVWWVFGFCWILAGGQVLMQDSPR 177

Query: 149 LYWVTVVFLAFDVSFVIFCIGMVCIFFFAIFCCIPIVALVYAVATRQGASADDIRNLPKY 208
           LYW+ VVFLAFDV F++FCIGM CIFFFA+FCCIP+ A+ YA+  R+GAS DDIR LP+Y
Sbjct: 178 LYWLAVVFLAFDVFFMMFCIGMACIFFFALFCCIPLAAIAYAMKIREGASEDDIRLLPRY 237

Query: 209 RYRLASHLRASNNSEKQDVFGTETEMSNSNSTDELALHPEDSDCCICLSQYVDGAELYTL 268
           R+  AS +R  ++ +KQ       E+ +S+S  +LALHPEDS+CCICLS+YVDGAELY L
Sbjct: 238 RFCDASLVRKVDDDKKQ-ALEAAVELGSSSSISDLALHPEDSECCICLSRYVDGAELYIL 296

Query: 269 PCNHHFHCGCISKWLRINATCPLCKYNIRRGDTLV 303
           PCNHHFHCGCIS+WLRINATCPLCK+NI RGD LV
Sbjct: 297 PCNHHFHCGCISRWLRINATCPLCKFNILRGDMLV 331




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449437970|ref|XP_004136763.1| PREDICTED: E3 ubiquitin protein ligase RIE1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449516611|ref|XP_004165340.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin protein ligase RIE1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356570399|ref|XP_003553376.1| PREDICTED: E3 ubiquitin protein ligase RIE1-like [Glycine max] Back     alignment and taxonomy information
>gi|297741734|emb|CBI32866.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356504625|ref|XP_003521096.1| PREDICTED: E3 ubiquitin protein ligase RIE1-like [Glycine max] Back     alignment and taxonomy information
>gi|357509161|ref|XP_003624869.1| E3 ubiquitin-protein ligase [Medicago truncatula] gi|355499884|gb|AES81087.1| E3 ubiquitin-protein ligase [Medicago truncatula] Back     alignment and taxonomy information
>gi|148908123|gb|ABR17177.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|148910158|gb|ABR18161.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|449453127|ref|XP_004144310.1| PREDICTED: E3 ubiquitin protein ligase RIE1-like [Cucumis sativus] gi|449488257|ref|XP_004157983.1| PREDICTED: E3 ubiquitin protein ligase RIE1-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query303
TAIR|locus:2195077408 AT1G12760 [Arabidopsis thalian 0.636 0.473 0.489 8.7e-67
TAIR|locus:2015248381 AT1G63170 [Arabidopsis thalian 0.610 0.485 0.505 2.3e-64
TAIR|locus:2200301343 AT1G68070 [Arabidopsis thalian 0.874 0.772 0.454 4.7e-64
TAIR|locus:2139717390 AT4G11680 [Arabidopsis thalian 0.867 0.674 0.452 2e-63
TAIR|locus:2098916379 AT3G61180 [Arabidopsis thalian 0.660 0.527 0.399 7.8e-58
TAIR|locus:1005452975359 RIE1 "RING-finger protein for 0.891 0.752 0.411 1.2e-56
TAIR|locus:2034210407 AT1G80400 [Arabidopsis thalian 0.518 0.385 0.35 6.5e-29
TAIR|locus:2125652453 AT4G32600 [Arabidopsis thalian 0.534 0.357 0.314 1.9e-28
TAIR|locus:2161740343 AT5G55970 [Arabidopsis thalian 0.848 0.749 0.252 3.9e-21
TAIR|locus:2133877335 AT4G26580 [Arabidopsis thalian 0.194 0.176 0.423 1.4e-20
TAIR|locus:2195077 AT1G12760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 515 (186.3 bits), Expect = 8.7e-67, Sum P(2) = 8.7e-67
 Identities = 96/196 (48%), Positives = 123/196 (62%)

Query:   109 SLSVVKRLGAMNTMISSIWWVIGFYWIVVGGQALVRDSPRLYWVTVVFLAFDVSFVIFCI 168
             S SV K L + NTM S IWW+IGFYW+  GGQ L ++SPR+YW+++VFL FDV FV+FC+
Sbjct:   209 SSSVAKHLESANTMFSFIWWIIGFYWVSAGGQELAQESPRIYWLSIVFLGFDVFFVVFCV 268

Query:   169 GMVXXXXXXXXXXXX-XVALVYAVATRQGASADDIRNLPKYRYRLASHLRASNNSEKQDV 227
              +               +A++YAVA ++GAS +DI  L K+++R         N E Q  
Sbjct:   269 ALACVIGIAVCCCLPCIIAVLYAVADQEGASKEDIEQLTKFKFRKLGDANKHTNDEAQGT 328

Query:   228 F-GTETEMSNSNSTDELALHPEDSDCCICLSQYVDGAELYTLPCNHHFHCGCISKWLRIN 286
               G  TE   ++S  E  L  ED++CCICLS Y DG EL  LPC HHFHC C+ KWL IN
Sbjct:   329 TEGIMTECG-TDSPIEHTLLQEDAECCICLSAYEDGTELRELPCGHHFHCSCVDKWLYIN 387

Query:   287 ATCPLCKYNIRRGDTL 302
             ATCPLCKYNI +   L
Sbjct:   388 ATCPLCKYNILKSSNL 403


GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0004842 "ubiquitin-protein ligase activity" evidence=IDA
TAIR|locus:2015248 AT1G63170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200301 AT1G68070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139717 AT4G11680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098916 AT3G61180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1005452975 RIE1 "RING-finger protein for embryogenesis" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034210 AT1G80400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2125652 AT4G32600 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161740 AT5G55970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133877 AT4G26580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00023357001
SubName- Full=Chromosome chr8 scaffold_29, whole genome shotgun sequence; (418 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query303
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 6e-15
cd0016245 cd00162, RING, RING-finger (Really Interesting New 4e-09
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 6e-09
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 2e-08
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 8e-08
smart0018440 smart00184, RING, Ring finger 5e-07
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 4e-06
COG5243 491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 1e-04
COG519488 COG5194, APC11, Component of SCF ubiquitin ligase 9e-04
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 9e-04
COG52191525 COG5219, COG5219, Uncharacterized conserved protei 0.001
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
 Score = 67.4 bits (165), Expect = 6e-15
 Identities = 22/43 (51%), Positives = 29/43 (67%)

Query: 251 DCCICLSQYVDGAELYTLPCNHHFHCGCISKWLRINATCPLCK 293
           +C ICL ++  G E+  LPC H FH  C+ KWLR + TCPLC+
Sbjct: 2   ECPICLDEFEPGEEVVVLPCGHVFHKECLDKWLRSSNTCPLCR 44


Length = 46

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information
>gnl|CDD|227544 COG5219, COG5219, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 303
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.76
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.59
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 99.39
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.38
PHA02929238 N1R/p28-like protein; Provisional 99.35
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.34
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 99.23
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 99.14
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 99.09
cd0016245 RING RING-finger (Really Interesting New Gene) dom 99.05
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 99.04
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.04
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 98.96
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.95
PF1463444 zf-RING_5: zinc-RING finger domain 98.87
PHA02926242 zinc finger-like protein; Provisional 98.83
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.81
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.76
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.75
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.73
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.67
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 98.65
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 98.65
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.57
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 98.56
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.54
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.49
KOG149384 consensus Anaphase-promoting complex (APC), subuni 98.46
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 98.23
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.17
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 98.15
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.15
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.15
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.07
COG52191525 Uncharacterized conserved protein, contains RING Z 98.05
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 98.03
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 98.03
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 97.86
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.82
KOG4445 368 consensus Uncharacterized conserved protein, conta 97.75
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.74
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 97.66
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.54
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.3
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 97.26
KOG1941518 consensus Acetylcholine receptor-associated protei 97.24
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 97.23
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.2
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.19
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 96.94
PHA02862156 5L protein; Provisional 96.9
KOG0297 391 consensus TNF receptor-associated factor [Signal t 96.82
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 96.81
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 96.69
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.62
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 96.61
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 96.59
PHA02825162 LAP/PHD finger-like protein; Provisional 96.58
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 95.85
COG5152259 Uncharacterized conserved protein, contains RING a 95.79
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 95.79
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 95.79
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 95.76
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 95.76
KOG3039303 consensus Uncharacterized conserved protein [Funct 95.66
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 95.63
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 95.29
PHA03096284 p28-like protein; Provisional 95.12
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 95.02
KOG1002 791 consensus Nucleotide excision repair protein RAD16 94.97
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 94.94
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 94.93
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 94.79
KOG2660 331 consensus Locus-specific chromosome binding protei 94.76
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 93.86
COG5222427 Uncharacterized conserved protein, contains RING Z 93.59
COG5236 493 Uncharacterized conserved protein, contains RING Z 93.19
KOG1940276 consensus Zn-finger protein [General function pred 93.14
PF04641260 Rtf2: Rtf2 RING-finger 93.03
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 93.01
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 92.8
KOG1609 323 consensus Protein involved in mRNA turnover and st 92.66
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 92.46
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 92.07
KOG3053 293 consensus Uncharacterized conserved protein [Funct 91.2
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 90.63
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 90.56
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 90.24
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 89.95
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 89.87
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 89.72
PF10272358 Tmpp129: Putative transmembrane protein precursor; 89.04
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 88.56
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 88.45
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 88.35
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 85.9
COG5175 480 MOT2 Transcriptional repressor [Transcription] 85.59
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 84.79
KOG0825 1134 consensus PHD Zn-finger protein [General function 83.9
KOG0298 1394 consensus DEAD box-containing helicase-like transc 82.82
KOG03091081 consensus Conserved WD40 repeat-containing protein 82.7
KOG3002 299 consensus Zn finger protein [General function pred 82.66
KOG3899381 consensus Uncharacterized conserved protein [Funct 82.07
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 81.25
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.76  E-value=1.5e-18  Score=160.42  Aligned_cols=78  Identities=35%  Similarity=0.831  Sum_probs=64.9

Q ss_pred             ccCCCCHHHHhcCCcceeccccccccCCCCccccccCCcccccCCCCcccccCCCCCCcceeecccccCCCceEEeCCCC
Q 022069          193 TRQGASADDIRNLPKYRYRLASHLRASNNSEKQDVFGTETEMSNSNSTDELALHPEDSDCCICLSQYVDGAELYTLPCNH  272 (303)
Q Consensus       193 ~~~g~s~~~i~~Lp~~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~~~ed~~C~ICL~~y~~~~~lr~LpC~H  272 (303)
                      +.+++.++.++++|...|+     ...+++                         ....|+|||++|++||.+|.|||+|
T Consensus       203 ~~~r~~k~~l~~~p~~~f~-----~~~~~~-------------------------~~~~CaIClEdY~~GdklRiLPC~H  252 (348)
T KOG4628|consen  203 RRNRLIKRLLKKLPVRTFT-----KGDDED-------------------------ATDTCAICLEDYEKGDKLRILPCSH  252 (348)
T ss_pred             hhhhhHHHHHhhCCcEEec-----cccccC-------------------------CCceEEEeecccccCCeeeEecCCC
Confidence            5678899999999999999     111110                         1147999999999999999999999


Q ss_pred             ccChhhHHHHHhcCCC-CcccccCccCCC
Q 022069          273 HFHCGCISKWLRINAT-CPLCKYNIRRGD  300 (303)
Q Consensus       273 ~FH~~CI~~WL~~~~t-CPlCR~~I~~~~  300 (303)
                      .||..|||+||..+.+ ||+||+++.++.
T Consensus       253 ~FH~~CIDpWL~~~r~~CPvCK~di~~~~  281 (348)
T KOG4628|consen  253 KFHVNCIDPWLTQTRTFCPVCKRDIRTDS  281 (348)
T ss_pred             chhhccchhhHhhcCccCCCCCCcCCCCC
Confidence            9999999999988755 999999987654



>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG3899 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query303
2l0b_A91 Solution Nmr Structure Of Zinc Finger Domain Of E3 5e-08
1x4j_A75 Solution Structure Of Ring Finger In Ring Finger Pr 5e-07
2kiz_A69 Solution Structure Of Arkadia Ring-H2 Finger Domain 6e-07
2ep4_A74 Solution Structure Of Ring Finger From Human Ring F 1e-06
2ect_A78 Solution Structure Of The Zinc Finger, C3hc4 Type ( 1e-06
1iym_A55 Ring-H2 Finger Domain Of El5 Length = 55 8e-06
2ecn_A70 Solution Structure Of The Ring Domain Of The Human 8e-05
>pdb|2L0B|A Chain A, Solution Nmr Structure Of Zinc Finger Domain Of E3 Ubiquitin-Protein Ligase Praja-1 From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr4710b Length = 91 Back     alignment and structure

Iteration: 1

Score = 55.1 bits (131), Expect = 5e-08, Method: Composition-based stats. Identities = 21/42 (50%), Positives = 29/42 (69%) Query: 252 CCICLSQYVDGAELYTLPCNHHFHCGCISKWLRINATCPLCK 293 C IC S+YV G LPC+H+FH C+S WL+ + TCP+C+ Sbjct: 43 CPICCSEYVKGDVATELPCHHYFHKPCVSIWLQKSGTCPVCR 84
>pdb|1X4J|A Chain A, Solution Structure Of Ring Finger In Ring Finger Protein 38 Length = 75 Back     alignment and structure
>pdb|2KIZ|A Chain A, Solution Structure Of Arkadia Ring-H2 Finger Domain Length = 69 Back     alignment and structure
>pdb|2EP4|A Chain A, Solution Structure Of Ring Finger From Human Ring Finger Protein 24 Length = 74 Back     alignment and structure
>pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 Back     alignment and structure
>pdb|1IYM|A Chain A, Ring-H2 Finger Domain Of El5 Length = 55 Back     alignment and structure
>pdb|2ECN|A Chain A, Solution Structure Of The Ring Domain Of The Human Ring Finger Protein 141 Length = 70 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query303
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 2e-25
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 4e-24
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 8e-24
2ect_A78 Ring finger protein 126; metal binding protein, st 4e-21
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 5e-20
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 6e-20
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 4e-19
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 2e-15
2ecm_A55 Ring finger and CHY zinc finger domain- containing 1e-13
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 2e-13
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 3e-11
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 3e-11
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 3e-11
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 7e-11
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 9e-11
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 2e-10
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 7e-10
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 6e-09
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 7e-09
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 9e-09
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 1e-08
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 2e-08
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 2e-08
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 8e-08
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 8e-08
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 2e-07
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 2e-07
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 3e-07
1z6u_A150 NP95-like ring finger protein isoform B; structura 8e-07
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 2e-06
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 3e-06
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 3e-05
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 3e-05
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 7e-05
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 8e-05
2ysl_A73 Tripartite motif-containing protein 31; ring-type 9e-05
3nw0_A238 Non-structural maintenance of chromosomes element 1e-04
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 1e-04
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 1e-04
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 2e-04
2ecw_A85 Tripartite motif-containing protein 30; metal bind 3e-04
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 5e-04
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 5e-04
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 6e-04
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 6e-04
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
 Score = 95.5 bits (238), Expect = 2e-25
 Identities = 26/101 (25%), Positives = 38/101 (37%), Gaps = 30/101 (29%)

Query: 197 ASADDIRNLPKYRYRLASHLRASNNSEKQDVFGTETEMSNSNSTDELALHPEDSDCCICL 256
            S+     LP YR+   +H                                E + C +C+
Sbjct: 1   GSSGSSGQLPSYRFNPNNH------------------------------QSEQTLCVVCM 30

Query: 257 SQYVDGAELYTLPCNHHFHCGCISKWLRINATCPLCKYNIR 297
             +     L  LPCNH FH  C+ KWL+ N TCP+C+ +  
Sbjct: 31  CDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADSG 71


>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Length = 60 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query303
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.73
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.7
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.61
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.61
2ect_A78 Ring finger protein 126; metal binding protein, st 99.6
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.6
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.54
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.52
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.49
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.49
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.47
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.47
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.47
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.47
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.45
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.43
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.43
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.41
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.4
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.38
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.37
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.36
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.36
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.34
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.28
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.26
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.26
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 99.25
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.25
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.24
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.24
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.24
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.23
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.22
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.22
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.2
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.19
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.18
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.14
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.13
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.09
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.06
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.05
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.03
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.03
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.02
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.0
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.97
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.96
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.95
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.95
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.95
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.94
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.89
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.88
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.88
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.85
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.84
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.83
2ea5_A68 Cell growth regulator with ring finger domain prot 98.78
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.73
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.68
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.67
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.66
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.56
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.49
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.49
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.38
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.33
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.23
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.85
3nw0_A238 Non-structural maintenance of chromosomes element 97.77
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 95.01
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 94.92
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 94.24
1wil_A89 KIAA1045 protein; ring finger domain, structural g 92.05
1we9_A64 PHD finger family protein; structural genomics, PH 91.57
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 89.83
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 89.55
2k16_A75 Transcription initiation factor TFIID subunit 3; p 89.09
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 88.24
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 87.64
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 87.35
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 86.72
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 86.53
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 86.51
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 85.91
1wem_A76 Death associated transcription factor 1; structura 85.06
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 83.68
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 83.53
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 83.35
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 82.96
1wee_A72 PHD finger family protein; structural genomics, PH 82.03
1weu_A91 Inhibitor of growth family, member 4; structural g 81.47
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 80.69
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 80.23
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
Probab=99.73  E-value=2.8e-18  Score=130.38  Aligned_cols=78  Identities=33%  Similarity=0.660  Sum_probs=66.1

Q ss_pred             hccCCCCHHHHhcCCcceeccccccccCCCCccccccCCcccccCCCCcccccCCCCCCcceeecccccCCCceEEeCCC
Q 022069          192 ATRQGASADDIRNLPKYRYRLASHLRASNNSEKQDVFGTETEMSNSNSTDELALHPEDSDCCICLSQYVDGAELYTLPCN  271 (303)
Q Consensus       192 ~~~~g~s~~~i~~Lp~~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~~~ed~~C~ICL~~y~~~~~lr~LpC~  271 (303)
                      ...+|++++.+++||...+....                             ....++.+|+||+++|.+++.++.+||+
T Consensus        12 ~~~~~~s~~~i~~lp~~~~~~~~-----------------------------~~~~~~~~C~IC~~~~~~~~~~~~l~C~   62 (91)
T 2l0b_A           12 VANPPASKESIDALPEILVTEDH-----------------------------GAVGQEMCCPICCSEYVKGDVATELPCH   62 (91)
T ss_dssp             SCCCCCCHHHHHTSCEEECCTTC-----------------------------SSSSSCSEETTTTEECCTTCEEEEETTT
T ss_pred             cCCCCCCHHHHHhCCCeeecccc-----------------------------cccCCCCCCcccChhhcCCCcEEecCCC
Confidence            45689999999999988876110                             0123567899999999999999999999


Q ss_pred             CccChhhHHHHHhcCCCCcccccCccC
Q 022069          272 HHFHCGCISKWLRINATCPLCKYNIRR  298 (303)
Q Consensus       272 H~FH~~CI~~WL~~~~tCPlCR~~I~~  298 (303)
                      |.||..||++|++.+.+||+||+++..
T Consensus        63 H~Fh~~Ci~~wl~~~~~CP~Cr~~~~~   89 (91)
T 2l0b_A           63 HYFHKPCVSIWLQKSGTCPVCRCMFPP   89 (91)
T ss_dssp             EEEEHHHHHHHHTTTCBCTTTCCBSSC
T ss_pred             ChHHHHHHHHHHHcCCcCcCcCccCCC
Confidence            999999999999999999999998864



>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 303
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 4e-16
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 2e-12
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 1e-11
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 1e-10
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 9e-09
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 2e-08
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 2e-07
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 3e-07
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 8e-07
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 1e-06
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 2e-06
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 4e-06
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 2e-05
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 6e-04
d1wewa_78 g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale c 0.004
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
 Score = 69.1 bits (169), Expect = 4e-16
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 248 EDSDCCICLSQYVDGAELYTLP-CNHHFHCGCISKWLRINATCPLCKYNI 296
           +  +C +CL++  DG E   LP C H FH  C+  WL  ++TCPLC+  +
Sbjct: 4   DGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTV 53


>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query303
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.75
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.54
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.52
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.5
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.48
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.46
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.46
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.29
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.23
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.18
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.18
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.17
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.01
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.97
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.96
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.82
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.46
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 94.08
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 93.69
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 90.79
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 90.26
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 89.67
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 89.55
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 89.29
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 84.42
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 84.32
d1wema_76 Death associated transcription factor 1, Datf1 (DI 83.77
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 83.01
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
Probab=99.75  E-value=2.7e-19  Score=121.58  Aligned_cols=51  Identities=39%  Similarity=1.036  Sum_probs=46.9

Q ss_pred             CCCCcceeecccccCCCceEEeC-CCCccChhhHHHHHhcCCCCcccccCcc
Q 022069          247 PEDSDCCICLSQYVDGAELYTLP-CNHHFHCGCISKWLRINATCPLCKYNIR  297 (303)
Q Consensus       247 ~ed~~C~ICL~~y~~~~~lr~Lp-C~H~FH~~CI~~WL~~~~tCPlCR~~I~  297 (303)
                      +++.+|+||+++|++++.++.+| |+|.||.+||++|++++.+||+||++|.
T Consensus         3 ed~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i~   54 (55)
T d1iyma_           3 DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV   54 (55)
T ss_dssp             CCSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCSC
T ss_pred             CCCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEeE
Confidence            35678999999999999999886 9999999999999999999999999874



>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure