Citrus Sinensis ID: 022113


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300--
MLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPRDYITGLRLYLDSLRKKSSLKLATGANIVGNVLVHESAQIGEGCLIGPDVAVGPGCVVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILKPEIVM
cHHHHHHHHHHcccEEEEEEcccccccHHHHHHHHHHccccccccEEEEEccEEccccHHHHHHHHHHccccEEEEEEEEccccccEEEEEEccccEEEEEEEccccccccEEEEEEEEEcHHHHHHccccccccccccHHHHHHcccEEEEEcccEEcccccHHHHHHHHHHHHHHHccccccccccccEEEccEEEccccEEccccEEccccEEccccEEccccEEcccEEccccEEccccEEEccEEEcccEEccccEEEccEEEccccEEcccEEEcccEEccccEEccccccccccc
cHHHHHHHHHHcccEEEEEEcccccccHHHHHHHHHHHcccccccEEEEEccEEccccHHHHHHHHHHcccEEEEEEEEcccccccEEEEEccccccEEEEEEccccccccEEccEEEEEcHHHHHHcccccccHHHHHHHHHHHcccEEEEEEccEEEccccHHHHHHHHHHHHHHHHcccccccccccEEEccEEEccccEEccccEEcccEEEcccEEEcccEEEEEEEEEccEEEcccEEEEEEEEEcccEEccEEEEEEEEEEcccEEEccEEEEcccEEccccEEccccccccEcc
MLNFLKEFEAKLGIKIIcsqeteplgtagplALARdkliddtgepffvlnsdviseypfaEMIEFHkahggeasimvtkvdepskyGVVVMEESTgkvekfvekpklfvgnkinagiyllnpavldrielrptsiekevfpkiaLEGKLFAMVLpgfwmdigqprdyITGLRLYLDSLRKKSSLKLATGANIVGNVLVHesaqigegcligpdvavgpgcvvesgvrlsrcTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDeiysnggvvlphkeikssilkpeivm
MLNFLKEFEAKLGIKiicsqeteplgTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPRDYITGLRLYLDSLRKKSSLKLATGANIVGNVLVHESAQIGEGCLIGPDVAVGPGCVVESGVRLSRCTVMRGVRIKKhacisssiigwhstVGQWARVENMTILGEDVHVCDEIYsnggvvlphkeikssilkpeivm
MLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPRDYITGlrlyldslrkksslklATGANIVGNVLVHESAQIGEGCLIGPDVAVGPGCVVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILKPEIVM
***FLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPRDYITGLRLYLDSLRKKSSLKLATGANIVGNVLVHESAQIGEGCLIGPDVAVGPGCVVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEI***********
MLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPRDYITGLRLYLDSLRKKSSLKLATGANIVGNVLVHESAQIGEGCLIGPDVAVGPGCVVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILKPEIVM
MLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPRDYITGLRLYLDSLRKKSSLKLATGANIVGNVLVHESAQIGEGCLIGPDVAVGPGCVVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILKPEIVM
MLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPRDYITGLRLYLDSLRKKSSLKLATGANIVGNVLVHESAQIGEGCLIGPDVAVGPGCVVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILKPEIV*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPRDYITGLRLYLDSLRKKSSLKLATGANIVGNVLVHESAQIGEGCLIGPDVAVGPGCVVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILKPEIVM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query302 2.2.26 [Sep-21-2011]
Q6Z9A3361 Probable mannose-1-phosph yes no 1.0 0.836 0.880 1e-159
Q84JH5361 Probable mannose-1-phosph no no 1.0 0.836 0.877 1e-158
Q941T9361 Probable mannose-1-phosph yes no 1.0 0.836 0.880 1e-158
O22287361 Mannose-1-phosphate guany yes no 1.0 0.836 0.884 1e-157
Q9M2S0364 Probable mannose-1-phosph no no 1.0 0.829 0.827 1e-147
Q8H1Q7331 Probable mannose-1-phosph no no 0.956 0.873 0.754 1e-126
Q54K39359 Mannose-1-phosphate guany yes no 0.993 0.835 0.599 1e-108
Q9Y5P6360 Mannose-1-phosphate guany yes no 0.983 0.825 0.617 1e-108
Q68EQ1360 Mannose-1-phosphate guany yes no 0.983 0.825 0.604 1e-108
Q68EY9360 Mannose-1-phosphate guany N/A no 0.983 0.825 0.604 1e-107
>sp|Q6Z9A3|GMPP3_ORYSJ Probable mannose-1-phosphate guanylyltransferase 3 OS=Oryza sativa subsp. japonica GN=Os08g0237200 PE=2 SV=1 Back     alignment and function desciption
 Score =  561 bits (1446), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 266/302 (88%), Positives = 291/302 (96%)

Query: 1   MLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFA 60
           MLNFLK+FE KLGI I CSQETEPLGTAGPLALARDKL+D +GEPFFVLNSDVISEYPFA
Sbjct: 60  MLNFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPFA 119

Query: 61  EMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGKVEKFVEKPKLFVGNKINAGIYLL 120
           E+I+FHK HGGEA+IMVTKVDEPSKYGVVVMEE+TG VEKFVEKPK+FVGNKINAGIYLL
Sbjct: 120 ELIKFHKNHGGEATIMVTKVDEPSKYGVVVMEEATGMVEKFVEKPKIFVGNKINAGIYLL 179

Query: 121 NPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPRDYITGLRLYLDSLRK 180
           NP+VLDRIEL+PTSIEKEVFP+I+ + KLFAMVLPGFWMD+GQPRDYITGLRLYLDSLRK
Sbjct: 180 NPSVLDRIELKPTSIEKEVFPRISADAKLFAMVLPGFWMDVGQPRDYITGLRLYLDSLRK 239

Query: 181 KSSLKLATGANIVGNVLVHESAQIGEGCLIGPDVAVGPGCVVESGVRLSRCTVMRGVRIK 240
           +S+ +LATGA+IVGNVLVHESA+IGEGCLIGPDVA+GPGCVVE GVRLSRCTVMRGVRIK
Sbjct: 240 RSANRLATGAHIVGNVLVHESAKIGEGCLIGPDVAIGPGCVVEDGVRLSRCTVMRGVRIK 299

Query: 241 KHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILKPEI 300
           KHACIS+SIIGWHSTVGQWAR+ENMTILGEDVHV DE+Y+NGGV+LPHKEIKSSILKPEI
Sbjct: 300 KHACISNSIIGWHSTVGQWARIENMTILGEDVHVGDEVYTNGGVILPHKEIKSSILKPEI 359

Query: 301 VM 302
           VM
Sbjct: 360 VM 361




Catalyzes a reaction of the Smirnoff-Wheeler pathway, the major route to ascorbate biosynthesis in plants.
Oryza sativa subsp. japonica (taxid: 39947)
EC: 2EC: .EC: 7EC: .EC: 7EC: .EC: 1EC: 3
>sp|Q84JH5|GMPP1_ORYSJ Probable mannose-1-phosphate guanylyltransferase 1 OS=Oryza sativa subsp. japonica GN=Os03g0268400 PE=2 SV=1 Back     alignment and function description
>sp|Q941T9|GMPP2_ORYSJ Probable mannose-1-phosphate guanylyltransferase 2 OS=Oryza sativa subsp. japonica GN=Os01g0847200 PE=2 SV=1 Back     alignment and function description
>sp|O22287|GMPP1_ARATH Mannose-1-phosphate guanylyltransferase 1 OS=Arabidopsis thaliana GN=CYT1 PE=1 SV=1 Back     alignment and function description
>sp|Q9M2S0|GMPP2_ARATH Probable mannose-1-phosphate guanylyltransferase 2 OS=Arabidopsis thaliana GN=At3g55590 PE=2 SV=1 Back     alignment and function description
>sp|Q8H1Q7|GMPP3_ARATH Probable mannose-1-phosphate guanylyltransferase 3 OS=Arabidopsis thaliana GN=At4g30570 PE=2 SV=1 Back     alignment and function description
>sp|Q54K39|GMPPB_DICDI Mannose-1-phosphate guanyltransferase beta OS=Dictyostelium discoideum GN=gmppB PE=2 SV=1 Back     alignment and function description
>sp|Q9Y5P6|GMPPB_HUMAN Mannose-1-phosphate guanyltransferase beta OS=Homo sapiens GN=GMPPB PE=1 SV=2 Back     alignment and function description
>sp|Q68EQ1|GMPPB_XENTR Mannose-1-phosphate guanyltransferase beta OS=Xenopus tropicalis GN=gmppb PE=2 SV=1 Back     alignment and function description
>sp|Q68EY9|GMPBA_XENLA Mannose-1-phosphate guanyltransferase beta-A OS=Xenopus laevis GN=gmppb-a PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query302
319739577361 putative GDP-mannose pyrophosphorylase [ 1.0 0.836 0.986 1e-172
225449380361 PREDICTED: mannose-1-phosphate guanylylt 1.0 0.836 0.937 1e-164
388518711353 unknown [Lotus japonicus] 1.0 0.855 0.927 1e-163
224038262361 GDP-D-mannose pyrophosphorylase [Actinid 1.0 0.836 0.927 1e-162
357492373361 Mannose-1-phosphate guanyltransferase [M 1.0 0.836 0.913 1e-162
240851533333 GDP-D-mannose pyrophosphorylase [Malus x 1.0 0.906 0.920 1e-162
113952525361 GDP-D-mannose pyrophosphorylase [Viola b 1.0 0.836 0.923 1e-162
218117841361 GDP-D-mannose pyrophosphorylase [Prunus 1.0 0.836 0.917 1e-161
255566484361 mannose-1-phosphate guanyltransferase, p 1.0 0.836 0.907 1e-161
80973464361 GDP-mannose pyrophosphorylase [Malpighia 1.0 0.836 0.900 1e-160
>gi|319739577|gb|ADV59923.1| putative GDP-mannose pyrophosphorylase [Citrus unshiu] Back     alignment and taxonomy information
 Score =  609 bits (1571), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 298/302 (98%), Positives = 299/302 (99%)

Query: 1   MLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFA 60
           MLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFA
Sbjct: 60  MLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFA 119

Query: 61  EMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGKVEKFVEKPKLFVGNKINAGIYLL 120
           EMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGKVEKFVEKPKLFVGNKINAGIYLL
Sbjct: 120 EMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGKVEKFVEKPKLFVGNKINAGIYLL 179

Query: 121 NPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPRDYITGLRLYLDSLRK 180
           NPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPRDYITGLRLYLDSLRK
Sbjct: 180 NPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPRDYITGLRLYLDSLRK 239

Query: 181 KSSLKLATGANIVGNVLVHESAQIGEGCLIGPDVAVGPGCVVESGVRLSRCTVMRGVRIK 240
           KSS KLATGANIVGNVLVHESAQIGE CLIGPDVA+GPGCVVESGVRLSRCTVMRGVRIK
Sbjct: 240 KSSFKLATGANIVGNVLVHESAQIGEECLIGPDVAIGPGCVVESGVRLSRCTVMRGVRIK 299

Query: 241 KHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILKPEI 300
           KHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGV LPHKEIKSSILKPEI
Sbjct: 300 KHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVALPHKEIKSSILKPEI 359

Query: 301 VM 302
           VM
Sbjct: 360 VM 361




Source: Citrus unshiu

Species: Citrus unshiu

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225449380|ref|XP_002282422.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|388518711|gb|AFK47417.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|224038262|gb|ACN38266.1| GDP-D-mannose pyrophosphorylase [Actinidia latifolia] Back     alignment and taxonomy information
>gi|357492373|ref|XP_003616475.1| Mannose-1-phosphate guanyltransferase [Medicago truncatula] gi|49246467|gb|AAT58365.1| GMPase [Medicago sativa] gi|355517810|gb|AES99433.1| Mannose-1-phosphate guanyltransferase [Medicago truncatula] Back     alignment and taxonomy information
>gi|240851533|gb|ACN88684.2| GDP-D-mannose pyrophosphorylase [Malus x domestica] Back     alignment and taxonomy information
>gi|113952525|gb|ABI48955.1| GDP-D-mannose pyrophosphorylase [Viola baoshanensis] Back     alignment and taxonomy information
>gi|218117841|dbj|BAH03298.1| GDP-D-mannose pyrophosphorylase [Prunus persica] Back     alignment and taxonomy information
>gi|255566484|ref|XP_002524227.1| mannose-1-phosphate guanyltransferase, putative [Ricinus communis] gi|223536504|gb|EEF38151.1| mannose-1-phosphate guanyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|80973464|gb|ABB53473.1| GDP-mannose pyrophosphorylase [Malpighia glabra] gi|161898831|gb|ABX80393.1| GDP-mannose pyrophosphorylase [Malpighia glabra] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query302
TAIR|locus:2005504361 CYT1 "CYTOKINESIS DEFECTIVE 1" 1.0 0.836 0.837 9.8e-135
TAIR|locus:2100001364 AT3G55590 [Arabidopsis thalian 1.0 0.829 0.781 6.1e-126
TAIR|locus:2118671331 AT4G30570 [Arabidopsis thalian 0.943 0.861 0.738 1.4e-110
DICTYBASE|DDB_G0287619359 gmppB "mannose-1-phosphate gua 0.993 0.835 0.576 9.7e-96
UNIPROTKB|Q9Y5P6360 GMPPB "Mannose-1-phosphate gua 0.983 0.825 0.593 3.8e-94
UNIPROTKB|F1SPR4360 GMPPB "Mannose-1-phosphate gua 0.983 0.825 0.590 7.8e-94
UNIPROTKB|F1N7H5360 GMPPB "Mannose-1-phosphate gua 0.983 0.825 0.593 1e-93
UNIPROTKB|E2R2I6360 GMPPB "Uncharacterized protein 0.983 0.825 0.587 1.6e-93
MGI|MGI:2660880360 Gmppb "GDP-mannose pyrophospho 0.983 0.825 0.587 1.6e-93
RGD|1560458360 Gmppb "GDP-mannose pyrophospho 0.983 0.825 0.583 2.1e-93
TAIR|locus:2005504 CYT1 "CYTOKINESIS DEFECTIVE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1320 (469.7 bits), Expect = 9.8e-135, P = 9.8e-135
 Identities = 253/302 (83%), Positives = 270/302 (89%)

Query:     1 MLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFA 60
             MLNFLK+FE KL IKI CSQETEPLGTAGPLALARDKL+D +GEPFFVLNSDVISEYP  
Sbjct:    60 MLNFLKDFETKLEIKITCSQETEPLGTAGPLALARDKLLDGSGEPFFVLNSDVISEYPLK 119

Query:    61 EMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGKVEKFVEKPKLFVGNKINAGIYLL 120
             EM+EFHK+HGGEASIMVTKVDEPSKYGVVVMEESTG+VEKFVEKPKL+VGNKINAGIYLL
Sbjct:   120 EMLEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGRVEKFVEKPKLYVGNKINAGIYLL 179

Query:   121 NPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPRDYITGXXXXXXXXXX 180
             NP+VLD+IELRPTSIEKE FPKIA    L+AMVLPGFWMDIGQPRDYITG          
Sbjct:   180 NPSVLDKIELRPTSIEKETFPKIAAAQGLYAMVLPGFWMDIGQPRDYITGLRLYLDSLRK 239

Query:   181 XXXXXXATGANIVGNVLVHESAQIGEGCLIGPDVAVGPGCVVESGVRLSRCTVMRGVRIK 240
                    +G +IVGNVLV E+A IGEGCLIGPDVA+GPGC+VESGVRLSRCTVMRGVRIK
Sbjct:   240 KSPAKLTSGPHIVGNVLVDETATIGEGCLIGPDVAIGPGCIVESGVRLSRCTVMRGVRIK 299

Query:   241 KHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILKPEI 300
             KHACISSSIIGWHSTVGQWAR+ENMTILGEDVHV DEIYSNGGVVLPHKEIKS+ILKPEI
Sbjct:   300 KHACISSSIIGWHSTVGQWARIENMTILGEDVHVSDEIYSNGGVVLPHKEIKSNILKPEI 359

Query:   301 VM 302
             VM
Sbjct:   360 VM 361




GO:0005737 "cytoplasm" evidence=ISM
GO:0009058 "biosynthetic process" evidence=IEA;ISS
GO:0016779 "nucleotidyltransferase activity" evidence=ISS
GO:0004475 "mannose-1-phosphate guanylyltransferase activity" evidence=ISS;IMP
GO:0019853 "L-ascorbic acid biosynthetic process" evidence=IMP
GO:0030244 "cellulose biosynthetic process" evidence=RCA;IMP
GO:0009408 "response to heat" evidence=IMP
GO:0042742 "defense response to bacterium" evidence=IMP
GO:0009753 "response to jasmonic acid stimulus" evidence=IEP
GO:0010193 "response to ozone" evidence=IEP;RCA
GO:0009651 "response to salt stress" evidence=IMP
GO:0060359 "response to ammonium ion" evidence=IMP
GO:0005829 "cytosol" evidence=IDA
GO:0006007 "glucose catabolic process" evidence=RCA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0007010 "cytoskeleton organization" evidence=RCA
GO:0010498 "proteasomal protein catabolic process" evidence=RCA
GO:0005515 "protein binding" evidence=IPI
GO:0005634 "nucleus" evidence=IDA
TAIR|locus:2100001 AT3G55590 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118671 AT4G30570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0287619 gmppB "mannose-1-phosphate guanylyltransferase beta" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y5P6 GMPPB "Mannose-1-phosphate guanyltransferase beta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SPR4 GMPPB "Mannose-1-phosphate guanyltransferase beta" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1N7H5 GMPPB "Mannose-1-phosphate guanyltransferase beta" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R2I6 GMPPB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:2660880 Gmppb "GDP-mannose pyrophosphorylase B" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1560458 Gmppb "GDP-mannose pyrophosphorylase B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A3QMC8GMPPB_CAEEL2, ., 7, ., 7, ., 1, 30.53350.96020.7945yesno
Q8H1Q7GMPP3_ARATH2, ., 7, ., 7, ., 1, 30.75430.95690.8731nono
O74484MPG1_SCHPO2, ., 7, ., 7, ., 1, 30.57700.99660.8292yesno
Q4I1Y5MPG1_GIBZE2, ., 7, ., 7, ., 1, 30.55220.99660.8269yesno
Q2YDJ9GMPPB_BOVIN2, ., 7, ., 7, ., 1, 30.61400.98340.825yesno
Q941T9GMPP2_ORYSJ2, ., 7, ., 7, ., 1, 30.88071.00.8365yesno
O74624MPG1_HYPJE2, ., 7, ., 7, ., 1, 30.55880.99660.8269N/Ano
O93827MPG1_CANAL2, ., 7, ., 7, ., 1, 30.51970.99660.8314N/Ano
Q7RVR8MPG1_NEUCR2, ., 7, ., 7, ., 1, 30.57650.99330.8241N/Ano
Q9P8N0MPG1_PICAN2, ., 7, ., 7, ., 1, 30.55550.99660.8269N/Ano
Q9M2S0GMPP2_ARATH2, ., 7, ., 7, ., 1, 30.82781.00.8296nono
Q68EQ1GMPPB_XENTR2, ., 7, ., 7, ., 1, 30.60400.98340.825yesno
Q5B1J4MPG1_EMENI2, ., 7, ., 7, ., 1, 30.56200.99660.8269yesno
Q6BN12MPG1_DEBHA2, ., 7, ., 7, ., 1, 30.50650.99660.8314yesno
Q8BTZ7GMPPB_MOUSE2, ., 7, ., 7, ., 1, 30.61070.98340.825yesno
Q54K39GMPPB_DICDI2, ., 7, ., 7, ., 1, 30.59930.99330.8356yesno
Q7JZB4GMPPB_DROME2, ., 7, ., 7, ., 1, 30.58380.98010.8021yesno
Q9Y5P6GMPPB_HUMAN2, ., 7, ., 7, ., 1, 30.61740.98340.825yesno
P0C5I2GMPPB_PIG2, ., 7, ., 7, ., 1, 30.61400.98340.825yesno
Q6DBU5GMPPB_DANRE2, ., 7, ., 7, ., 1, 30.58050.98340.825yesno
Q70SJ2MPG1_KLULA2, ., 7, ., 7, ., 1, 30.55110.99660.8337yesno
Q6Z9A3GMPP3_ORYSJ2, ., 7, ., 7, ., 1, 30.88071.00.8365yesno
Q9Y725MPG11_CANGA2, ., 7, ., 7, ., 1, 30.52800.99660.8337yesno
Q6CCU3MPG1_YARLI2, ., 7, ., 7, ., 1, 30.56200.99330.8264yesno
P0CO20MPG1_CRYNJ2, ., 7, ., 7, ., 1, 30.54900.99660.8269yesno
P0CO21MPG1_CRYNB2, ., 7, ., 7, ., 1, 30.54900.99660.8269N/Ano
Q2UJU5MPG1_ASPOR2, ., 7, ., 7, ., 1, 30.55220.99660.8269yesno
Q4U3E8MPG1_ASPFU2, ., 7, ., 7, ., 1, 30.55550.99660.8269yesno
P41940MPG1_YEAST2, ., 7, ., 7, ., 1, 30.56760.99660.8337yesno
O22287GMPP1_ARATH2, ., 7, ., 7, ., 1, 30.88411.00.8365yesno
Q84JH5GMPP1_ORYSJ2, ., 7, ., 7, ., 1, 30.87741.00.8365nono
Q295Y7GMPPB_DROPS2, ., 7, ., 7, ., 1, 30.58050.98010.7978yesno
Q68EY9GMPBA_XENLA2, ., 7, ., 7, ., 1, 30.60400.98340.825N/Ano
Q752H4MPG1_ASHGO2, ., 7, ., 7, ., 1, 30.53460.99660.8337yesno
A2VD83GMPBB_XENLA2, ., 7, ., 7, ., 1, 30.59390.98340.825N/Ano

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.70.963
3rd Layer2.7.7.130.946

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00018410001
SubName- Full=Chromosome chr13 scaffold_17, whole genome shotgun sequence; (361 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00036807001
SubName- Full=Chromosome chr4 scaffold_83, whole genome shotgun sequence; (373 aa)
     0.978
GSVIVG00026780001
SubName- Full=Chromosome chr15 scaffold_40, whole genome shotgun sequence; (249 aa)
     0.973
GSVIVG00015572001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (243 aa)
   0.933
GSVIVG00031181001
SubName- Full=Chromosome chr14 scaffold_54, whole genome shotgun sequence; (376 aa)
      0.905
GSVIVG00014968001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (437 aa)
     0.890
GSVIVG00028703001
SubName- Full=Chromosome chr13 scaffold_45, whole genome shotgun sequence; (621 aa)
     0.858
GSVIVG00015680001
SubName- Full=Chromosome chr2 scaffold_11, whole genome shotgun sequence; (80 aa)
      0.848
GSVIVG00018184001
SubName- Full=Chromosome chr13 scaffold_17, whole genome shotgun sequence; (522 aa)
     0.774
GSVIVG00017124001
SubName- Full=Chromosome chr11 scaffold_14, whole genome shotgun sequence; (355 aa)
      0.678
GSVIVG00000750001
SubName- Full=Chromosome undetermined scaffold_107, whole genome shotgun sequence; (657 aa)
     0.629

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query302
cd06425233 cd06425, M1P_guanylylT_B_like_N, N-terminal domain 1e-116
COG1208358 COG1208, GCD1, Nucleoside-diphosphate-sugar pyroph 4e-74
cd04181217 cd04181, NTP_transferase, NTP_transferases catalyz 4e-48
pfam00483247 pfam00483, NTP_transferase, Nucleotidyl transferas 9e-40
cd06428257 cd06428, M1P_guanylylT_A_like_N, N-terminal domain 2e-37
TIGR03992393 TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diph 3e-36
cd06426220 cd06426, NTP_transferase_like_2, NTP_trnasferase_l 6e-32
cd06915223 cd06915, NTP_transferase_WcbM_like, WcbM_like is a 4e-31
cd0582480 cd05824, LbH_M1P_guanylylT_C, Mannose-1-phosphate 3e-29
cd06422221 cd06422, NTP_transferase_like_1, NTP_transferase_l 8e-23
TIGR01208353 TIGR01208, rmlA_long, glucose-1-phosphate thymidyl 1e-22
cd02524253 cd02524, G1P_cytidylyltransferase, G1P_cytidylyltr 6e-22
cd04189236 cd04189, G1P_TT_long, G1P_TT_long represents the l 1e-21
COG0448393 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carb 3e-21
COG1207460 COG1207, GlmU, N-acetylglucosamine-1-phosphate uri 8e-20
COG1209286 COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cel 8e-18
TIGR02623254 TIGR02623, G1P_cyt_trans, glucose-1-phosphate cyti 1e-17
TIGR01173451 TIGR01173, glmU, UDP-N-acetylglucosamine diphospho 2e-17
cd0335679 cd03356, LbH_G1P_AT_C_like, Left-handed parallel b 2e-16
TIGR02091361 TIGR02091, glgC, glucose-1-phosphate adenylyltrans 4e-15
PRK05293380 PRK05293, glgC, glucose-1-phosphate adenylyltransf 8e-15
cd02541267 cd02541, UGPase_prokaryotic, Prokaryotic UGPase ca 8e-13
PRK14354458 PRK14354, glmU, bifunctional N-acetylglucosamine-1 2e-12
PRK14355459 PRK14355, glmU, bifunctional N-acetylglucosamine-1 2e-11
cd03353193 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosph 5e-11
cd02540229 cd02540, GT2_GlmU_N_bac, N-terminal domain of bact 5e-11
cd0465281 cd04652, LbH_eIF2B_gamma_C, eIF-2B gamma subunit, 3e-10
PRK14357448 PRK14357, glmU, bifunctional N-acetylglucosamine-1 5e-09
cd03352205 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyl 2e-08
PRK14356456 PRK14356, glmU, bifunctional N-acetylglucosamine-1 9e-08
PRK00892 343 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] gluco 2e-07
PRK02862429 PRK02862, glgC, glucose-1-phosphate adenylyltransf 2e-07
PRK14360450 PRK14360, glmU, bifunctional N-acetylglucosamine-1 2e-07
COG1210291 COG1210, GalU, UDP-glucose pyrophosphorylase [Cell 3e-07
PRK00844407 PRK00844, glgC, glucose-1-phosphate adenylyltransf 3e-07
TIGR01099260 TIGR01099, galU, UTP-glucose-1-phosphate uridylylt 6e-07
TIGR01853324 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristo 7e-07
PRK14358 481 PRK14358, glmU, bifunctional N-acetylglucosamine-1 1e-06
cd05636163 cd05636, LbH_G1P_TT_C_like, Putative glucose-1-pho 2e-06
TIGR01852 254 TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protei 2e-06
cd03351 254 cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamin 5e-06
cd02538240 cd02538, G1P_TT_short, G1P_TT_short is the short f 9e-06
PRK05289 262 PRK05289, PRK05289, UDP-N-acetylglucosamine acyltr 1e-05
COG1043 260 COG1043, LpxA, Acyl-[acyl carrier protein] 1e-05
PRK00892 343 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] gluco 2e-05
PRK05289 262 PRK05289, PRK05289, UDP-N-acetylglucosamine acyltr 3e-05
COG1044 338 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] 3e-05
cd02507216 cd02507, eIF-2B_gamma_N_like, The N-terminal of eI 7e-05
TIGR01853 324 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristo 1e-04
cd04645153 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydra 1e-04
cd03360197 cd03360, LbH_AT_putative, Putative Acyltransferase 3e-04
cd03351 254 cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamin 4e-04
PRK14352 482 PRK14352, glmU, bifunctional N-acetylglucosamine-1 5e-04
PLN02241436 PLN02241, PLN02241, glucose-1-phosphate adenylyltr 5e-04
PRK14353446 PRK14353, glmU, bifunctional N-acetylglucosamine-1 0.001
cd03358119 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed p 0.001
cd04651104 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenyly 0.001
PRK14356456 PRK14356, glmU, bifunctional N-acetylglucosamine-1 0.002
COG1043 260 COG1043, LpxA, Acyl-[acyl carrier protein] 0.002
PRK12461 255 PRK12461, PRK12461, UDP-N-acetylglucosamine acyltr 0.002
PRK14359430 PRK14359, glmU, bifunctional N-acetylglucosamine-1 0.002
TIGR03570193 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sia 0.002
pfam0013236 pfam00132, Hexapep, Bacterial transferase hexapept 0.003
pfam0013236 pfam00132, Hexapep, Bacterial transferase hexapept 0.003
PRK00725425 PRK00725, glgC, glucose-1-phosphate adenylyltransf 0.003
cd02523229 cd02523, PC_cytidylyltransferase, Phosphocholine c 0.003
>gnl|CDD|133047 cd06425, M1P_guanylylT_B_like_N, N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins Back     alignment and domain information
 Score =  332 bits (854), Expect = e-116
 Identities = 127/175 (72%), Positives = 154/175 (88%), Gaps = 1/175 (0%)

Query: 1   MLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFA 60
           M+ FLKE+E KLGIKI  S ETEPLGTAGPLALARD L DD  EPFFVLNSDVI ++P A
Sbjct: 60  MVPFLKEYEKKLGIKITFSIETEPLGTAGPLALARDLLGDD-DEPFFVLNSDVICDFPLA 118

Query: 61  EMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGKVEKFVEKPKLFVGNKINAGIYLL 120
           E+++FHK HG E +I+VTKV++PSKYGVVV +E+TG++E+FVEKPK+FVGNKINAGIY+L
Sbjct: 119 ELLDFHKKHGAEGTILVTKVEDPSKYGVVVHDENTGRIERFVEKPKVFVGNKINAGIYIL 178

Query: 121 NPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPRDYITGLRLYL 175
           NP+VLDRI LRPTSIEKE+FPK+A EG+L+A  LPGFWMDIGQP+D++ G+ LYL
Sbjct: 179 NPSVLDRIPLRPTSIEKEIFPKMASEGQLYAYELPGFWMDIGQPKDFLKGMSLYL 233


GDP-mannose pyrophosphorylase (GTP: alpha-d-mannose-1-phosphate guanyltransferase) catalyzes the formation of GDP-d-mannose from GTP and alpha-d-mannose-1-Phosphate. It contains an N-terminal catalytic domain and a C-terminal Lefthanded-beta-Helix fold domain. GDP-d-mannose is the activated form of mannose for formation of cell wall lipoarabinomannan and various mannose-containing glycolipids and polysaccharides. The function of GDP-mannose pyrophosphorylase is essential for cell wall integrity, morphogenesis and viability. Repression of GDP-mannose pyrophosphorylase in yeast leads to phenotypes, such as cell lysis, defective cell wall, and failure of polarized growth and cell separation. Length = 233

>gnl|CDD|224129 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|133024 cd04181, NTP_transferase, NTP_transferases catalyze the transfer of nucleotides onto phosphosugars Back     alignment and domain information
>gnl|CDD|215940 pfam00483, NTP_transferase, Nucleotidyl transferase Back     alignment and domain information
>gnl|CDD|133050 cd06428, M1P_guanylylT_A_like_N, N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase Back     alignment and domain information
>gnl|CDD|234433 TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>gnl|CDD|133048 cd06426, NTP_transferase_like_2, NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family Back     alignment and domain information
>gnl|CDD|133065 cd06915, NTP_transferase_WcbM_like, WcbM_like is a subfamily of nucleotidyl transferases Back     alignment and domain information
>gnl|CDD|100062 cd05824, LbH_M1P_guanylylT_C, Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase Back     alignment and domain information
>gnl|CDD|133044 cd06422, NTP_transferase_like_1, NTP_transferase_like_1 is a member of the nucleotidyl transferase family Back     alignment and domain information
>gnl|CDD|233311 TIGR01208, rmlA_long, glucose-1-phosphate thymidylylransferase, long form Back     alignment and domain information
>gnl|CDD|133015 cd02524, G1P_cytidylyltransferase, G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose Back     alignment and domain information
>gnl|CDD|133032 cd04189, G1P_TT_long, G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>gnl|CDD|223525 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|224128 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224130 COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|131672 TIGR02623, G1P_cyt_trans, glucose-1-phosphate cytidylyltransferase Back     alignment and domain information
>gnl|CDD|233299 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>gnl|CDD|100046 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>gnl|CDD|233720 TIGR02091, glgC, glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>gnl|CDD|179997 PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|133021 cd02541, UGPase_prokaryotic, Prokaryotic UGPase catalyses the synthesis of UDP-glucose Back     alignment and domain information
>gnl|CDD|184643 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|237685 PRK14355, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>gnl|CDD|133020 cd02540, GT2_GlmU_N_bac, N-terminal domain of bacterial GlmU Back     alignment and domain information
>gnl|CDD|100057 cd04652, LbH_eIF2B_gamma_C, eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>gnl|CDD|237687 PRK14357, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>gnl|CDD|237686 PRK14356, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|234858 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|179486 PRK02862, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|184646 PRK14360, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|224131 COG1210, GalU, UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|234846 PRK00844, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|233272 TIGR01099, galU, UTP-glucose-1-phosphate uridylyltransferase Back     alignment and domain information
>gnl|CDD|233599 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase Back     alignment and domain information
>gnl|CDD|237688 PRK14358, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|100060 cd05636, LbH_G1P_TT_C_like, Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>gnl|CDD|188173 TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Back     alignment and domain information
>gnl|CDD|100042 cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>gnl|CDD|133019 cd02538, G1P_TT_short, G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>gnl|CDD|235390 PRK05289, PRK05289, UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|223973 COG1043, LpxA, Acyl-[acyl carrier protein] Back     alignment and domain information
>gnl|CDD|234858 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|235390 PRK05289, PRK05289, UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>gnl|CDD|133001 cd02507, eIF-2B_gamma_N_like, The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity Back     alignment and domain information
>gnl|CDD|233599 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase Back     alignment and domain information
>gnl|CDD|100051 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>gnl|CDD|100050 cd03360, LbH_AT_putative, Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>gnl|CDD|100042 cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>gnl|CDD|184641 PRK14352, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|215133 PLN02241, PLN02241, glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>gnl|CDD|184642 PRK14353, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|100048 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>gnl|CDD|100056 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>gnl|CDD|237686 PRK14356, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|223973 COG1043, LpxA, Acyl-[acyl carrier protein] Back     alignment and domain information
>gnl|CDD|183539 PRK12461, PRK12461, UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|237689 PRK14359, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|234265 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>gnl|CDD|189409 pfam00132, Hexapep, Bacterial transferase hexapeptide (six repeats) Back     alignment and domain information
>gnl|CDD|189409 pfam00132, Hexapep, Bacterial transferase hexapeptide (six repeats) Back     alignment and domain information
>gnl|CDD|234824 PRK00725, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|133014 cd02523, PC_cytidylyltransferase, Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 302
KOG1322371 consensus GDP-mannose pyrophosphorylase/mannose-1- 100.0
COG1208358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas 100.0
KOG1460407 consensus GDP-mannose pyrophosphorylase [Carbohydr 100.0
PRK05293380 glgC glucose-1-phosphate adenylyltransferase; Prov 100.0
COG0448393 GlgC ADP-glucose pyrophosphorylase [Carbohydrate t 100.0
TIGR01208353 rmlA_long glucose-1-phosphate thymidylylransferase 100.0
COG1207460 GlmU N-acetylglucosamine-1-phosphate uridyltransfe 100.0
PLN02241436 glucose-1-phosphate adenylyltransferase 100.0
PRK02862429 glgC glucose-1-phosphate adenylyltransferase; Prov 100.0
PRK00844407 glgC glucose-1-phosphate adenylyltransferase; Prov 100.0
PRK00725425 glgC glucose-1-phosphate adenylyltransferase; Prov 100.0
TIGR02091361 glgC glucose-1-phosphate adenylyltransferase. This 100.0
PRK14355459 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
TIGR02092369 glgD glucose-1-phosphate adenylyltransferase, GlgD 100.0
PRK14352 482 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK14356456 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK14358 481 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
TIGR01173451 glmU UDP-N-acetylglucosamine diphosphorylase/gluco 100.0
COG1209286 RfbA dTDP-glucose pyrophosphorylase [Cell envelope 99.98
PRK14353446 glmU bifunctional N-acetylglucosamine-1-phosphate 99.97
PRK14359430 glmU bifunctional N-acetylglucosamine-1-phosphate 99.97
PRK09451456 glmU bifunctional N-acetylglucosamine-1-phosphate 99.97
PRK14357448 glmU bifunctional N-acetylglucosamine-1-phosphate 99.97
PRK14354458 glmU bifunctional N-acetylglucosamine-1-phosphate 99.97
PRK14360450 glmU bifunctional N-acetylglucosamine-1-phosphate 99.96
KOG1461 673 consensus Translation initiation factor 2B, epsilo 99.95
KOG1462433 consensus Translation initiation factor 2B, gamma 99.95
cd06428257 M1P_guanylylT_A_like_N N-terminal domain of M1P_gu 99.94
cd06425233 M1P_guanylylT_B_like_N N-terminal domain of the M1 99.94
PRK15480292 glucose-1-phosphate thymidylyltransferase RfbA; Pr 99.92
TIGR01105297 galF UTP-glucose-1-phosphate uridylyltransferase, 99.92
TIGR01207286 rmlA glucose-1-phosphate thymidylyltransferase, sh 99.92
PF00483248 NTP_transferase: Nucleotidyl transferase This Pros 99.92
cd02538240 G1P_TT_short G1P_TT_short is the short form of glu 99.91
PRK10122297 GalU regulator GalF; Provisional 99.91
TIGR02623254 G1P_cyt_trans glucose-1-phosphate cytidylyltransfe 99.91
PRK13389302 UTP--glucose-1-phosphate uridylyltransferase subun 99.89
cd04189236 G1P_TT_long G1P_TT_long represents the long form o 99.88
cd06422221 NTP_transferase_like_1 NTP_transferase_like_1 is a 99.87
cd06915223 NTP_transferase_WcbM_like WcbM_like is a subfamily 99.86
cd02524253 G1P_cytidylyltransferase G1P_cytidylyltransferase 99.86
cd02541267 UGPase_prokaryotic Prokaryotic UGPase catalyses th 99.85
cd04181217 NTP_transferase NTP_transferases catalyze the tran 99.85
cd06426220 NTP_transferase_like_2 NTP_trnasferase_like_2 is a 99.85
TIGR01099260 galU UTP-glucose-1-phosphate uridylyltransferase. 99.84
COG1210291 GalU UDP-glucose pyrophosphorylase [Cell envelope 99.84
TIGR03532231 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla 99.82
COG0663176 PaaY Carbonic anhydrases/acetyltransferases, isole 99.71
TIGR02287192 PaaY phenylacetic acid degradation protein PaaY. M 99.71
cd04745155 LbH_paaY_like paaY-like: This group is composed by 99.71
cd05636163 LbH_G1P_TT_C_like Putative glucose-1-phosphate thy 99.7
cd04646164 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact 99.69
PRK13627196 carnitine operon protein CaiE; Provisional 99.68
PLN02296269 carbonate dehydratase 99.68
PLN02472246 uncharacterized protein 99.67
COG1044338 LpxD UDP-3-O-[3-hydroxymyristoyl] 99.66
cd04183231 GT2_BcE_like GT2_BcbE_like is likely involved in t 99.65
TIGR00965269 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate 99.65
cd04650154 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP 99.64
cd04645153 LbH_gamma_CA_like Gamma carbonic anhydrase-like: T 99.62
PRK00892343 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac 99.61
cd0582480 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr 99.6
cd03350139 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d 99.6
cd05636163 LbH_G1P_TT_C_like Putative glucose-1-phosphate thy 99.59
cd03351254 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr 99.59
cd02517239 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes th 99.57
PRK05450245 3-deoxy-manno-octulosonate cytidylyltransferase; P 99.57
cd03359161 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact 99.57
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-a 99.57
cd03360197 LbH_AT_putative Putative Acyltransferase (AT), Lef 99.57
cd02509274 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransf 99.56
cd0335679 LbH_G1P_AT_C_like Left-handed parallel beta-Helix 99.56
PRK05289 262 UDP-N-acetylglucosamine acyltransferase; Provision 99.56
cd03351254 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr 99.56
cd04197217 eIF-2B_epsilon_N The N-terminal domain of epsilon 99.56
TIGR01853 324 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam 99.56
cd02523229 PC_cytidylyltransferase Phosphocholine cytidylyltr 99.56
TIGR01852254 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac 99.56
cd02508200 ADP_Glucose_PP ADP-glucose pyrophosphorylase is in 99.55
PRK11830272 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- 99.55
cd0465281 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal 99.55
TIGR01479468 GMP_PMI mannose-1-phosphate guanylyltransferase/ma 99.54
TIGR01852254 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac 99.53
cd0578779 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central 99.53
KOG1461 673 consensus Translation initiation factor 2B, epsilo 99.53
COG1044338 LpxD UDP-3-O-[3-hydroxymyristoyl] 99.53
cd03353193 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl 99.52
PRK05289 262 UDP-N-acetylglucosamine acyltransferase; Provision 99.52
TIGR01853324 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam 99.51
cd03358119 LbH_WxcM_N_like WcxM-like, Left-handed parallel be 99.51
cd00710167 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo 99.5
PRK12461 255 UDP-N-acetylglucosamine acyltransferase; Provision 99.5
cd04649147 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah 99.49
PRK00892 343 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac 99.49
cd03350139 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d 99.49
COG1043260 LpxA Acyl-[acyl carrier protein] 99.48
cd03360197 LbH_AT_putative Putative Acyltransferase (AT), Lef 99.48
PRK12461 255 UDP-N-acetylglucosamine acyltransferase; Provision 99.48
cd02540229 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU 99.48
TIGR03308204 phn_thr-fam phosphonate metabolim protein, transfe 99.48
TIGR00965269 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate 99.47
cd03352205 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas 99.46
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-a 99.45
cd04745155 LbH_paaY_like paaY-like: This group is composed by 99.45
PRK13368238 3-deoxy-manno-octulosonate cytidylyltransferase; P 99.43
cd03353193 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl 99.43
TIGR02287192 PaaY phenylacetic acid degradation protein PaaY. M 99.41
TIGR03532231 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla 99.4
PRK13627196 carnitine operon protein CaiE; Provisional 99.4
TIGR03308204 phn_thr-fam phosphonate metabolim protein, transfe 99.39
cd04651104 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera 99.39
cd04646164 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact 99.39
TIGR03536341 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl 99.39
cd03358119 LbH_WxcM_N_like WcxM-like, Left-handed parallel be 99.37
cd05635101 LbH_unknown Uncharacterized proteins, Left-handed 99.36
cd03352205 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas 99.36
PLN02296269 carbonate dehydratase 99.35
cd04650154 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP 99.35
PRK10502182 putative acyl transferase; Provisional 99.35
cd0578779 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central 99.34
COG2171271 DapD Tetrahydrodipicolinate N-succinyltransferase 99.33
cd04645153 LbH_gamma_CA_like Gamma carbonic anhydrase-like: T 99.33
cd00710167 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo 99.33
PRK11830272 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- 99.32
cd0335679 LbH_G1P_AT_C_like Left-handed parallel beta-Helix 99.32
PRK14353446 glmU bifunctional N-acetylglucosamine-1-phosphate 99.32
cd05635101 LbH_unknown Uncharacterized proteins, Left-handed 99.31
PRK14360450 glmU bifunctional N-acetylglucosamine-1-phosphate 99.31
PRK09451456 glmU bifunctional N-acetylglucosamine-1-phosphate 99.3
COG1043 260 LpxA Acyl-[acyl carrier protein] 99.3
cd03359161 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact 99.29
PRK14355459 glmU bifunctional N-acetylglucosamine-1-phosphate 99.29
PLN02472246 uncharacterized protein 99.29
TIGR01173451 glmU UDP-N-acetylglucosamine diphosphorylase/gluco 99.29
cd0465281 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal 99.29
cd04651104 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera 99.28
TIGR03535319 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo 99.28
COG0663176 PaaY Carbonic anhydrases/acetyltransferases, isole 99.28
KOG1462433 consensus Translation initiation factor 2B, gamma 99.26
PRK14356456 glmU bifunctional N-acetylglucosamine-1-phosphate 99.25
PRK09677192 putative lipopolysaccharide biosynthesis O-acetyl 99.25
PRK11132273 cysE serine acetyltransferase; Provisional 99.25
PLN02694294 serine O-acetyltransferase 99.24
PRK14352482 glmU bifunctional N-acetylglucosamine-1-phosphate 99.24
PRK14358481 glmU bifunctional N-acetylglucosamine-1-phosphate 99.23
PRK09527203 lacA galactoside O-acetyltransferase; Reviewed 99.23
PRK10092183 maltose O-acetyltransferase; Provisional 99.22
PRK14359430 glmU bifunctional N-acetylglucosamine-1-phosphate 99.22
cd03354101 LbH_SAT Serine acetyltransferase (SAT): SAT cataly 99.21
TIGR01172162 cysE serine O-acetyltransferase. Cysteine biosynth 99.21
KOG3121184 consensus Dynactin, subunit p25 [Cytoskeleton] 99.21
cd04647109 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: 99.21
PRK14357448 glmU bifunctional N-acetylglucosamine-1-phosphate 99.21
PRK14354458 glmU bifunctional N-acetylglucosamine-1-phosphate 99.2
cd04649147 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah 99.19
PRK05293380 glgC glucose-1-phosphate adenylyltransferase; Prov 99.18
cd04198214 eIF-2B_gamma_N The N-terminal domain of gamma subu 99.17
COG0836333 {ManC} Mannose-1-phosphate guanylyltransferase [Ce 99.16
cd0020878 LbetaH Left-handed parallel beta-Helix (LbetaH or 99.16
cd0582480 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr 99.16
cd03357169 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and 99.16
COG0448393 GlgC ADP-glucose pyrophosphorylase [Carbohydrate t 99.15
cd02507216 eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma 99.15
TIGR01172162 cysE serine O-acetyltransferase. Cysteine biosynth 99.12
PLN02357360 serine acetyltransferase 99.11
PRK10191146 putative acyl transferase; Provisional 99.1
COG1207460 GlmU N-acetylglucosamine-1-phosphate uridyltransfe 99.09
TIGR01208353 rmlA_long glucose-1-phosphate thymidylylransferase 99.07
PRK00844407 glgC glucose-1-phosphate adenylyltransferase; Prov 99.05
PLN02739355 serine acetyltransferase 99.03
PLN02694294 serine O-acetyltransferase 99.03
TIGR03535319 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo 99.03
TIGR02091361 glgC glucose-1-phosphate adenylyltransferase. This 99.02
PRK10092183 maltose O-acetyltransferase; Provisional 99.02
PRK10191146 putative acyl transferase; Provisional 99.02
cd05825107 LbH_wcaF_like wcaF-like: This group is composed of 99.01
cd0020878 LbetaH Left-handed parallel beta-Helix (LbetaH or 99.0
PRK09527203 lacA galactoside O-acetyltransferase; Reviewed 99.0
PRK02862429 glgC glucose-1-phosphate adenylyltransferase; Prov 98.99
cd03354101 LbH_SAT Serine acetyltransferase (SAT): SAT cataly 98.99
PRK11132273 cysE serine acetyltransferase; Provisional 98.97
PRK00725425 glgC glucose-1-phosphate adenylyltransferase; Prov 98.96
cd03357169 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and 98.96
PLN02739355 serine acetyltransferase 98.95
TIGR02092369 glgD glucose-1-phosphate adenylyltransferase, GlgD 98.93
TIGR03536341 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl 98.91
cd05825107 LbH_wcaF_like wcaF-like: This group is composed of 98.91
PLN02917293 CMP-KDO synthetase 98.91
PLN02357360 serine acetyltransferase 98.9
COG1045194 CysE Serine acetyltransferase [Amino acid transpor 98.88
PRK10502182 putative acyl transferase; Provisional 98.88
COG1208358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas 98.88
KOG3121184 consensus Dynactin, subunit p25 [Cytoskeleton] 98.88
PRK15460478 cpsB mannose-1-phosphate guanyltransferase; Provis 98.87
cd03349145 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT 98.87
cd04647109 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: 98.86
PRK09677192 putative lipopolysaccharide biosynthesis O-acetyl 98.85
COG2171271 DapD Tetrahydrodipicolinate N-succinyltransferase 98.82
PLN02241436 glucose-1-phosphate adenylyltransferase 98.81
KOG4042190 consensus Dynactin subunit p27/WS-3, involved in t 98.72
COG1045194 CysE Serine acetyltransferase [Amino acid transpor 98.61
COG1213239 Predicted sugar nucleotidyltransferases [Cell enve 98.6
TIGR02353 695 NRPS_term_dom non-ribosomal peptide synthetase ter 98.59
COG0110190 WbbJ Acetyltransferase (isoleucine patch superfami 98.58
TIGR02353695 NRPS_term_dom non-ribosomal peptide synthetase ter 98.57
KOG4042190 consensus Dynactin subunit p27/WS-3, involved in t 98.54
KOG1460407 consensus GDP-mannose pyrophosphorylase [Carbohydr 98.52
cd03349145 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT 98.41
KOG4750269 consensus Serine O-acetyltransferase [Amino acid t 98.36
KOG1322371 consensus GDP-mannose pyrophosphorylase/mannose-1- 98.34
COG0110190 WbbJ Acetyltransferase (isoleucine patch superfami 98.18
PF07959414 Fucokinase: L-fucokinase; InterPro: IPR012887 In t 98.07
PF0013236 Hexapep: Bacterial transferase hexapeptide (six re 97.93
COG4801 277 Predicted acyltransferase [General function predic 97.87
COG4801 277 Predicted acyltransferase [General function predic 97.84
PF0013236 Hexapep: Bacterial transferase hexapeptide (six re 97.83
cd02513223 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N- 97.82
PRK13412 974 fkp bifunctional fucokinase/L-fucose-1-P-guanylylt 97.76
TIGR00466238 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransfe 97.76
KOG4750269 consensus Serine O-acetyltransferase [Amino acid t 97.68
PF1460234 Hexapep_2: Hexapeptide repeat of succinyl-transfer 97.55
COG1212247 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase 97.25
TIGR03584222 PseF pseudaminic acid CMP-transferase. The sequenc 97.07
PRK09382378 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosp 96.96
TIGR00453217 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl 96.6
PRK00155227 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl 96.6
cd02516218 CDP-ME_synthetase CDP-ME synthetase is involved in 96.27
TIGR03310188 matur_ygfJ molybdenum hydroxylase accessory protei 95.74
PF12804160 NTP_transf_3: MobA-like NTP transferase domain; PD 94.82
PRK13385230 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 93.66
PF07959414 Fucokinase: L-fucokinase; InterPro: IPR012887 In t 93.35
PF00535169 Glycos_transf_2: Glycosyl transferase family 2; In 92.88
PRK00317193 mobA molybdopterin-guanine dinucleotide biosynthes 92.69
COG2068199 Uncharacterized MobA-related protein [General func 91.72
cd04180266 UGPase_euk_like Eukaryotic UGPase-like includes UD 91.32
PLN02474469 UTP--glucose-1-phosphate uridylyltransferase 90.95
TIGR02665186 molyb_mobA molybdopterin-guanine dinucleotide bios 89.83
PRK14489366 putative bifunctional molybdopterin-guanine dinucl 88.5
cd04188211 DPG_synthase DPG_synthase is involved in protein N 88.3
cd04182186 GT_2_like_f GT_2_like_f is a subfamily of the glyc 88.26
TIGR00454183 conserved hypothetical protein TIGR00454. At this 87.05
cd02503181 MobA MobA catalyzes the formation of molybdopterin 84.97
PRK00560196 molybdopterin-guanine dinucleotide biosynthesis pr 84.32
cd04179185 DPM_DPG-synthase_like DPM_DPG-synthase_like is a m 83.9
TIGR03202190 pucB xanthine dehydrogenase accessory protein pucB 82.08
COG2266177 GTP:adenosylcobinamide-phosphate guanylyltransfera 82.03
cd00761156 Glyco_tranf_GTA_type Glycosyltransferase family A 80.51
COG1083228 NeuA CMP-N-acetylneuraminic acid synthetase [Cell 80.44
cd06427241 CESA_like_2 CESA_like_2 is a member of the cellulo 80.38
cd04187181 DPM1_like_bac Bacterial DPM1_like enzymes are rela 80.33
>KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
Probab=100.00  E-value=3.7e-55  Score=368.32  Aligned_cols=301  Identities=57%  Similarity=0.956  Sum_probs=287.7

Q ss_pred             hhHHHHHhhcCCcEEEEEecCCCCCChHHHHHcHhhhccCCCCcEEEEeCCeecCcCHHHHHHHHHHcCCcEEEEEEeCC
Q 022113            2 LNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVD   81 (302)
Q Consensus         2 ~~~~~~~~~~~g~~i~~~~~~~~~Gt~~al~~a~~~i~~~~~~~~lv~~gD~l~~~~l~~~~~~~~~~~~~~~l~~~~~~   81 (302)
                      +++.+.++.++|++|.++.|.+++||++.+..|++++..+.+.+|+|++||+++++++++|+++|++++++.|+++.+.+
T Consensus        71 ~~~~k~y~~~lgVei~~s~eteplgtaGpl~laR~~L~~~~~~~ffVLnsDvi~~~p~~~~vqfH~~~gae~TI~~t~vd  150 (371)
T KOG1322|consen   71 RHLSKAYGKELGVEILASTETEPLGTAGPLALARDFLWVFEDAPFFVLNSDVICRMPYKEMVQFHRAHGAEITIVVTKVD  150 (371)
T ss_pred             HHHHHHhhhccceEEEEEeccCCCcccchHHHHHHHhhhcCCCcEEEecCCeeecCCHHHHHHHHHhcCCceEEEEEecc
Confidence            35667778889999999999999999999999999998765568999999999999999999999999999999999999


Q ss_pred             CCCCcceEEEeCCCCcEEEEEecCCCCCCCeEEEEEEEeCHhhHhhccCCCCCccccchHHHHhcCcEEEEEecCeeEec
Q 022113           82 EPSKYGVVVMEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDI  161 (302)
Q Consensus        82 ~~~~~g~v~~d~~~~~v~~~~ekp~~~~~~~~~~Giy~~~~~~l~~l~~~~~~~~~~~~~~l~~~~~v~~~~~~g~~~di  161 (302)
                      +|++||++..|+++|+|.+|.|||+...++.+++|+|+|+|++++.+.....++..|++|.++...++++|.++|||+|+
T Consensus       151 epSkyGvv~~d~~~grV~~F~EKPkd~vsnkinaGiYi~~~~vL~ri~~~ptSiekEifP~~a~~~~l~a~~l~gfWmDI  230 (371)
T KOG1322|consen  151 EPSKYGVVVIDEDTGRVIRFVEKPKDLVSNKINAGIYILNPEVLDRILLRPTSIEKEIFPAMAEEHQLYAFDLPGFWMDI  230 (371)
T ss_pred             CccccceEEEecCCCceeEehhCchhhhhccccceEEEECHHHHhHhhhcccchhhhhhhhhhhcCceEEEecCchhhhc
Confidence            99999999999878999999999998778899999999999999999888888999999999999999999999999999


Q ss_pred             CChHHHHHHHHHHHHhhccccccccccCceEecceEEcCCcEECCCCEECCCcEECCCCEECCCcEEeceEEccCCEECC
Q 022113          162 GQPRDYITGLRLYLDSLRKKSSLKLATGANIVGNVLVHESAQIGEGCLIGPDVAVGPGCVVESGVRLSRCTVMRGVRIKK  241 (302)
Q Consensus       162 gt~~~~~~a~~~~l~~~~~~~~~~~~~~~~i~~~~~i~~~~~i~~~~~i~~~~~ig~~~~i~~~~~i~~~~i~~~~~i~~  241 (302)
                      |+|++|+.+...+++.++...+.++.+++.+.+++++++.+.+|++|.|+++++||++|+|++++.|.+|.|+.+..++.
T Consensus       231 Gqpkdf~~g~~~Yl~s~~~~t~~r~~p~~~i~~nvlvd~~~~iG~~C~Ig~~vvIG~r~~i~~gV~l~~s~il~~~~~~~  310 (371)
T KOG1322|consen  231 GQPKDFLTGFSFYLRSLPKYTSPRLLPGSKIVGNVLVDSIASIGENCSIGPNVVIGPRVRIEDGVRLQDSTILGADYYET  310 (371)
T ss_pred             CCHHHHHHHHHHHHhhCcccCCccccCCccccccEeeccccccCCccEECCCceECCCcEecCceEEEeeEEEccceech
Confidence            99999999999999999888888999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcEEeccEECCCCEECCCcEEccCcEECCCcEECCceEEcCCeEecCccccccccCCcccC
Q 022113          242 HACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILKPEIVM  302 (302)
Q Consensus       242 ~~~i~~~~i~~~~~i~~~~~i~~~~~i~~~~~v~~~~~v~~~~v~~~~~~~~~~~~~~~~~  302 (302)
                      ++.+..++++.++.||.|++|.+.++||+++.|.+.-.+..+.++|+|++..+++||.++|
T Consensus       311 ~s~i~s~ivg~~~~IG~~~~id~~a~lG~nV~V~d~~~vn~g~~l~~ks~~~~v~~~~iI~  371 (371)
T KOG1322|consen  311 HSEISSSIVGWNVPIGIWARIDKNAVLGKNVIVADEDYVNEGSGLPIKSGITVVLKPAIIM  371 (371)
T ss_pred             hHHHHhhhccccccccCceEEecccEeccceEEecccccccceeEEeccceeecccccccC
Confidence            9999999999999999999999999999999999999999999999999999999999987



>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form Back     alignment and domain information
>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02241 glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>TIGR02091 glgC glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit Back     alignment and domain information
>PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>COG1209 RfbA dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd06428 M1P_guanylylT_A_like_N N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase Back     alignment and domain information
>cd06425 M1P_guanylylT_B_like_N N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins Back     alignment and domain information
>PRK15480 glucose-1-phosphate thymidylyltransferase RfbA; Provisional Back     alignment and domain information
>TIGR01105 galF UTP-glucose-1-phosphate uridylyltransferase, non-catalytic GalF subunit Back     alignment and domain information
>TIGR01207 rmlA glucose-1-phosphate thymidylyltransferase, short form Back     alignment and domain information
>PF00483 NTP_transferase: Nucleotidyl transferase This Prosite entry is only a sub-family of the Pfam entry Back     alignment and domain information
>cd02538 G1P_TT_short G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>PRK10122 GalU regulator GalF; Provisional Back     alignment and domain information
>TIGR02623 G1P_cyt_trans glucose-1-phosphate cytidylyltransferase Back     alignment and domain information
>PRK13389 UTP--glucose-1-phosphate uridylyltransferase subunit GalU; Provisional Back     alignment and domain information
>cd04189 G1P_TT_long G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>cd06422 NTP_transferase_like_1 NTP_transferase_like_1 is a member of the nucleotidyl transferase family Back     alignment and domain information
>cd06915 NTP_transferase_WcbM_like WcbM_like is a subfamily of nucleotidyl transferases Back     alignment and domain information
>cd02524 G1P_cytidylyltransferase G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose Back     alignment and domain information
>cd02541 UGPase_prokaryotic Prokaryotic UGPase catalyses the synthesis of UDP-glucose Back     alignment and domain information
>cd04181 NTP_transferase NTP_transferases catalyze the transfer of nucleotides onto phosphosugars Back     alignment and domain information
>cd06426 NTP_transferase_like_2 NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family Back     alignment and domain information
>TIGR01099 galU UTP-glucose-1-phosphate uridylyltransferase Back     alignment and domain information
>COG1210 GalU UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Back     alignment and domain information
>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>TIGR02287 PaaY phenylacetic acid degradation protein PaaY Back     alignment and domain information
>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E Back     alignment and domain information
>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>PRK13627 carnitine operon protein CaiE; Provisional Back     alignment and domain information
>PLN02296 carbonate dehydratase Back     alignment and domain information
>PLN02472 uncharacterized protein Back     alignment and domain information
>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>cd04183 GT2_BcE_like GT2_BcbE_like is likely involved in the biosynthesis of the polysaccharide capsule Back     alignment and domain information
>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition Back     alignment and domain information
>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase Back     alignment and domain information
>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA Back     alignment and domain information
>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>cd02517 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes the activation of KDO which is an essential component of the lipopolysaccharide Back     alignment and domain information
>PRK05450 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>cd02509 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransferase catalyzes the formation of GDP-Mannose Back     alignment and domain information
>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>cd04197 eIF-2B_epsilon_N The N-terminal domain of epsilon subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase Back     alignment and domain information
>cd02523 PC_cytidylyltransferase Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline Back     alignment and domain information
>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Back     alignment and domain information
>cd02508 ADP_Glucose_PP ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch Back     alignment and domain information
>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional Back     alignment and domain information
>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase Back     alignment and domain information
>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Back     alignment and domain information
>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase Back     alignment and domain information
>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH Back     alignment and domain information
>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA Back     alignment and domain information
>COG1043 LpxA Acyl-[acyl carrier protein] Back     alignment and domain information
>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>cd02540 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU Back     alignment and domain information
>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family Back     alignment and domain information
>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E Back     alignment and domain information
>PRK13368 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>TIGR02287 PaaY phenylacetic acid degradation protein PaaY Back     alignment and domain information
>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Back     alignment and domain information
>PRK13627 carnitine operon protein CaiE; Provisional Back     alignment and domain information
>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family Back     alignment and domain information
>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>PLN02296 carbonate dehydratase Back     alignment and domain information
>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition Back     alignment and domain information
>PRK10502 putative acyl transferase; Provisional Back     alignment and domain information
>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional Back     alignment and domain information
>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>COG1043 LpxA Acyl-[acyl carrier protein] Back     alignment and domain information
>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PLN02472 uncharacterized protein Back     alignment and domain information
>TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional Back     alignment and domain information
>PRK11132 cysE serine acetyltransferase; Provisional Back     alignment and domain information
>PLN02694 serine O-acetyltransferase Back     alignment and domain information
>PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK09527 lacA galactoside O-acetyltransferase; Reviewed Back     alignment and domain information
>PRK10092 maltose O-acetyltransferase; Provisional Back     alignment and domain information
>PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine Back     alignment and domain information
>TIGR01172 cysE serine O-acetyltransferase Back     alignment and domain information
>KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton] Back     alignment and domain information
>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH Back     alignment and domain information
>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd04198 eIF-2B_gamma_N The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>COG0836 {ManC} Mannose-1-phosphate guanylyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase Back     alignment and domain information
>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates Back     alignment and domain information
>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02507 eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity Back     alignment and domain information
>TIGR01172 cysE serine O-acetyltransferase Back     alignment and domain information
>PLN02357 serine acetyltransferase Back     alignment and domain information
>PRK10191 putative acyl transferase; Provisional Back     alignment and domain information
>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form Back     alignment and domain information
>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PLN02739 serine acetyltransferase Back     alignment and domain information
>PLN02694 serine O-acetyltransferase Back     alignment and domain information
>TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>TIGR02091 glgC glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>PRK10092 maltose O-acetyltransferase; Provisional Back     alignment and domain information
>PRK10191 putative acyl transferase; Provisional Back     alignment and domain information
>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E Back     alignment and domain information
>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>PRK09527 lacA galactoside O-acetyltransferase; Reviewed Back     alignment and domain information
>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine Back     alignment and domain information
>PRK11132 cysE serine acetyltransferase; Provisional Back     alignment and domain information
>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates Back     alignment and domain information
>PLN02739 serine acetyltransferase Back     alignment and domain information
>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit Back     alignment and domain information
>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E Back     alignment and domain information
>PLN02917 CMP-KDO synthetase Back     alignment and domain information
>PLN02357 serine acetyltransferase Back     alignment and domain information
>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10502 putative acyl transferase; Provisional Back     alignment and domain information
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton] Back     alignment and domain information
>PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional Back     alignment and domain information
>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others Back     alignment and domain information
>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional Back     alignment and domain information
>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02241 glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1213 Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function Back     alignment and domain information
>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function Back     alignment and domain information
>KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others Back     alignment and domain information
>KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase [] Back     alignment and domain information
>PF00132 Hexapep: Bacterial transferase hexapeptide (six repeats); InterPro: IPR001451 A variety of bacterial transferases contain a repeat structure composed of tandem repeats of a [LIV]-G-X(4) hexapeptide, which, in the tertiary structure of LpxA (UDP N-acetylglucosamine acyltransferase) [], has been shown to form a left-handed parallel beta helix Back     alignment and domain information
>COG4801 Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>COG4801 Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>PF00132 Hexapep: Bacterial transferase hexapeptide (six repeats); InterPro: IPR001451 A variety of bacterial transferases contain a repeat structure composed of tandem repeats of a [LIV]-G-X(4) hexapeptide, which, in the tertiary structure of LpxA (UDP N-acetylglucosamine acyltransferase) [], has been shown to form a left-handed parallel beta helix Back     alignment and domain information
>cd02513 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N-acetylneuraminic acid by adding CMP moiety Back     alignment and domain information
>PRK13412 fkp bifunctional fucokinase/L-fucose-1-P-guanylyltransferase; Provisional Back     alignment and domain information
>TIGR00466 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransferase Back     alignment and domain information
>KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A Back     alignment and domain information
>COG1212 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03584 PseF pseudaminic acid CMP-transferase Back     alignment and domain information
>PRK09382 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase protein; Provisional Back     alignment and domain information
>TIGR00453 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Back     alignment and domain information
>PRK00155 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Reviewed Back     alignment and domain information
>cd02516 CDP-ME_synthetase CDP-ME synthetase is involved in mevalonate-independent isoprenoid production Back     alignment and domain information
>TIGR03310 matur_ygfJ molybdenum hydroxylase accessory protein, YgfJ family Back     alignment and domain information
>PF12804 NTP_transf_3: MobA-like NTP transferase domain; PDB: 3FWW_A 2XME_D 2XMH_C 2DPW_A 2WAW_A 2OI5_B 1HV9_B 1FWY_A 2OI6_A 2OI7_B Back     alignment and domain information
>PRK13385 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Provisional Back     alignment and domain information
>PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase [] Back     alignment and domain information
>PF00535 Glycos_transf_2: Glycosyl transferase family 2; InterPro: IPR001173 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PRK00317 mobA molybdopterin-guanine dinucleotide biosynthesis protein MobA; Reviewed Back     alignment and domain information
>COG2068 Uncharacterized MobA-related protein [General function prediction only] Back     alignment and domain information
>cd04180 UGPase_euk_like Eukaryotic UGPase-like includes UDPase and UDPGlcNAc pyrophosphorylase enzymes Back     alignment and domain information
>PLN02474 UTP--glucose-1-phosphate uridylyltransferase Back     alignment and domain information
>TIGR02665 molyb_mobA molybdopterin-guanine dinucleotide biosynthesis protein A, proteobacterial Back     alignment and domain information
>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional Back     alignment and domain information
>cd04188 DPG_synthase DPG_synthase is involved in protein N-linked glycosylation Back     alignment and domain information
>cd04182 GT_2_like_f GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function Back     alignment and domain information
>TIGR00454 conserved hypothetical protein TIGR00454 Back     alignment and domain information
>cd02503 MobA MobA catalyzes the formation of molybdopterin guanine dinucleotide Back     alignment and domain information
>PRK00560 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>cd04179 DPM_DPG-synthase_like DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily Back     alignment and domain information
>TIGR03202 pucB xanthine dehydrogenase accessory protein pucB Back     alignment and domain information
>COG2266 GTP:adenosylcobinamide-phosphate guanylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>cd00761 Glyco_tranf_GTA_type Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold Back     alignment and domain information
>COG1083 NeuA CMP-N-acetylneuraminic acid synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd06427 CESA_like_2 CESA_like_2 is a member of the cellulose synthase superfamily Back     alignment and domain information
>cd04187 DPM1_like_bac Bacterial DPM1_like enzymes are related to eukaryotic DPM1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query302
1tzf_A259 X-Ray Crystal Structure Of Alpha-D-Glucose-1-Phosph 3e-15
2ggo_A401 Crystal Structure Of Glucose-1-Phosphate Thymidylyl 7e-12
2qkx_A391 N-Acetyl Glucosamine 1-Phosphate Uridyltransferase 4e-05
3spt_A 501 Crystal Structure Of Glmu From Mycobacterium Tuberc 7e-05
3d8v_A 495 Crystal Structure Of Glmu From Mycobacterium Tuberc 7e-05
3foq_A 503 Crystal Structure Of N-Acetylglucosamine-1-Phosphat 7e-05
1lvw_A295 Crystal Structure Of Glucose-1-phosphate Thymidylyl 3e-04
>pdb|1TZF|A Chain A, X-Ray Crystal Structure Of Alpha-D-Glucose-1-Phosphate Cytidylyltransferase From Salmonella Typhi Length = 259 Back     alignment and structure

Iteration: 1

Score = 79.0 bits (193), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 51/146 (34%), Positives = 78/146 (53%), Gaps = 9/146 (6%) Query: 27 TAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKY 86 T G L + + DD E F D +++ I+FHKAHG +A++ T P ++ Sbjct: 108 TGGRLKRVAEYVKDD--EAFLFTYGDGVADLDIKATIDFHKAHGKKATLTATF--PPGRF 163 Query: 87 GVVVMEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALE 146 G + ++ G+V F EKPK G IN G ++LNP+V+D I+ T+ E+E +A + Sbjct: 164 GALDIQ--AGQVRSFQEKPKG-DGAMINGGFFVLNPSVIDLIDNDATTWEQEPLMTLAQQ 220 Query: 147 GKLFAMVLPGFWMDIGQPRD--YITG 170 G+L A PGFW + RD Y+ G Sbjct: 221 GELMAFEHPGFWQPMDTLRDKVYLEG 246
>pdb|2GGO|A Chain A, Crystal Structure Of Glucose-1-Phosphate Thymidylyltransferase From Sulfolobus Tokodaii Length = 401 Back     alignment and structure
>pdb|2QKX|A Chain A, N-Acetyl Glucosamine 1-Phosphate Uridyltransferase From Mycobacterium Tuberculosis Complex With N-Acetyl Glucosamine 1-Phosphate Length = 391 Back     alignment and structure
>pdb|3SPT|A Chain A, Crystal Structure Of Glmu From Mycobacterium Tuberculosis In Complex With Acetyl Coenzyme A And Uridine-Diphosphate-N-Acetylglucosamine Length = 501 Back     alignment and structure
>pdb|3D8V|A Chain A, Crystal Structure Of Glmu From Mycobacterium Tuberculosis In Complex With Uridine-Diphosphate-N-Acetylglucosamine Length = 495 Back     alignment and structure
>pdb|3FOQ|A Chain A, Crystal Structure Of N-Acetylglucosamine-1-Phosphate Uridyltransferase (Glmu) From Mycobacterium Tuberculosis In A Cubic Space Group Length = 503 Back     alignment and structure
>pdb|1LVW|A Chain A, Crystal Structure Of Glucose-1-phosphate Thymidylyltransferase, Rmla, Complex With Dtdp Length = 295 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query302
2xme_A232 CTP-inositol-1-phosphate cytidylyltransferase; CDP 8e-41
2ggo_A401 401AA long hypothetical glucose-1-phosphate thymid 2e-37
1jyk_A254 LICC protein, CTP:phosphocholine cytidylytransfera 4e-33
1tzf_A259 Glucose-1-phosphate cytidylyltransferase; nucleoti 7e-25
3brk_X420 Glucose-1-phosphate adenylyltransferase; ADP-gluco 9e-18
2v0h_A456 Bifunctional protein GLMU; cell WALL, magnesium, c 2e-15
1yp2_A451 Glucose-1-phosphate adenylyltransferase small subu 5e-14
3rsb_A196 Adenosylcobinamide-phosphate guanylyltransferase; 8e-13
3st8_A 501 Bifunctional protein GLMU; acetyltransferase, pyro 1e-09
3st8_A 501 Bifunctional protein GLMU; acetyltransferase, pyro 4e-08
3fs8_A 273 QDTC; acetyltransferase, natural product, deoxysug 1e-09
3fs8_A273 QDTC; acetyltransferase, natural product, deoxysug 8e-04
4fce_A459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 2e-09
4fce_A459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 2e-06
3eh0_A 341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr 1e-08
3eh0_A 341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr 2e-07
1hm9_A 468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 1e-08
1hm9_A468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 4e-08
3pmo_A 372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; 1e-08
3pmo_A 372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; 1e-07
2iu8_A 374 LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a 3e-08
2iu8_A 374 LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a 2e-07
2ux8_A297 Glucose-1-phosphate uridylyltransferase; UGPG, GAL 4e-08
2e3d_A302 UTP--glucose-1-phosphate uridylyltransferase; UDP- 1e-07
3juk_A281 UDP-glucose pyrophosphorylase (GALU); transfer; HE 4e-07
3mqg_A192 Lipopolysaccharides biosynthesis acetyltransferas; 1e-06
3mqg_A192 Lipopolysaccharides biosynthesis acetyltransferas; 6e-05
2pa4_A323 UTP-glucose-1-phosphate uridylyltransferase; phosp 2e-06
2pig_A334 Putative transferase; SCR6, NESG, YDCK, structural 6e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-06
3t57_A 305 UDP-N-acetylglucosamine O-acyltransferase domain- 1e-05
3t57_A 305 UDP-N-acetylglucosamine O-acyltransferase domain- 3e-05
3hsq_A 259 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam 3e-05
3hsq_A 259 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam 9e-05
1j2z_A 270 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 3e-05
1j2z_A 270 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 8e-05
4eqy_A 283 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 4e-05
4eqy_A 283 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 4e-05
3r0s_A 266 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 5e-05
3r0s_A 266 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 5e-05
2qia_A 262 UDP-N-acetylglucosamine acyltransferase; LEFT-hand 5e-05
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 6e-05
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 1e-04
3bfp_A194 Acetyltransferase; LEFT-handed beta helix, COA bin 9e-05
3r8y_A240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac 3e-04
>2xme_A CTP-inositol-1-phosphate cytidylyltransferase; CDP-inositol, DI-MYO-inositol phosphate; 1.89A {Archaeoglobus fulgidus} PDB: 2xmh_A* Length = 232 Back     alignment and structure
 Score =  140 bits (356), Expect = 8e-41
 Identities = 28/167 (16%), Positives = 63/167 (37%), Gaps = 16/167 (9%)

Query: 3   NFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEM 62
            FLK+       KI+     E  G    L +A++ +     + F +   D +      + 
Sbjct: 75  AFLKDK--GFNYKIVRHDRPE-KGNGYSLLVAKNHV----EDRFILTMGDHVYS---QQF 124

Query: 63  IEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGKVEKFVEKPKLFVGNKINAGIYLLNP 122
           IE      G  +    +  +  +   + +E+  G+V K  +  +    + ++ G ++L+ 
Sbjct: 125 IEKAVRGEGVIADREPRFVDIGEATKIRVED--GRVAKIGKDLRE--FDCVDTGFFVLDD 180

Query: 123 AVLDRIELRPTSIEKEVFPKIALEGKLFAMVLP-GFWMDIGQPRDYI 168
           ++ +  E +    E+    +I    +L    +    WMD+    D  
Sbjct: 181 SIFEHAE-KLRDREEIPLSEIVKLARLPVTYVDGELWMDVDTKEDVR 226


>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401 Back     alignment and structure
>1jyk_A LICC protein, CTP:phosphocholine cytidylytransferase; 3D structure, CTP:phosphocholine cytidylyltransferase; 1.50A {Streptococcus pneumoniae} SCOP: c.68.1.13 PDB: 1jyl_A* Length = 254 Back     alignment and structure
>1tzf_A Glucose-1-phosphate cytidylyltransferase; nucleotidyltransferase, mixed alpha/beta fold; HET: C5G; 2.10A {Salmonella enterica subsp} SCOP: c.68.1.13 PDB: 1wvc_A* Length = 259 Back     alignment and structure
>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Length = 420 Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Length = 456 Back     alignment and structure
>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Length = 451 Back     alignment and structure
>3rsb_A Adenosylcobinamide-phosphate guanylyltransferase; pyrophosphorylase binding motif, pyrophosphorylase; HET: GTP; 2.80A {Methanocaldococcus jannaschii} Length = 196 Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Length = 501 Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Length = 501 Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Length = 459 Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Length = 459 Back     alignment and structure
>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Length = 341 Back     alignment and structure
>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Length = 341 Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Length = 468 Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Length = 468 Back     alignment and structure
>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Length = 372 Back     alignment and structure
>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Length = 372 Back     alignment and structure
>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Length = 374 Back     alignment and structure
>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Length = 374 Back     alignment and structure
>2ux8_A Glucose-1-phosphate uridylyltransferase; UGPG, GALU pyrophosphorylase, nucleotidyltransferase; HET: G1P; 2.65A {Sphingomonas elodea} Length = 297 Back     alignment and structure
>2e3d_A UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose, carbohydrate, pyrophosphorylase; 1.95A {Escherichia coli} Length = 302 Back     alignment and structure
>3juk_A UDP-glucose pyrophosphorylase (GALU); transfer; HET: UPG; 2.30A {Helicobacter pylori} PDB: 3juj_A* Length = 281 Back     alignment and structure
>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Length = 192 Back     alignment and structure
>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Length = 192 Back     alignment and structure
>2pa4_A UTP-glucose-1-phosphate uridylyltransferase; phosphorylase, nucleotidyltransferase, metabolism; HET: GUD; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 323 Back     alignment and structure
>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Length = 334 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} Length = 305 Back     alignment and structure
>3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} Length = 305 Back     alignment and structure
>3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} PDB: 3i3a_A* 3i3x_A* Length = 259 Back     alignment and structure
>3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} PDB: 3i3a_A* 3i3x_A* Length = 259 Back     alignment and structure
>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Length = 270 Back     alignment and structure
>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Length = 270 Back     alignment and structure
>4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} Length = 283 Back     alignment and structure
>4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} Length = 283 Back     alignment and structure
>3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} Length = 266 Back     alignment and structure
>3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} Length = 266 Back     alignment and structure
>2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A Length = 262 Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Length = 220 Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Length = 220 Back     alignment and structure
>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Length = 194 Back     alignment and structure
>3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* Length = 240 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query302
1yp2_A451 Glucose-1-phosphate adenylyltransferase small subu 100.0
3brk_X420 Glucose-1-phosphate adenylyltransferase; ADP-gluco 100.0
3st8_A501 Bifunctional protein GLMU; acetyltransferase, pyro 100.0
2ggo_A401 401AA long hypothetical glucose-1-phosphate thymid 100.0
1hm9_A468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 100.0
2v0h_A456 Bifunctional protein GLMU; cell WALL, magnesium, c 99.97
4fce_A459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 99.97
3pnn_A303 Conserved domain protein; structural genomics, PSI 99.88
4ecm_A269 Glucose-1-phosphate thymidylyltransferase; HET: DA 99.88
3juk_A281 UDP-glucose pyrophosphorylase (GALU); transfer; HE 99.87
2iu8_A374 LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a 99.87
3c8v_A496 Putative acetyltransferase; YP_390128.1, structura 99.87
1fxo_A293 Glucose-1-phosphate thymidylyltransferase; rhamnos 99.82
1mc3_A296 Glucose-1-phosphate thymidylyltransferase; glucose 99.82
2e3d_A302 UTP--glucose-1-phosphate uridylyltransferase; UDP- 99.81
1lvw_A295 Glucose-1-phosphate thymidylyltransferase; protein 99.81
1tzf_A259 Glucose-1-phosphate cytidylyltransferase; nucleoti 99.8
3r8y_A240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac 99.77
2ux8_A297 Glucose-1-phosphate uridylyltransferase; UGPG, GAL 99.76
2pa4_A323 UTP-glucose-1-phosphate uridylyltransferase; phosp 99.76
4evw_A255 Nucleoside-diphosphate-sugar pyrophosphorylase; st 99.76
1xhd_A173 Putative acetyltransferase/acyltransferase; struct 99.72
3tv0_A194 Dynactin subunit 6; LEFT-handed beta-helix, ARP11, 99.71
3ixc_A191 Hexapeptide transferase family protein; niaid, ssg 99.71
3r3r_A187 Ferripyochelin binding protein; structural genomic 99.71
1v3w_A173 Ferripyochelin binding protein; beta-helix, carbon 99.7
2qh5_A308 PMI, ALGA, mannose-6-phosphate isomerase; structur 99.7
3r1w_A189 Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid 99.69
3bfp_A194 Acetyltransferase; LEFT-handed beta helix, COA bin 99.67
3vbi_A205 ANTD, galactoside O-acetyltransferase; anthrose, a 99.67
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 99.66
3oam_A252 3-deoxy-manno-octulosonate cytidylyltransferase; c 99.66
3mqg_A192 Lipopolysaccharides biosynthesis acetyltransferas; 99.63
3mqg_A192 Lipopolysaccharides biosynthesis acetyltransferas; 99.63
3kwd_A213 Carbon dioxide concentrating mechanism protein; LE 99.63
3eg4_A304 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.62
3gos_A276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.62
1qre_A247 Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth 99.62
4eqy_A 283 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.61
3bfp_A194 Acetyltransferase; LEFT-handed beta helix, COA bin 99.6
3r5d_A347 Tetrahydrodipicolinate N-succinyletransferase; 1.8 99.6
3tk8_A316 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.6
3fs8_A 273 QDTC; acetyltransferase, natural product, deoxysug 99.6
1j2z_A 270 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.59
3fsy_A332 Tetrahydrodipicolinate N-succinyltransferase; beta 99.58
4e79_A 357 UDP-3-O-acylglucosamine N-acyltransferase; lipopol 99.57
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 99.57
3r0s_A 266 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.57
3r0s_A 266 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.57
4e6u_A 265 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.57
3eh0_A 341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr 99.56
3hsq_A 259 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam 99.56
3r8y_A240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac 99.55
3pmo_A 372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; 99.55
4e6u_A 265 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.55
2qia_A262 UDP-N-acetylglucosamine acyltransferase; LEFT-hand 99.55
2x65_A336 Mannose-1-phosphate guanylyltransferase; nucleotid 99.55
3hsq_A259 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam 99.54
3tk8_A316 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.54
3pmo_A372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; 99.53
2qia_A262 UDP-N-acetylglucosamine acyltransferase; LEFT-hand 99.53
3ixc_A191 Hexapeptide transferase family protein; niaid, ssg 99.53
1j2z_A 270 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.53
3t57_A 305 UDP-N-acetylglucosamine O-acyltransferase domain- 99.53
4e79_A 357 UDP-3-O-acylglucosamine N-acyltransferase; lipopol 99.52
3eh0_A341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr 99.51
1xhd_A173 Putative acetyltransferase/acyltransferase; struct 99.51
3jqy_B252 NEUO, polysialic acid O-acetyltransferase; LEFT-ha 99.51
3fs8_A 273 QDTC; acetyltransferase, natural product, deoxysug 99.51
3gos_A276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.51
3eg4_A304 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.5
2cu2_A337 Putative mannose-1-phosphate guanylyl transferase; 99.49
2ggo_A401 401AA long hypothetical glucose-1-phosphate thymid 99.49
3tv0_A194 Dynactin subunit 6; LEFT-handed beta-helix, ARP11, 99.49
3vbi_A205 ANTD, galactoside O-acetyltransferase; anthrose, a 99.48
3t57_A 305 UDP-N-acetylglucosamine O-acyltransferase domain- 99.48
2wlg_A215 Polysialic acid O-acetyltransferase; enzyme, LEFT- 99.47
3r3r_A187 Ferripyochelin binding protein; structural genomic 99.46
3q1x_A313 Serine acetyltransferase; cysteine biosynthesis, L 99.46
2v0h_A456 Bifunctional protein GLMU; cell WALL, magnesium, c 99.45
2rij_A387 Putative 2,3,4,5-tetrahydropyridine-2-carboxylate 99.45
4fce_A459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 99.45
3r1w_A189 Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid 99.44
3tqd_A256 3-deoxy-manno-octulosonate cytidylyltransferase; c 99.44
3kwd_A213 Carbon dioxide concentrating mechanism protein; LE 99.44
1v3w_A173 Ferripyochelin binding protein; beta-helix, carbon 99.43
3nz2_A195 Hexapeptide-repeat containing-acetyltransferase; s 99.43
3srt_A188 Maltose O-acetyltransferase; structural genomics, 99.43
3k8d_A264 3-deoxy-manno-octulosonate cytidylyltransferase; K 99.43
3hjj_A190 Maltose O-acetyltransferase; LEFT-handed beta-heli 99.43
4eqy_A283 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.42
2icy_A469 Probable UTP-glucose-1-phosphate uridylyltransfera 99.42
2pig_A 334 Putative transferase; SCR6, NESG, YDCK, structural 99.41
1hm9_A468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 99.41
3ftt_A199 Putative acetyltransferase sacol2570; galactoside 99.41
2iu8_A374 LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a 99.41
1qre_A247 Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth 99.41
3c8v_A 496 Putative acetyltransferase; YP_390128.1, structura 99.39
2pig_A 334 Putative transferase; SCR6, NESG, YDCK, structural 99.39
4hur_A220 Virginiamycin A acetyltransferase; structural geno 99.37
1krr_A203 Galactoside O-acetyltransferase; LEFT-handed paral 99.36
2p2o_A185 Maltose transacetylase; GK1921, GKA001001921.1, ge 99.35
1ocx_A182 Maltose O-acetyltransferase; LEFT-handed parallel 99.35
3mc4_A287 WW/RSP5/WWP domain:bacterial transferase hexapept 99.34
3st8_A501 Bifunctional protein GLMU; acetyltransferase, pyro 99.34
3f1x_A310 Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 99.33
4fcu_A253 3-deoxy-manno-octulosonate cytidylyltransferase; s 99.3
3hjj_A190 Maltose O-acetyltransferase; LEFT-handed beta-heli 99.3
3r5d_A347 Tetrahydrodipicolinate N-succinyletransferase; 1.8 99.29
3fsy_A332 Tetrahydrodipicolinate N-succinyltransferase; beta 99.29
1jyk_A254 LICC protein, CTP:phosphocholine cytidylytransfera 99.28
2y6p_A234 3-deoxy-manno-octulosonate cytidylyltransferase; l 99.28
3jqy_B252 NEUO, polysialic acid O-acetyltransferase; LEFT-ha 99.27
3q1x_A313 Serine acetyltransferase; cysteine biosynthesis, L 99.26
1ssq_A267 SAT, serine acetyltransferase; LEFT-handed paralle 99.25
1vic_A262 3-deoxy-manno-octulosonate cytidylyltransferase; s 99.25
3nz2_A195 Hexapeptide-repeat containing-acetyltransferase; s 99.24
3ftt_A199 Putative acetyltransferase sacol2570; galactoside 99.23
1t3d_A289 SAT, serine acetyltransferase; LEFT-handed-beta-he 99.22
2wlg_A215 Polysialic acid O-acetyltransferase; enzyme, LEFT- 99.21
1yp2_A451 Glucose-1-phosphate adenylyltransferase small subu 99.2
1krr_A203 Galactoside O-acetyltransferase; LEFT-handed paral 99.19
1ocx_A182 Maltose O-acetyltransferase; LEFT-handed parallel 99.19
2rij_A387 Putative 2,3,4,5-tetrahydropyridine-2-carboxylate 99.18
2xme_A232 CTP-inositol-1-phosphate cytidylyltransferase; CDP 99.17
1ssq_A267 SAT, serine acetyltransferase; LEFT-handed paralle 99.16
3mc4_A287 WW/RSP5/WWP domain:bacterial transferase hexapept 99.16
3f1x_A310 Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 99.16
3srt_A188 Maltose O-acetyltransferase; structural genomics, 99.14
1t3d_A289 SAT, serine acetyltransferase; LEFT-handed-beta-he 99.13
3eev_A212 Chloramphenicol acetyltransferase; beta-helix, str 99.12
2p2o_A185 Maltose transacetylase; GK1921, GKA001001921.1, ge 99.12
3brk_X420 Glucose-1-phosphate adenylyltransferase; ADP-gluco 99.07
4e8l_A219 Virginiamycin A acetyltransferase; structural geno 99.05
1h7e_A245 3-deoxy-manno-octulosonate cytidylyltransferase; n 99.05
4hur_A220 Virginiamycin A acetyltransferase; structural geno 99.01
1mr7_A209 Streptogramin A acetyltransferase; LEFT-handed par 98.99
2i5k_A488 UTP--glucose-1-phosphate uridylyltransferase; LEFT 98.9
1xat_A212 Xenobiotic acetyltransferase; chloramphenicol, LEF 98.84
3eev_A212 Chloramphenicol acetyltransferase; beta-helix, str 98.82
4e8l_A219 Virginiamycin A acetyltransferase; structural geno 98.74
1mr7_A209 Streptogramin A acetyltransferase; LEFT-handed par 98.72
2dpw_A232 Hypothetical protein TTHA0179; transferase, struct 98.7
1jv1_A505 Glcnac1P uridyltransferase isoform 1: AGX1; nucleo 98.7
1ezi_A228 CMP-N-acetylneuraminic acid synthetase; homodimer, 98.66
1xat_A212 Xenobiotic acetyltransferase; chloramphenicol, LEF 98.62
1qwj_A229 Cytidine monophospho-N-acetylneuraminic acid synth 98.42
2xwl_A223 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; 98.35
2vsh_A236 TARI, 2-C-methyl-D-erythritol 4-phosphate cytidyly 98.13
2yc3_A228 2-C-methyl-D-erythritol 4-phosphate cytidylyltran 97.93
3f1c_A246 Putative 2-C-methyl-D-erythritol 4-phosphate cytid 97.83
2oeg_A505 UTP-glucose-1-phosphate uridylyltransferase 2, put 97.81
1vgw_A231 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; 97.74
2waw_A199 MOBA relate protein; unknown function; HET: PGE; 1 97.63
3oc9_A405 UDP-N-acetylglucosamine pyrophosphorylase; structu 97.61
2wee_A197 MOBA-related protein; unknown function; 1.65A {Myc 97.35
3rsb_A196 Adenosylcobinamide-phosphate guanylyltransferase; 97.3
2yqc_A486 UDP-N-acetylglucosamine pyrophosphorylase; uridine 97.23
2px7_A236 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 97.19
1vpa_A234 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; 97.17
2e8b_A201 Probable molybdopterin-guanine dinucleotide biosy 97.08
1i52_A236 4-diphosphocytidyl-2-C-methylerythritol synthase; 96.79
3d5n_A197 Q97W15_sulso; NESG, SSR125, structural genomics, P 96.24
1e5k_A201 Molybdopterin-guanine dinucleotide biosynthesis pr 95.26
3q80_A231 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; 94.95
3ngw_A208 Molybdopterin-guanine dinucleotide biosynthesis P 94.42
1w55_A371 ISPD/ISPF bifunctional enzyme; biosynthetic pathwa 90.82
1xhb_A472 Polypeptide N-acetylgalactosaminyltransferase 1; g 84.24
>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Back     alignment and structure
Probab=100.00  E-value=3.9e-35  Score=271.95  Aligned_cols=264  Identities=19%  Similarity=0.307  Sum_probs=204.1

Q ss_pred             CCCChHHHHHcHhhhccCCCCcEEEEeCCeecCcCHHHHHHHHHHcCCcEEEEEEeCC--CCCCcceEEEeCCCCcEEEE
Q 022113           24 PLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVD--EPSKYGVVVMEESTGKVEKF  101 (302)
Q Consensus        24 ~~Gt~~al~~a~~~i~~~~~~~~lv~~gD~l~~~~l~~~~~~~~~~~~~~~l~~~~~~--~~~~~g~v~~d~~~~~v~~~  101 (302)
                      ++||+++|+.+++++.....++|++++||++++.++.++++.|+++++++|+++.+.+  ++..||++.+|+ +++++.|
T Consensus       117 ~~Gt~~al~~a~~~~~~~~~~~~lv~~~D~~~~~~l~~l~~~~~~~~~~~tl~~~~~~~~~~~~~g~v~~d~-~~~v~~~  195 (451)
T 1yp2_A          117 FQGTADAVRQYLWLFEEHTVLEYLILAGDHLYRMDYEKFIQAHRETDADITVAALPMDEKRATAFGLMKIDE-EGRIIEF  195 (451)
T ss_dssp             CCSHHHHHHHTHHHHTTSCCSEEEEECSCEECCCCHHHHHHHHHHTTCSEEEEEEEECHHHHTTSEEEEECT-TSBEEEE
T ss_pred             ccCcHHHHHHHHHHHHhcCCCeEEEecCcEEEcCCHHHHHHHHHHcCCcEEEEEEEcChhhcccCCEEEECC-CCCEEEE
Confidence            5899999999999885322378999999999999999999999998889998888764  567899999985 7899999


Q ss_pred             EecCCCC---------------------CCCeEEEEEEEeCHhhH-hhccC---CCCCccccchHHHHhc-CcEEEEEec
Q 022113          102 VEKPKLF---------------------VGNKINAGIYLLNPAVL-DRIEL---RPTSIEKEVFPKIALE-GKLFAMVLP  155 (302)
Q Consensus       102 ~ekp~~~---------------------~~~~~~~Giy~~~~~~l-~~l~~---~~~~~~~~~~~~l~~~-~~v~~~~~~  155 (302)
                      .|||...                     ...++++|+|+|++++| +.++.   ...++..++++.++++ .++.++.++
T Consensus       196 ~ekp~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~Giy~~~~~~l~~~l~~~~~~~~~~~~~~l~~~i~~g~~v~~~~~~  275 (451)
T 1yp2_A          196 AEKPQGEQLQAMKVDTTILGLDDKRAKEMPFIASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPGATSLGMRVQAYLYD  275 (451)
T ss_dssp             EESCCHHHHHHTCCCGGGGSCCHHHHHHCCEEEEEEEEEEEHHHHHHHHHTTCTTCCCTTTTHHHHHHHTTCCEEEEECC
T ss_pred             EECCCchhhccccccccccccccccccCCcceEEeeEEEEcHHHHHHHHHhhcccccchHhhHHHHHHhcCCceEEEEeC
Confidence            9999632                     24689999999999987 44443   2234555778887776 689999999


Q ss_pred             CeeEecCChHHHHHHHHHHHHhhcc-----cc------ccccccCceEecceEEcCCcEECCCCEECC----CcEECCCC
Q 022113          156 GFWMDIGQPRDYITGLRLYLDSLRK-----KS------SLKLATGANIVGNVLVHESAQIGEGCLIGP----DVAVGPGC  220 (302)
Q Consensus       156 g~~~digt~~~~~~a~~~~l~~~~~-----~~------~~~~~~~~~i~~~~~i~~~~~i~~~~~i~~----~~~ig~~~  220 (302)
                      ++|.|+++|++|.++++.+++....     ..      .+.+.+++.+ +++.| .++.||++|.|++    +++||++|
T Consensus       276 ~~w~digt~~~l~~a~~~l~~~~~~~~~~~~~~~~i~~~~~i~~~~~i-~~~~I-~~~~Ig~~~~I~~~~i~~~~Ig~~~  353 (451)
T 1yp2_A          276 GYWEDIGTIEAFYNANLGITKKPVPDFSFYDRSAPIYTQPRYLPPSKM-LDADV-TDSVIGEGCVIKNCKIHHSVVGLRS  353 (451)
T ss_dssp             SCCEECSSHHHHHHHHHGGGCSSSCSSCSCCSSSCCCCCCCCCCCEEE-EEEEE-EEEEECTTCEEEEEEEESCEECTTC
T ss_pred             CEEEECCCHHHHHHHHHHHhcccccchhccCCCCeeccCCccCCCeEE-cceEE-eCeEECCCCEEcceEEeccEECCCC
Confidence            9999999999999998876543311     01      1223333333 22333 3455566665554    88999999


Q ss_pred             EECCCcEEeceEEccC-------------------CEECCCcEEeccEECCCCEECCCcEEccCc------EECCCcEEC
Q 022113          221 VVESGVRLSRCTVMRG-------------------VRIKKHACISSSIIGWHSTVGQWARVENMT------ILGEDVHVC  275 (302)
Q Consensus       221 ~i~~~~~i~~~~i~~~-------------------~~i~~~~~i~~~~i~~~~~i~~~~~i~~~~------~i~~~~~v~  275 (302)
                      .||++|.|.++++..+                   +.||+++.|++++|+++|+||+++.|.+++      .||+++.||
T Consensus       354 ~Ig~~~~I~~~~~~~~~~~~~~~~~~~~~~~g~~~~~Ig~~~~i~~~~Ig~~~~IG~~~~i~~~~~~~~~~~ig~~~~ig  433 (451)
T 1yp2_A          354 CISEGAIIEDSLLMGADYYETDADRKLLAAKGSVPIGIGKNCHIKRAIIDKNARIGDNVKIINKDNVQEAARETDGYFIK  433 (451)
T ss_dssp             EECTTCEEESCEECCCSSCCCHHHHHHHHTTTCCCSEECTTCEEESEEECTTCEECTTCEECCSSCCSCEEEGGGTEEEE
T ss_pred             EECCCCEEcCceEECCCCcccccccccccccCceeEEECCCCEEeccEeCCCcEECCCCEEeCCcccccCceeCCCEEEc
Confidence            9999999998888877                   999999999999999999999999998653      567777777


Q ss_pred             Cce-EEcCCeEecCcc
Q 022113          276 DEI-YSNGGVVLPHKE  290 (302)
Q Consensus       276 ~~~-~v~~~~v~~~~~  290 (302)
                      +++ .|++++++++..
T Consensus       434 ~~~v~Ig~~a~i~ags  449 (451)
T 1yp2_A          434 SGIVTVIKDALIPSGI  449 (451)
T ss_dssp             TTEEEECTTCEECTTC
T ss_pred             CCEEEECCCcEECCCc
Confidence            764 467777776654



>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Back     alignment and structure
>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Back     alignment and structure
>3pnn_A Conserved domain protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: MSE GOL; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>4ecm_A Glucose-1-phosphate thymidylyltransferase; HET: DAU; 2.30A {Bacillus anthracis} PDB: 3hl3_A* Back     alignment and structure
>3juk_A UDP-glucose pyrophosphorylase (GALU); transfer; HET: UPG; 2.30A {Helicobacter pylori} PDB: 3juj_A* Back     alignment and structure
>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Back     alignment and structure
>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>1fxo_A Glucose-1-phosphate thymidylyltransferase; rhamnose, nucleotidyltransferase, pyrophosphorylase, allostery; HET: TMP; 1.66A {Pseudomonas aeruginosa} SCOP: c.68.1.6 PDB: 1fzw_A 1g0r_A* 1g1l_A* 1g23_A* 1g2v_A* 1g3l_A* 1h5r_A* 1h5s_C* 1h5t_A* 1h5s_D* 1h5s_A* 1h5r_B* 1h5s_B* 1h5t_B* 1iim_A* 1iin_A* 3pkp_A* 3pkq_A* 1mp5_A* 1mp3_A* ... Back     alignment and structure
>1mc3_A Glucose-1-phosphate thymidylyltransferase; glucose-1-phosphate thymidylytransferase, RFFH; HET: TTP; 2.60A {Escherichia coli} SCOP: c.68.1.6 Back     alignment and structure
>2e3d_A UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose, carbohydrate, pyrophosphorylase; 1.95A {Escherichia coli} Back     alignment and structure
>1lvw_A Glucose-1-phosphate thymidylyltransferase; protein nucleotide complex, nucleotide binding fold; HET: TYD; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.68.1.6 Back     alignment and structure
>1tzf_A Glucose-1-phosphate cytidylyltransferase; nucleotidyltransferase, mixed alpha/beta fold; HET: C5G; 2.10A {Salmonella enterica subsp} SCOP: c.68.1.13 PDB: 1wvc_A* Back     alignment and structure
>3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* Back     alignment and structure
>2ux8_A Glucose-1-phosphate uridylyltransferase; UGPG, GALU pyrophosphorylase, nucleotidyltransferase; HET: G1P; 2.65A {Sphingomonas elodea} Back     alignment and structure
>2pa4_A UTP-glucose-1-phosphate uridylyltransferase; phosphorylase, nucleotidyltransferase, metabolism; HET: GUD; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4evw_A Nucleoside-diphosphate-sugar pyrophosphorylase; structural genomics, PSI-biology; HET: MSE; 1.90A {Vibrio cholerae} Back     alignment and structure
>1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A Back     alignment and structure
>3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} Back     alignment and structure
>3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} Back     alignment and structure
>3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A Back     alignment and structure
>1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A Back     alignment and structure
>2qh5_A PMI, ALGA, mannose-6-phosphate isomerase; structural genomics, PSI, protein structure initi nysgrc; 2.30A {Helicobacter pylori} Back     alignment and structure
>3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} Back     alignment and structure
>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Back     alignment and structure
>3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Back     alignment and structure
>3oam_A 3-deoxy-manno-octulosonate cytidylyltransferase; center for structural genomics of infectious diseases; 1.75A {Vibrio cholerae o1 biovar el tor} SCOP: c.68.1.13 Back     alignment and structure
>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Back     alignment and structure
>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Back     alignment and structure
>3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A Back     alignment and structure
>3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} Back     alignment and structure
>3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A Back     alignment and structure
>1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A Back     alignment and structure
>4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} Back     alignment and structure
>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Back     alignment and structure
>3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A Back     alignment and structure
>3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Back     alignment and structure
>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Back     alignment and structure
>3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* Back     alignment and structure
>4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Back     alignment and structure
>3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 Back     alignment and structure
>3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 Back     alignment and structure
>4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* Back     alignment and structure
>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Back     alignment and structure
>3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* Back     alignment and structure
>3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* Back     alignment and structure
>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Back     alignment and structure
>4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* Back     alignment and structure
>2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A Back     alignment and structure
>2x65_A Mannose-1-phosphate guanylyltransferase; nucleotidyltransferase; HET: M1P; 2.10A {Thermotoga maritima} PDB: 2x5z_A* 2x60_A* 2x5s_A* Back     alignment and structure
>3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* Back     alignment and structure
>3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} Back     alignment and structure
>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A Back     alignment and structure
>3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} Back     alignment and structure
>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Back     alignment and structure
>3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A Back     alignment and structure
>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Back     alignment and structure
>1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A Back     alignment and structure
>3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Back     alignment and structure
>3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A Back     alignment and structure
>3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} Back     alignment and structure
>2cu2_A Putative mannose-1-phosphate guanylyl transferase; mannose-1-phosphate geranyltransferase, thermus thermophilus structural genomics; 2.20A {Thermus thermophilus} SCOP: b.81.4.1 c.68.1.20 Back     alignment and structure
>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Back     alignment and structure
>3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} Back     alignment and structure
>3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Back     alignment and structure
>3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* Back     alignment and structure
>3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A Back     alignment and structure
>3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Back     alignment and structure
>2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Back     alignment and structure
>3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} Back     alignment and structure
>3tqd_A 3-deoxy-manno-octulosonate cytidylyltransferase; cell envelope; 1.80A {Coxiella burnetii} SCOP: c.68.1.0 Back     alignment and structure
>3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A Back     alignment and structure
>1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A Back     alignment and structure
>3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* Back     alignment and structure
>3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* Back     alignment and structure
>3k8d_A 3-deoxy-manno-octulosonate cytidylyltransferase; KDSB synthetase KDO complex, lipopolysaccharide biosynthesis magnesium, nucleotidyltransferase; HET: KDO CTP; 1.90A {Escherichia coli} SCOP: c.68.1.13 PDB: 3k8e_C 1vh1_A 3jtj_A* Back     alignment and structure
>3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* Back     alignment and structure
>4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} Back     alignment and structure
>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Back     alignment and structure
>3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A Back     alignment and structure
>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Back     alignment and structure
>1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A Back     alignment and structure
>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Back     alignment and structure
>4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A Back     alignment and structure
>1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* Back     alignment and structure
>2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A Back     alignment and structure
>1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 Back     alignment and structure
>3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Back     alignment and structure
>3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>4fcu_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.90A {Acinetobacter baumannii} PDB: 3pol_A Back     alignment and structure
>3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* Back     alignment and structure
>3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A Back     alignment and structure
>3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* Back     alignment and structure
>1jyk_A LICC protein, CTP:phosphocholine cytidylytransferase; 3D structure, CTP:phosphocholine cytidylyltransferase; 1.50A {Streptococcus pneumoniae} SCOP: c.68.1.13 PDB: 1jyl_A* Back     alignment and structure
>2y6p_A 3-deoxy-manno-octulosonate cytidylyltransferase; lipid A; HET: CTP; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} Back     alignment and structure
>3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A Back     alignment and structure
>1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* Back     alignment and structure
>1vic_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics; 1.80A {Haemophilus influenzae} SCOP: c.68.1.13 PDB: 1vh3_A 3duv_A* Back     alignment and structure
>3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* Back     alignment and structure
>3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A Back     alignment and structure
>1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 Back     alignment and structure
>2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* Back     alignment and structure
>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Back     alignment and structure
>1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* Back     alignment and structure
>1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 Back     alignment and structure
>2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} Back     alignment and structure
>2xme_A CTP-inositol-1-phosphate cytidylyltransferase; CDP-inositol, DI-MYO-inositol phosphate; 1.89A {Archaeoglobus fulgidus} PDB: 2xmh_A* Back     alignment and structure
>1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* Back     alignment and structure
>3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} Back     alignment and structure
>3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* Back     alignment and structure
>1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 Back     alignment and structure
>3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 Back     alignment and structure
>2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A Back     alignment and structure
>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Back     alignment and structure
>4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} Back     alignment and structure
>1h7e_A 3-deoxy-manno-octulosonate cytidylyltransferase; nucleotidyltransferase, CMP-KDO synthetase, nucleoside monophosphate glycosides; 1.83A {Escherichia coli} SCOP: c.68.1.13 PDB: 1gqc_A* 1gq9_A 1h6j_A 1h7f_A* 1h7g_A* 1h7h_A* 1h7t_A* Back     alignment and structure
>4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A Back     alignment and structure
>1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* Back     alignment and structure
>2i5k_A UTP--glucose-1-phosphate uridylyltransferase; LEFT-handed beta-helix, SGC domain; 3.10A {Saccharomyces cerevisiae} Back     alignment and structure
>1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* Back     alignment and structure
>3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 Back     alignment and structure
>4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} Back     alignment and structure
>1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* Back     alignment and structure
>2dpw_A Hypothetical protein TTHA0179; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 2.90A {Thermus thermophilus} SCOP: c.68.1.19 Back     alignment and structure
>1jv1_A Glcnac1P uridyltransferase isoform 1: AGX1; nucleotidyltransferase, alternative splicing; HET: UD1; 1.90A {Homo sapiens} SCOP: c.68.1.5 PDB: 1jv3_A* 1jvg_A* 1jvd_A* 1vm8_A* Back     alignment and structure
>1ezi_A CMP-N-acetylneuraminic acid synthetase; homodimer, alpha-beta-alpha, transferase; 2.00A {Neisseria meningitidis} SCOP: c.68.1.13 PDB: 1eyr_A Back     alignment and structure
>1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* Back     alignment and structure
>1qwj_A Cytidine monophospho-N-acetylneuraminic acid synthetase; CMP-5-N-acetylneuraminic acid synthetase, CMP-NEU5AC, sialic acid, glycosylation; HET: NCC; 2.80A {Mus musculus} SCOP: c.68.1.13 Back     alignment and structure
>2xwl_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; transferase, MEP pathway; HET: CTP; 1.49A {Mycobacterium smegmatis} PDB: 2xwm_A* Back     alignment and structure
>2vsh_A TARI, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; nucleotidyltransferase; HET: 1PE PG4 P6G; 2.00A {Streptococcus pneumoniae} PDB: 2vsi_A* Back     alignment and structure
>2yc3_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran chloroplastic; transferase, non-mevalonate-pathway, herbicide, allosteric P; HET: MW5; 1.40A {Arabidopsis thaliana} PDB: 2yc5_A* 1w77_A* 2ycm_A* Back     alignment and structure
>3f1c_A Putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 2; structural genomics, PSI-2, protein structure initiative; 2.30A {Listeria monocytogenes str} SCOP: c.68.1.0 Back     alignment and structure
>2oeg_A UTP-glucose-1-phosphate uridylyltransferase 2, putative; rossmann-fold, beta-helix, pyrophosphorylase; HET: UPG; 2.30A {Leishmania major} PDB: 2oef_A* Back     alignment and structure
>1vgw_A 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; structural genomics, transferase; 2.35A {Neisseria gonorrhoeae} SCOP: c.68.1.13 PDB: 1vgz_A Back     alignment and structure
>2waw_A MOBA relate protein; unknown function; HET: PGE; 1.60A {Mycobacterium SP} Back     alignment and structure
>3oc9_A UDP-N-acetylglucosamine pyrophosphorylase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.80A {Entamoeba histolytica} Back     alignment and structure
>2wee_A MOBA-related protein; unknown function; 1.65A {Mycobacterium tuberculosis H37RV} PDB: 2we9_A 2yes_A Back     alignment and structure
>3rsb_A Adenosylcobinamide-phosphate guanylyltransferase; pyrophosphorylase binding motif, pyrophosphorylase; HET: GTP; 2.80A {Methanocaldococcus jannaschii} Back     alignment and structure
>2yqc_A UDP-N-acetylglucosamine pyrophosphorylase; uridine-diphospho-N- acetylglucosamine, N-acetylglucosamine-1-phosphate, transferase; 1.90A {Candida albicans} PDB: 2yqh_A* 2yqj_A* 2yqs_A* Back     alignment and structure
>2px7_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; TTHA0171, ISPD_THET8, ISPD, structural genomics PSI; 2.20A {Thermus thermophilus HB8} Back     alignment and structure
>1vpa_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; TM1393, JCSG, joint center for structural GENO PSI, protein structure initiative; HET: CTP; 2.67A {Thermotoga maritima} SCOP: c.68.1.13 Back     alignment and structure
>2e8b_A Probable molybdopterin-guanine dinucleotide biosy protein A; putative protein, molybdenum cofactor, structural G NPPSFA; 1.61A {Aquifex aeolicus} Back     alignment and structure
>1i52_A 4-diphosphocytidyl-2-C-methylerythritol synthase; cytidylyltransferase, deoxyxylulose-5-phosphate pathway (DXP isoprenoid biosynthesys, MEP; HET: CTP; 1.50A {Escherichia coli} SCOP: c.68.1.13 PDB: 1ini_A* 1inj_A 1vgt_A 1vgu_A 3n9w_A 1h3m_A Back     alignment and structure
>3d5n_A Q97W15_sulso; NESG, SSR125, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.80A {Sulfolobus solfataricus} Back     alignment and structure
>1e5k_A Molybdopterin-guanine dinucleotide biosynthesis protein A; molybdopterin nucleotidyl-transferase,; HET: CIT; 1.35A {Escherichia coli} SCOP: c.68.1.8 PDB: 1h4e_A* 1hjl_A* 1hjj_A* 1h4c_A* 1h4d_A* 1fr9_A 1frw_A* Back     alignment and structure
>3q80_A 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; TB structural genomics consortium, TBSGC, rossman fold; HET: CDM; 2.00A {Mycobacterium tuberculosis} SCOP: c.68.1.0 PDB: 3q7u_A* 3okr_A 2xwn_A* Back     alignment and structure
>3ngw_A Molybdopterin-guanine dinucleotide biosynthesis P (MOBA); alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.31A {Archaeoglobus fulgidus} Back     alignment and structure
>1w55_A ISPD/ISPF bifunctional enzyme; biosynthetic pathway, isoprenoids, nonmevalonate, transferase; HET: C GPP; 2.3A {Campylobacter jejuni} SCOP: c.68.1.13 d.79.5.1 PDB: 1w57_A* Back     alignment and structure
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 302
d1mc3a_291 c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} 2e-28
d1fxoa_292 c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa 4e-27
d1lvwa_295 c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacteri 3e-22
d1tzfa_259 c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransf 1e-15
d1yp2a2307 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltr 2e-15
d1fxja178 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha 2e-10
d1fxja178 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha 7e-04
d2jf2a1 262 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltra 2e-07
d2jf2a1 262 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltra 1e-04
d2f9ca1 320 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salm 2e-07
d2f9ca1 320 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salm 2e-06
d2f9ca1 320 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salm 5e-06
d2f9ca1 320 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salm 0.004
d1j2za_ 259 b.81.1.1 (A:) UDP N-acetylglucosamine acyltransfer 2e-07
d1g97a2250 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate 0.002
d2oi6a1201 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phospha 0.002
d2oi6a1201 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phospha 0.003
d1v3wa_173 b.81.1.5 (A:) Ferripyochelin binding protein {Arch 0.004
d1g97a1196 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phospha 0.004
>d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} Length = 291 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: glucose-1-phosphate thymidylyltransferase
domain: RffH
species: Escherichia coli [TaxId: 562]
 Score =  108 bits (271), Expect = 2e-28
 Identities = 36/184 (19%), Positives = 71/184 (38%), Gaps = 11/184 (5%)

Query: 11  KLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHG 70
           + GI++  +++  P G A    +    L  +      VL  ++     F+  +    A  
Sbjct: 71  EFGIQLEYAEQPSPDGLAQAFIIGETFLNGE--PSCLVLGDNIFFGQGFSPKLRHVAART 128

Query: 71  GEASIMVTKVDEPSKYGVVVMEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIEL 130
             A++   +V +P ++GVV  ++   +     EKPK    N    G+Y  +  V++  + 
Sbjct: 129 EGATVFGYQVMDPERFGVVEFDD-NFRAISLEEKPKQPKSNWAVTGLYFYDSKVVEYAKQ 187

Query: 131 RPTSIEKE-----VFPKIALEGKLFAMVLP--GFWMDIGQPRDYITGLRLYLDSLRKKSS 183
              S   E     +       G L   +L     W+D G     I     ++ ++ K+  
Sbjct: 188 VKPSERGELEITSINQMYLEAGNLTVELLGRGFAWLDTGTHDSLIEAST-FVQTVEKRQG 246

Query: 184 LKLA 187
            K+A
Sbjct: 247 FKIA 250


>d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure
>d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 295 Back     information, alignment and structure
>d1tzfa_ c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium [TaxId: 90371]} Length = 259 Back     information, alignment and structure
>d1yp2a2 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 307 Back     information, alignment and structure
>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 Back     information, alignment and structure
>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 Back     information, alignment and structure
>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Length = 262 Back     information, alignment and structure
>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Length = 262 Back     information, alignment and structure
>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Length = 320 Back     information, alignment and structure
>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Length = 320 Back     information, alignment and structure
>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Length = 320 Back     information, alignment and structure
>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Length = 320 Back     information, alignment and structure
>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Length = 259 Back     information, alignment and structure
>d1g97a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 250 Back     information, alignment and structure
>d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 201 Back     information, alignment and structure
>d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 201 Back     information, alignment and structure
>d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 173 Back     information, alignment and structure
>d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 196 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query302
d1fxoa_292 RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} 99.94
d1mc3a_291 RffH {Escherichia coli [TaxId: 562]} 99.94
d1lvwa_295 RmlA (RfbA) {Archaeon Methanobacterium thermoautot 99.83
d1yp2a2307 Glucose-1-phosphate adenylyltransferase small subu 99.76
d3bswa1193 Acetyltransferase PglD {Campylobacter jejuni [TaxI 99.66
d2cu2a2268 Putative mannose-1-phosphate guanylyl transferase 99.65
d1j2za_ 259 UDP N-acetylglucosamine acyltransferase {Helicobac 99.61
d1fxja178 N-acetylglucosamine 1-phosphate uridyltransferase 99.61
d1qrea_210 gamma-carbonic anhydrase {Archaeon Methanosarcina 99.59
d1xhda_172 Putative acetyltransferase/acyltransferase BC4754 99.58
d3bswa1193 Acetyltransferase PglD {Campylobacter jejuni [TaxI 99.56
d2jf2a1 262 UDP N-acetylglucosamine acyltransferase {Escherich 99.56
d2jf2a1262 UDP N-acetylglucosamine acyltransferase {Escherich 99.56
d1tzfa_259 Glucose-1-phosphate cytidylyltransferase RfbF {Sal 99.53
d1krra_200 Galactoside acetyltransferase {Escherichia coli [T 99.48
d1v3wa_173 Ferripyochelin binding protein {Archaeon Pyrococcu 99.48
d1fxja178 N-acetylglucosamine 1-phosphate uridyltransferase 99.46
d3tdta_274 Tetrahydrodipicolinate-N-succinlytransferase, THDP 99.45
d1j2za_259 UDP N-acetylglucosamine acyltransferase {Helicobac 99.44
d1g97a1196 N-acetylglucosamine 1-phosphate uridyltransferase 99.42
d1xhda_172 Putative acetyltransferase/acyltransferase BC4754 99.4
d1qrea_210 gamma-carbonic anhydrase {Archaeon Methanosarcina 99.39
d1ocxa_182 Maltose O-acetyltransferase {Escherichia coli [Tax 99.39
d1g97a1196 N-acetylglucosamine 1-phosphate uridyltransferase 99.38
d1yp2a1135 Glucose-1-phosphate adenylyltransferase small subu 99.37
d1jyka_229 CTP:phosphocholine cytidylytransferase LicC {Strep 99.32
d1v3wa_173 Ferripyochelin binding protein {Archaeon Pyrococcu 99.32
d1yp2a1135 Glucose-1-phosphate adenylyltransferase small subu 99.29
d1g97a2250 N-acetylglucosamine 1-phosphate uridyltransferase 99.28
d1mr7a_203 Xenobiotic acetyltransferase {Enterococcus faecium 99.28
d3tdta_274 Tetrahydrodipicolinate-N-succinlytransferase, THDP 99.2
d2oi6a1201 N-acetylglucosamine 1-phosphate uridyltransferase 99.19
d1ocxa_182 Maltose O-acetyltransferase {Escherichia coli [Tax 99.18
d1krra_200 Galactoside acetyltransferase {Escherichia coli [T 99.15
d2oi6a1201 N-acetylglucosamine 1-phosphate uridyltransferase 99.1
d1ssqa_241 Serine acetyltransferase {Haemophilus influenzae [ 99.05
d1xata_208 Xenobiotic acetyltransferase {Pseudomonas aerugino 99.0
d1ssqa_241 Serine acetyltransferase {Haemophilus influenzae [ 98.8
d1mr7a_203 Xenobiotic acetyltransferase {Enterococcus faecium 98.75
d2f9ca1 320 Hypothetical protein YdcK {Salmonella enterica [Ta 98.72
d2oi6a2248 N-acetylglucosamine 1-phosphate uridyltransferase 98.71
d2f9ca1 320 Hypothetical protein YdcK {Salmonella enterica [Ta 98.64
d1xata_208 Xenobiotic acetyltransferase {Pseudomonas aerugino 98.59
d1h7ea_245 CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn 97.46
d1vica_255 CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn 97.24
d1vh1a_246 CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn 97.15
d1eyra_225 CMP acylneuraminate synthetase {Neisseria meningit 94.23
d1vpaa_221 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 93.36
d1w77a1226 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 93.11
d2icya2378 UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale c 92.84
d1vgwa_226 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 88.06
d1xhba2328 Polypeptide N-acetylgalactosaminyltransferase 1, N 87.85
d1i52a_225 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 86.09
>d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: glucose-1-phosphate thymidylyltransferase
domain: RmlA (RfbA)
species: Pseudomonas aeruginosa [TaxId: 287]
Probab=99.94  E-value=1.6e-26  Score=198.51  Aligned_cols=168  Identities=21%  Similarity=0.328  Sum_probs=143.5

Q ss_pred             hHHHHHhhcCCcEEEEEecCCCCCChHHHHHcHhhhccCCCCcEEEEeCCeecCcCHHHHHHHHHHcCCcEEEEEEeCCC
Q 022113            3 NFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDE   82 (302)
Q Consensus         3 ~~~~~~~~~~g~~i~~~~~~~~~Gt~~al~~a~~~i~~~~~~~~lv~~gD~l~~~~l~~~~~~~~~~~~~~~l~~~~~~~   82 (302)
                      +++++ ++++|++|+|+.|++++|||+|+++|.+++++  ++.|+++++|++++.|+.++++.|.++.+.+++.+.++++
T Consensus        64 ~~~~~-~~~~g~~I~y~~q~~~~Gta~ai~~a~~~i~~--~~~~lil~dD~~~~~dl~~ll~~h~~~~~~~~i~~~~V~~  140 (292)
T d1fxoa_          64 QLLGD-GSNWGLDLQYAVQPSPDGLAQAFLIGESFIGN--DLSALVLGDNLYYGHDFHELLGSASQRQTGASVFAYHVLD  140 (292)
T ss_dssp             HHHTT-SGGGTCEEEEEECSSCCCGGGHHHHTHHHHTT--SEEEEEETTEEEECTTHHHHHHHHHTCCSSEEEEEEECSC
T ss_pred             HHhcc-ccccCeEEEEccCCCCCcHHHHHHhhhhhcCC--CceEEEEccccccCcCHHHHHHHHHhCCCCcEEEEEECCC
Confidence            45555 56789999999999999999999999999975  2455777888899999999999999999999999999999


Q ss_pred             CCCcceEEEeCCCCcEEEEEecCCCCCCCeEEEEEEEeCHhhHhhccCCCCCcc-----ccchHHHHhcCcEEEEEec-C
Q 022113           83 PSKYGVVVMEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIE-----KEVFPKIALEGKLFAMVLP-G  156 (302)
Q Consensus        83 ~~~~g~v~~d~~~~~v~~~~ekp~~~~~~~~~~Giy~~~~~~l~~l~~~~~~~~-----~~~~~~l~~~~~v~~~~~~-g  156 (302)
                      |.+||++.+|+ +++++.|.|||..+.++++++|+|+|++++++.+..-..+..     .++++.+++++++.++.+. |
T Consensus       141 p~~yGV~~~d~-~~ki~~~~EKP~~p~Snla~~G~Y~f~~~~~~~~~~l~~s~rgE~eitD~~~~~l~~~~~~~~~~~~~  219 (292)
T d1fxoa_         141 PERYGVVEFDQ-GGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRG  219 (292)
T ss_dssp             GGGSEEEEECT-TSCEEEEEESCSSCSSSEEEEEEEEECTTHHHHHHHCCCCTTSSCCHHHHHHHHHHTTCEEEEECCTT
T ss_pred             HHHCeEEEEcC-CCCEeEEEECCCCCCCCcEEEEEEEEChHHHHHHHhCCCCCCCchhhHHHHHHHHHcCCeEEEEeCCC
Confidence            99999999986 899999999999999999999999999999877753333333     3456778888888877763 3


Q ss_pred             -eeEecCChHHHHHHHHHH
Q 022113          157 -FWMDIGQPRDYITGLRLY  174 (302)
Q Consensus       157 -~~~digt~~~~~~a~~~~  174 (302)
                       +|+|+||+++|++|....
T Consensus       220 ~~W~D~Gt~~~l~~a~~~v  238 (292)
T d1fxoa_         220 YAWLDTGTHDSLLEAGQFI  238 (292)
T ss_dssp             SEEEECCSHHHHHHHHHHH
T ss_pred             CEEEeCCCHHHHHHHHHHH
Confidence             699999999999998754



>d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1yp2a2 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2cu2a2 c.68.1.20 (A:1-268) Putative mannose-1-phosphate guanylyl transferase (GDP)/mannose-6-phosphate isomerase TTHA1750 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} Back     information, alignment and structure
>d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Back     information, alignment and structure
>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Back     information, alignment and structure
>d1tzfa_ c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} Back     information, alignment and structure
>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} Back     information, alignment and structure
>d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1jyka_ c.68.1.13 (A:) CTP:phosphocholine cytidylytransferase LicC {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1g97a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} Back     information, alignment and structure
>d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} Back     information, alignment and structure
>d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} Back     information, alignment and structure
>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d2oi6a2 c.68.1.5 (A:4-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1h7ea_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KpsU [TaxId: 562]} Back     information, alignment and structure
>d1vica_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vh1a_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KdsB [TaxId: 562]} Back     information, alignment and structure
>d1eyra_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1vpaa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w77a1 c.68.1.13 (A:75-300) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d2icya2 c.68.1.5 (A:6-383) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vgwa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Neisseria gonorrhoeae [TaxId: 485]} Back     information, alignment and structure
>d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i52a_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure