Citrus Sinensis ID: 022113
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 302 | ||||||
| 319739577 | 361 | putative GDP-mannose pyrophosphorylase [ | 1.0 | 0.836 | 0.986 | 1e-172 | |
| 225449380 | 361 | PREDICTED: mannose-1-phosphate guanylylt | 1.0 | 0.836 | 0.937 | 1e-164 | |
| 388518711 | 353 | unknown [Lotus japonicus] | 1.0 | 0.855 | 0.927 | 1e-163 | |
| 224038262 | 361 | GDP-D-mannose pyrophosphorylase [Actinid | 1.0 | 0.836 | 0.927 | 1e-162 | |
| 357492373 | 361 | Mannose-1-phosphate guanyltransferase [M | 1.0 | 0.836 | 0.913 | 1e-162 | |
| 240851533 | 333 | GDP-D-mannose pyrophosphorylase [Malus x | 1.0 | 0.906 | 0.920 | 1e-162 | |
| 113952525 | 361 | GDP-D-mannose pyrophosphorylase [Viola b | 1.0 | 0.836 | 0.923 | 1e-162 | |
| 218117841 | 361 | GDP-D-mannose pyrophosphorylase [Prunus | 1.0 | 0.836 | 0.917 | 1e-161 | |
| 255566484 | 361 | mannose-1-phosphate guanyltransferase, p | 1.0 | 0.836 | 0.907 | 1e-161 | |
| 80973464 | 361 | GDP-mannose pyrophosphorylase [Malpighia | 1.0 | 0.836 | 0.900 | 1e-160 |
| >gi|319739577|gb|ADV59923.1| putative GDP-mannose pyrophosphorylase [Citrus unshiu] | Back alignment and taxonomy information |
|---|
Score = 609 bits (1571), Expect = e-172, Method: Compositional matrix adjust.
Identities = 298/302 (98%), Positives = 299/302 (99%)
Query: 1 MLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFA 60
MLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFA
Sbjct: 60 MLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFA 119
Query: 61 EMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGKVEKFVEKPKLFVGNKINAGIYLL 120
EMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGKVEKFVEKPKLFVGNKINAGIYLL
Sbjct: 120 EMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGKVEKFVEKPKLFVGNKINAGIYLL 179
Query: 121 NPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPRDYITGLRLYLDSLRK 180
NPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPRDYITGLRLYLDSLRK
Sbjct: 180 NPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPRDYITGLRLYLDSLRK 239
Query: 181 KSSLKLATGANIVGNVLVHESAQIGEGCLIGPDVAVGPGCVVESGVRLSRCTVMRGVRIK 240
KSS KLATGANIVGNVLVHESAQIGE CLIGPDVA+GPGCVVESGVRLSRCTVMRGVRIK
Sbjct: 240 KSSFKLATGANIVGNVLVHESAQIGEECLIGPDVAIGPGCVVESGVRLSRCTVMRGVRIK 299
Query: 241 KHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILKPEI 300
KHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGV LPHKEIKSSILKPEI
Sbjct: 300 KHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVALPHKEIKSSILKPEI 359
Query: 301 VM 302
VM
Sbjct: 360 VM 361
|
Source: Citrus unshiu Species: Citrus unshiu Genus: Citrus Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225449380|ref|XP_002282422.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 isoform 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|388518711|gb|AFK47417.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|224038262|gb|ACN38266.1| GDP-D-mannose pyrophosphorylase [Actinidia latifolia] | Back alignment and taxonomy information |
|---|
| >gi|357492373|ref|XP_003616475.1| Mannose-1-phosphate guanyltransferase [Medicago truncatula] gi|49246467|gb|AAT58365.1| GMPase [Medicago sativa] gi|355517810|gb|AES99433.1| Mannose-1-phosphate guanyltransferase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|240851533|gb|ACN88684.2| GDP-D-mannose pyrophosphorylase [Malus x domestica] | Back alignment and taxonomy information |
|---|
| >gi|113952525|gb|ABI48955.1| GDP-D-mannose pyrophosphorylase [Viola baoshanensis] | Back alignment and taxonomy information |
|---|
| >gi|218117841|dbj|BAH03298.1| GDP-D-mannose pyrophosphorylase [Prunus persica] | Back alignment and taxonomy information |
|---|
| >gi|255566484|ref|XP_002524227.1| mannose-1-phosphate guanyltransferase, putative [Ricinus communis] gi|223536504|gb|EEF38151.1| mannose-1-phosphate guanyltransferase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|80973464|gb|ABB53473.1| GDP-mannose pyrophosphorylase [Malpighia glabra] gi|161898831|gb|ABX80393.1| GDP-mannose pyrophosphorylase [Malpighia glabra] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 302 | ||||||
| TAIR|locus:2005504 | 361 | CYT1 "CYTOKINESIS DEFECTIVE 1" | 1.0 | 0.836 | 0.837 | 9.8e-135 | |
| TAIR|locus:2100001 | 364 | AT3G55590 [Arabidopsis thalian | 1.0 | 0.829 | 0.781 | 6.1e-126 | |
| TAIR|locus:2118671 | 331 | AT4G30570 [Arabidopsis thalian | 0.943 | 0.861 | 0.738 | 1.4e-110 | |
| DICTYBASE|DDB_G0287619 | 359 | gmppB "mannose-1-phosphate gua | 0.993 | 0.835 | 0.576 | 9.7e-96 | |
| UNIPROTKB|Q9Y5P6 | 360 | GMPPB "Mannose-1-phosphate gua | 0.983 | 0.825 | 0.593 | 3.8e-94 | |
| UNIPROTKB|F1SPR4 | 360 | GMPPB "Mannose-1-phosphate gua | 0.983 | 0.825 | 0.590 | 7.8e-94 | |
| UNIPROTKB|F1N7H5 | 360 | GMPPB "Mannose-1-phosphate gua | 0.983 | 0.825 | 0.593 | 1e-93 | |
| UNIPROTKB|E2R2I6 | 360 | GMPPB "Uncharacterized protein | 0.983 | 0.825 | 0.587 | 1.6e-93 | |
| MGI|MGI:2660880 | 360 | Gmppb "GDP-mannose pyrophospho | 0.983 | 0.825 | 0.587 | 1.6e-93 | |
| RGD|1560458 | 360 | Gmppb "GDP-mannose pyrophospho | 0.983 | 0.825 | 0.583 | 2.1e-93 |
| TAIR|locus:2005504 CYT1 "CYTOKINESIS DEFECTIVE 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1320 (469.7 bits), Expect = 9.8e-135, P = 9.8e-135
Identities = 253/302 (83%), Positives = 270/302 (89%)
Query: 1 MLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFA 60
MLNFLK+FE KL IKI CSQETEPLGTAGPLALARDKL+D +GEPFFVLNSDVISEYP
Sbjct: 60 MLNFLKDFETKLEIKITCSQETEPLGTAGPLALARDKLLDGSGEPFFVLNSDVISEYPLK 119
Query: 61 EMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGKVEKFVEKPKLFVGNKINAGIYLL 120
EM+EFHK+HGGEASIMVTKVDEPSKYGVVVMEESTG+VEKFVEKPKL+VGNKINAGIYLL
Sbjct: 120 EMLEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGRVEKFVEKPKLYVGNKINAGIYLL 179
Query: 121 NPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPRDYITGXXXXXXXXXX 180
NP+VLD+IELRPTSIEKE FPKIA L+AMVLPGFWMDIGQPRDYITG
Sbjct: 180 NPSVLDKIELRPTSIEKETFPKIAAAQGLYAMVLPGFWMDIGQPRDYITGLRLYLDSLRK 239
Query: 181 XXXXXXATGANIVGNVLVHESAQIGEGCLIGPDVAVGPGCVVESGVRLSRCTVMRGVRIK 240
+G +IVGNVLV E+A IGEGCLIGPDVA+GPGC+VESGVRLSRCTVMRGVRIK
Sbjct: 240 KSPAKLTSGPHIVGNVLVDETATIGEGCLIGPDVAIGPGCIVESGVRLSRCTVMRGVRIK 299
Query: 241 KHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILKPEI 300
KHACISSSIIGWHSTVGQWAR+ENMTILGEDVHV DEIYSNGGVVLPHKEIKS+ILKPEI
Sbjct: 300 KHACISSSIIGWHSTVGQWARIENMTILGEDVHVSDEIYSNGGVVLPHKEIKSNILKPEI 359
Query: 301 VM 302
VM
Sbjct: 360 VM 361
|
|
| TAIR|locus:2100001 AT3G55590 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2118671 AT4G30570 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0287619 gmppB "mannose-1-phosphate guanylyltransferase beta" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9Y5P6 GMPPB "Mannose-1-phosphate guanyltransferase beta" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SPR4 GMPPB "Mannose-1-phosphate guanyltransferase beta" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N7H5 GMPPB "Mannose-1-phosphate guanyltransferase beta" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R2I6 GMPPB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2660880 Gmppb "GDP-mannose pyrophosphorylase B" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1560458 Gmppb "GDP-mannose pyrophosphorylase B" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00018410001 | SubName- Full=Chromosome chr13 scaffold_17, whole genome shotgun sequence; (361 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00036807001 | • | • | • | 0.978 | |||||||
| GSVIVG00026780001 | • | • | • | 0.973 | |||||||
| GSVIVG00015572001 | • | • | • | • | • | 0.933 | |||||
| GSVIVG00031181001 | • | • | 0.905 | ||||||||
| GSVIVG00014968001 | • | • | • | 0.890 | |||||||
| GSVIVG00028703001 | • | • | • | 0.858 | |||||||
| GSVIVG00015680001 | • | • | 0.848 | ||||||||
| GSVIVG00018184001 | • | • | • | 0.774 | |||||||
| GSVIVG00017124001 | • | • | 0.678 | ||||||||
| GSVIVG00000750001 | • | • | • | 0.629 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 302 | |||
| cd06425 | 233 | cd06425, M1P_guanylylT_B_like_N, N-terminal domain | 1e-116 | |
| COG1208 | 358 | COG1208, GCD1, Nucleoside-diphosphate-sugar pyroph | 4e-74 | |
| cd04181 | 217 | cd04181, NTP_transferase, NTP_transferases catalyz | 4e-48 | |
| pfam00483 | 247 | pfam00483, NTP_transferase, Nucleotidyl transferas | 9e-40 | |
| cd06428 | 257 | cd06428, M1P_guanylylT_A_like_N, N-terminal domain | 2e-37 | |
| TIGR03992 | 393 | TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diph | 3e-36 | |
| cd06426 | 220 | cd06426, NTP_transferase_like_2, NTP_trnasferase_l | 6e-32 | |
| cd06915 | 223 | cd06915, NTP_transferase_WcbM_like, WcbM_like is a | 4e-31 | |
| cd05824 | 80 | cd05824, LbH_M1P_guanylylT_C, Mannose-1-phosphate | 3e-29 | |
| cd06422 | 221 | cd06422, NTP_transferase_like_1, NTP_transferase_l | 8e-23 | |
| TIGR01208 | 353 | TIGR01208, rmlA_long, glucose-1-phosphate thymidyl | 1e-22 | |
| cd02524 | 253 | cd02524, G1P_cytidylyltransferase, G1P_cytidylyltr | 6e-22 | |
| cd04189 | 236 | cd04189, G1P_TT_long, G1P_TT_long represents the l | 1e-21 | |
| COG0448 | 393 | COG0448, GlgC, ADP-glucose pyrophosphorylase [Carb | 3e-21 | |
| COG1207 | 460 | COG1207, GlmU, N-acetylglucosamine-1-phosphate uri | 8e-20 | |
| COG1209 | 286 | COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cel | 8e-18 | |
| TIGR02623 | 254 | TIGR02623, G1P_cyt_trans, glucose-1-phosphate cyti | 1e-17 | |
| TIGR01173 | 451 | TIGR01173, glmU, UDP-N-acetylglucosamine diphospho | 2e-17 | |
| cd03356 | 79 | cd03356, LbH_G1P_AT_C_like, Left-handed parallel b | 2e-16 | |
| TIGR02091 | 361 | TIGR02091, glgC, glucose-1-phosphate adenylyltrans | 4e-15 | |
| PRK05293 | 380 | PRK05293, glgC, glucose-1-phosphate adenylyltransf | 8e-15 | |
| cd02541 | 267 | cd02541, UGPase_prokaryotic, Prokaryotic UGPase ca | 8e-13 | |
| PRK14354 | 458 | PRK14354, glmU, bifunctional N-acetylglucosamine-1 | 2e-12 | |
| PRK14355 | 459 | PRK14355, glmU, bifunctional N-acetylglucosamine-1 | 2e-11 | |
| cd03353 | 193 | cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosph | 5e-11 | |
| cd02540 | 229 | cd02540, GT2_GlmU_N_bac, N-terminal domain of bact | 5e-11 | |
| cd04652 | 81 | cd04652, LbH_eIF2B_gamma_C, eIF-2B gamma subunit, | 3e-10 | |
| PRK14357 | 448 | PRK14357, glmU, bifunctional N-acetylglucosamine-1 | 5e-09 | |
| cd03352 | 205 | cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyl | 2e-08 | |
| PRK14356 | 456 | PRK14356, glmU, bifunctional N-acetylglucosamine-1 | 9e-08 | |
| PRK00892 | 343 | PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] gluco | 2e-07 | |
| PRK02862 | 429 | PRK02862, glgC, glucose-1-phosphate adenylyltransf | 2e-07 | |
| PRK14360 | 450 | PRK14360, glmU, bifunctional N-acetylglucosamine-1 | 2e-07 | |
| COG1210 | 291 | COG1210, GalU, UDP-glucose pyrophosphorylase [Cell | 3e-07 | |
| PRK00844 | 407 | PRK00844, glgC, glucose-1-phosphate adenylyltransf | 3e-07 | |
| TIGR01099 | 260 | TIGR01099, galU, UTP-glucose-1-phosphate uridylylt | 6e-07 | |
| TIGR01853 | 324 | TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristo | 7e-07 | |
| PRK14358 | 481 | PRK14358, glmU, bifunctional N-acetylglucosamine-1 | 1e-06 | |
| cd05636 | 163 | cd05636, LbH_G1P_TT_C_like, Putative glucose-1-pho | 2e-06 | |
| TIGR01852 | 254 | TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protei | 2e-06 | |
| cd03351 | 254 | cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamin | 5e-06 | |
| cd02538 | 240 | cd02538, G1P_TT_short, G1P_TT_short is the short f | 9e-06 | |
| PRK05289 | 262 | PRK05289, PRK05289, UDP-N-acetylglucosamine acyltr | 1e-05 | |
| COG1043 | 260 | COG1043, LpxA, Acyl-[acyl carrier protein] | 1e-05 | |
| PRK00892 | 343 | PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] gluco | 2e-05 | |
| PRK05289 | 262 | PRK05289, PRK05289, UDP-N-acetylglucosamine acyltr | 3e-05 | |
| COG1044 | 338 | COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | 3e-05 | |
| cd02507 | 216 | cd02507, eIF-2B_gamma_N_like, The N-terminal of eI | 7e-05 | |
| TIGR01853 | 324 | TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristo | 1e-04 | |
| cd04645 | 153 | cd04645, LbH_gamma_CA_like, Gamma carbonic anhydra | 1e-04 | |
| cd03360 | 197 | cd03360, LbH_AT_putative, Putative Acyltransferase | 3e-04 | |
| cd03351 | 254 | cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamin | 4e-04 | |
| PRK14352 | 482 | PRK14352, glmU, bifunctional N-acetylglucosamine-1 | 5e-04 | |
| PLN02241 | 436 | PLN02241, PLN02241, glucose-1-phosphate adenylyltr | 5e-04 | |
| PRK14353 | 446 | PRK14353, glmU, bifunctional N-acetylglucosamine-1 | 0.001 | |
| cd03358 | 119 | cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed p | 0.001 | |
| cd04651 | 104 | cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenyly | 0.001 | |
| PRK14356 | 456 | PRK14356, glmU, bifunctional N-acetylglucosamine-1 | 0.002 | |
| COG1043 | 260 | COG1043, LpxA, Acyl-[acyl carrier protein] | 0.002 | |
| PRK12461 | 255 | PRK12461, PRK12461, UDP-N-acetylglucosamine acyltr | 0.002 | |
| PRK14359 | 430 | PRK14359, glmU, bifunctional N-acetylglucosamine-1 | 0.002 | |
| TIGR03570 | 193 | TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sia | 0.002 | |
| pfam00132 | 36 | pfam00132, Hexapep, Bacterial transferase hexapept | 0.003 | |
| pfam00132 | 36 | pfam00132, Hexapep, Bacterial transferase hexapept | 0.003 | |
| PRK00725 | 425 | PRK00725, glgC, glucose-1-phosphate adenylyltransf | 0.003 | |
| cd02523 | 229 | cd02523, PC_cytidylyltransferase, Phosphocholine c | 0.003 |
| >gnl|CDD|133047 cd06425, M1P_guanylylT_B_like_N, N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins | Back alignment and domain information |
|---|
Score = 332 bits (854), Expect = e-116
Identities = 127/175 (72%), Positives = 154/175 (88%), Gaps = 1/175 (0%)
Query: 1 MLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFA 60
M+ FLKE+E KLGIKI S ETEPLGTAGPLALARD L DD EPFFVLNSDVI ++P A
Sbjct: 60 MVPFLKEYEKKLGIKITFSIETEPLGTAGPLALARDLLGDD-DEPFFVLNSDVICDFPLA 118
Query: 61 EMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGKVEKFVEKPKLFVGNKINAGIYLL 120
E+++FHK HG E +I+VTKV++PSKYGVVV +E+TG++E+FVEKPK+FVGNKINAGIY+L
Sbjct: 119 ELLDFHKKHGAEGTILVTKVEDPSKYGVVVHDENTGRIERFVEKPKVFVGNKINAGIYIL 178
Query: 121 NPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPRDYITGLRLYL 175
NP+VLDRI LRPTSIEKE+FPK+A EG+L+A LPGFWMDIGQP+D++ G+ LYL
Sbjct: 179 NPSVLDRIPLRPTSIEKEIFPKMASEGQLYAYELPGFWMDIGQPKDFLKGMSLYL 233
|
GDP-mannose pyrophosphorylase (GTP: alpha-d-mannose-1-phosphate guanyltransferase) catalyzes the formation of GDP-d-mannose from GTP and alpha-d-mannose-1-Phosphate. It contains an N-terminal catalytic domain and a C-terminal Lefthanded-beta-Helix fold domain. GDP-d-mannose is the activated form of mannose for formation of cell wall lipoarabinomannan and various mannose-containing glycolipids and polysaccharides. The function of GDP-mannose pyrophosphorylase is essential for cell wall integrity, morphogenesis and viability. Repression of GDP-mannose pyrophosphorylase in yeast leads to phenotypes, such as cell lysis, defective cell wall, and failure of polarized growth and cell separation. Length = 233 |
| >gnl|CDD|224129 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|133024 cd04181, NTP_transferase, NTP_transferases catalyze the transfer of nucleotides onto phosphosugars | Back alignment and domain information |
|---|
| >gnl|CDD|215940 pfam00483, NTP_transferase, Nucleotidyl transferase | Back alignment and domain information |
|---|
| >gnl|CDD|133050 cd06428, M1P_guanylylT_A_like_N, N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|234433 TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|133048 cd06426, NTP_transferase_like_2, NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family | Back alignment and domain information |
|---|
| >gnl|CDD|133065 cd06915, NTP_transferase_WcbM_like, WcbM_like is a subfamily of nucleotidyl transferases | Back alignment and domain information |
|---|
| >gnl|CDD|100062 cd05824, LbH_M1P_guanylylT_C, Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|133044 cd06422, NTP_transferase_like_1, NTP_transferase_like_1 is a member of the nucleotidyl transferase family | Back alignment and domain information |
|---|
| >gnl|CDD|233311 TIGR01208, rmlA_long, glucose-1-phosphate thymidylylransferase, long form | Back alignment and domain information |
|---|
| >gnl|CDD|133015 cd02524, G1P_cytidylyltransferase, G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose | Back alignment and domain information |
|---|
| >gnl|CDD|133032 cd04189, G1P_TT_long, G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|223525 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224128 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224130 COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|131672 TIGR02623, G1P_cyt_trans, glucose-1-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|233299 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|100046 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma | Back alignment and domain information |
|---|
| >gnl|CDD|233720 TIGR02091, glgC, glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|179997 PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133021 cd02541, UGPase_prokaryotic, Prokaryotic UGPase catalyses the synthesis of UDP-glucose | Back alignment and domain information |
|---|
| >gnl|CDD|184643 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237685 PRK14355, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|133020 cd02540, GT2_GlmU_N_bac, N-terminal domain of bacterial GlmU | Back alignment and domain information |
|---|
| >gnl|CDD|100057 cd04652, LbH_eIF2B_gamma_C, eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >gnl|CDD|237687 PRK14357, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc | Back alignment and domain information |
|---|
| >gnl|CDD|237686 PRK14356, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234858 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179486 PRK02862, glgC, glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184646 PRK14360, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224131 COG1210, GalU, UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|234846 PRK00844, glgC, glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233272 TIGR01099, galU, UTP-glucose-1-phosphate uridylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|233599 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|237688 PRK14358, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100060 cd05636, LbH_G1P_TT_C_like, Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains | Back alignment and domain information |
|---|
| >gnl|CDD|188173 TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|100042 cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc | Back alignment and domain information |
|---|
| >gnl|CDD|133019 cd02538, G1P_TT_short, G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|235390 PRK05289, PRK05289, UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223973 COG1043, LpxA, Acyl-[acyl carrier protein] | Back alignment and domain information |
|---|
| >gnl|CDD|234858 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235390 PRK05289, PRK05289, UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >gnl|CDD|133001 cd02507, eIF-2B_gamma_N_like, The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity | Back alignment and domain information |
|---|
| >gnl|CDD|233599 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|100051 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E | Back alignment and domain information |
|---|
| >gnl|CDD|100050 cd03360, LbH_AT_putative, Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain | Back alignment and domain information |
|---|
| >gnl|CDD|100042 cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc | Back alignment and domain information |
|---|
| >gnl|CDD|184641 PRK14352, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215133 PLN02241, PLN02241, glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|184642 PRK14353, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100048 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|100056 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|237686 PRK14356, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223973 COG1043, LpxA, Acyl-[acyl carrier protein] | Back alignment and domain information |
|---|
| >gnl|CDD|183539 PRK12461, PRK12461, UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237689 PRK14359, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234265 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family | Back alignment and domain information |
|---|
| >gnl|CDD|189409 pfam00132, Hexapep, Bacterial transferase hexapeptide (six repeats) | Back alignment and domain information |
|---|
| >gnl|CDD|189409 pfam00132, Hexapep, Bacterial transferase hexapeptide (six repeats) | Back alignment and domain information |
|---|
| >gnl|CDD|234824 PRK00725, glgC, glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133014 cd02523, PC_cytidylyltransferase, Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 302 | |||
| KOG1322 | 371 | consensus GDP-mannose pyrophosphorylase/mannose-1- | 100.0 | |
| COG1208 | 358 | GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas | 100.0 | |
| KOG1460 | 407 | consensus GDP-mannose pyrophosphorylase [Carbohydr | 100.0 | |
| PRK05293 | 380 | glgC glucose-1-phosphate adenylyltransferase; Prov | 100.0 | |
| COG0448 | 393 | GlgC ADP-glucose pyrophosphorylase [Carbohydrate t | 100.0 | |
| TIGR01208 | 353 | rmlA_long glucose-1-phosphate thymidylylransferase | 100.0 | |
| COG1207 | 460 | GlmU N-acetylglucosamine-1-phosphate uridyltransfe | 100.0 | |
| PLN02241 | 436 | glucose-1-phosphate adenylyltransferase | 100.0 | |
| PRK02862 | 429 | glgC glucose-1-phosphate adenylyltransferase; Prov | 100.0 | |
| PRK00844 | 407 | glgC glucose-1-phosphate adenylyltransferase; Prov | 100.0 | |
| PRK00725 | 425 | glgC glucose-1-phosphate adenylyltransferase; Prov | 100.0 | |
| TIGR02091 | 361 | glgC glucose-1-phosphate adenylyltransferase. This | 100.0 | |
| PRK14355 | 459 | glmU bifunctional N-acetylglucosamine-1-phosphate | 100.0 | |
| TIGR02092 | 369 | glgD glucose-1-phosphate adenylyltransferase, GlgD | 100.0 | |
| PRK14352 | 482 | glmU bifunctional N-acetylglucosamine-1-phosphate | 100.0 | |
| PRK14356 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 100.0 | |
| PRK14358 | 481 | glmU bifunctional N-acetylglucosamine-1-phosphate | 100.0 | |
| TIGR01173 | 451 | glmU UDP-N-acetylglucosamine diphosphorylase/gluco | 100.0 | |
| COG1209 | 286 | RfbA dTDP-glucose pyrophosphorylase [Cell envelope | 99.98 | |
| PRK14353 | 446 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.97 | |
| PRK14359 | 430 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.97 | |
| PRK09451 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.97 | |
| PRK14357 | 448 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.97 | |
| PRK14354 | 458 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.97 | |
| PRK14360 | 450 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.96 | |
| KOG1461 | 673 | consensus Translation initiation factor 2B, epsilo | 99.95 | |
| KOG1462 | 433 | consensus Translation initiation factor 2B, gamma | 99.95 | |
| cd06428 | 257 | M1P_guanylylT_A_like_N N-terminal domain of M1P_gu | 99.94 | |
| cd06425 | 233 | M1P_guanylylT_B_like_N N-terminal domain of the M1 | 99.94 | |
| PRK15480 | 292 | glucose-1-phosphate thymidylyltransferase RfbA; Pr | 99.92 | |
| TIGR01105 | 297 | galF UTP-glucose-1-phosphate uridylyltransferase, | 99.92 | |
| TIGR01207 | 286 | rmlA glucose-1-phosphate thymidylyltransferase, sh | 99.92 | |
| PF00483 | 248 | NTP_transferase: Nucleotidyl transferase This Pros | 99.92 | |
| cd02538 | 240 | G1P_TT_short G1P_TT_short is the short form of glu | 99.91 | |
| PRK10122 | 297 | GalU regulator GalF; Provisional | 99.91 | |
| TIGR02623 | 254 | G1P_cyt_trans glucose-1-phosphate cytidylyltransfe | 99.91 | |
| PRK13389 | 302 | UTP--glucose-1-phosphate uridylyltransferase subun | 99.89 | |
| cd04189 | 236 | G1P_TT_long G1P_TT_long represents the long form o | 99.88 | |
| cd06422 | 221 | NTP_transferase_like_1 NTP_transferase_like_1 is a | 99.87 | |
| cd06915 | 223 | NTP_transferase_WcbM_like WcbM_like is a subfamily | 99.86 | |
| cd02524 | 253 | G1P_cytidylyltransferase G1P_cytidylyltransferase | 99.86 | |
| cd02541 | 267 | UGPase_prokaryotic Prokaryotic UGPase catalyses th | 99.85 | |
| cd04181 | 217 | NTP_transferase NTP_transferases catalyze the tran | 99.85 | |
| cd06426 | 220 | NTP_transferase_like_2 NTP_trnasferase_like_2 is a | 99.85 | |
| TIGR01099 | 260 | galU UTP-glucose-1-phosphate uridylyltransferase. | 99.84 | |
| COG1210 | 291 | GalU UDP-glucose pyrophosphorylase [Cell envelope | 99.84 | |
| TIGR03532 | 231 | DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla | 99.82 | |
| COG0663 | 176 | PaaY Carbonic anhydrases/acetyltransferases, isole | 99.71 | |
| TIGR02287 | 192 | PaaY phenylacetic acid degradation protein PaaY. M | 99.71 | |
| cd04745 | 155 | LbH_paaY_like paaY-like: This group is composed by | 99.71 | |
| cd05636 | 163 | LbH_G1P_TT_C_like Putative glucose-1-phosphate thy | 99.7 | |
| cd04646 | 164 | LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact | 99.69 | |
| PRK13627 | 196 | carnitine operon protein CaiE; Provisional | 99.68 | |
| PLN02296 | 269 | carbonate dehydratase | 99.68 | |
| PLN02472 | 246 | uncharacterized protein | 99.67 | |
| COG1044 | 338 | LpxD UDP-3-O-[3-hydroxymyristoyl] | 99.66 | |
| cd04183 | 231 | GT2_BcE_like GT2_BcbE_like is likely involved in t | 99.65 | |
| TIGR00965 | 269 | dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate | 99.65 | |
| cd04650 | 154 | LbH_FBP Ferripyochelin Binding Protein (FBP): FBP | 99.64 | |
| cd04645 | 153 | LbH_gamma_CA_like Gamma carbonic anhydrase-like: T | 99.62 | |
| PRK00892 | 343 | lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac | 99.61 | |
| cd05824 | 80 | LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr | 99.6 | |
| cd03350 | 139 | LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d | 99.6 | |
| cd05636 | 163 | LbH_G1P_TT_C_like Putative glucose-1-phosphate thy | 99.59 | |
| cd03351 | 254 | LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr | 99.59 | |
| cd02517 | 239 | CMP-KDO-Synthetase CMP-KDO synthetase catalyzes th | 99.57 | |
| PRK05450 | 245 | 3-deoxy-manno-octulosonate cytidylyltransferase; P | 99.57 | |
| cd03359 | 161 | LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact | 99.57 | |
| TIGR03570 | 201 | NeuD_NnaD sugar O-acyltransferase, sialic acid O-a | 99.57 | |
| cd03360 | 197 | LbH_AT_putative Putative Acyltransferase (AT), Lef | 99.57 | |
| cd02509 | 274 | GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransf | 99.56 | |
| cd03356 | 79 | LbH_G1P_AT_C_like Left-handed parallel beta-Helix | 99.56 | |
| PRK05289 | 262 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.56 | |
| cd03351 | 254 | LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr | 99.56 | |
| cd04197 | 217 | eIF-2B_epsilon_N The N-terminal domain of epsilon | 99.56 | |
| TIGR01853 | 324 | lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam | 99.56 | |
| cd02523 | 229 | PC_cytidylyltransferase Phosphocholine cytidylyltr | 99.56 | |
| TIGR01852 | 254 | lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac | 99.56 | |
| cd02508 | 200 | ADP_Glucose_PP ADP-glucose pyrophosphorylase is in | 99.55 | |
| PRK11830 | 272 | dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- | 99.55 | |
| cd04652 | 81 | LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal | 99.55 | |
| TIGR01479 | 468 | GMP_PMI mannose-1-phosphate guanylyltransferase/ma | 99.54 | |
| TIGR01852 | 254 | lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac | 99.53 | |
| cd05787 | 79 | LbH_eIF2B_epsilon eIF-2B epsilon subunit, central | 99.53 | |
| KOG1461 | 673 | consensus Translation initiation factor 2B, epsilo | 99.53 | |
| COG1044 | 338 | LpxD UDP-3-O-[3-hydroxymyristoyl] | 99.53 | |
| cd03353 | 193 | LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl | 99.52 | |
| PRK05289 | 262 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.52 | |
| TIGR01853 | 324 | lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam | 99.51 | |
| cd03358 | 119 | LbH_WxcM_N_like WcxM-like, Left-handed parallel be | 99.51 | |
| cd00710 | 167 | LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo | 99.5 | |
| PRK12461 | 255 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.5 | |
| cd04649 | 147 | LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah | 99.49 | |
| PRK00892 | 343 | lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac | 99.49 | |
| cd03350 | 139 | LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d | 99.49 | |
| COG1043 | 260 | LpxA Acyl-[acyl carrier protein] | 99.48 | |
| cd03360 | 197 | LbH_AT_putative Putative Acyltransferase (AT), Lef | 99.48 | |
| PRK12461 | 255 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.48 | |
| cd02540 | 229 | GT2_GlmU_N_bac N-terminal domain of bacterial GlmU | 99.48 | |
| TIGR03308 | 204 | phn_thr-fam phosphonate metabolim protein, transfe | 99.48 | |
| TIGR00965 | 269 | dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate | 99.47 | |
| cd03352 | 205 | LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas | 99.46 | |
| TIGR03570 | 201 | NeuD_NnaD sugar O-acyltransferase, sialic acid O-a | 99.45 | |
| cd04745 | 155 | LbH_paaY_like paaY-like: This group is composed by | 99.45 | |
| PRK13368 | 238 | 3-deoxy-manno-octulosonate cytidylyltransferase; P | 99.43 | |
| cd03353 | 193 | LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl | 99.43 | |
| TIGR02287 | 192 | PaaY phenylacetic acid degradation protein PaaY. M | 99.41 | |
| TIGR03532 | 231 | DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla | 99.4 | |
| PRK13627 | 196 | carnitine operon protein CaiE; Provisional | 99.4 | |
| TIGR03308 | 204 | phn_thr-fam phosphonate metabolim protein, transfe | 99.39 | |
| cd04651 | 104 | LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera | 99.39 | |
| cd04646 | 164 | LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact | 99.39 | |
| TIGR03536 | 341 | DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl | 99.39 | |
| cd03358 | 119 | LbH_WxcM_N_like WcxM-like, Left-handed parallel be | 99.37 | |
| cd05635 | 101 | LbH_unknown Uncharacterized proteins, Left-handed | 99.36 | |
| cd03352 | 205 | LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas | 99.36 | |
| PLN02296 | 269 | carbonate dehydratase | 99.35 | |
| cd04650 | 154 | LbH_FBP Ferripyochelin Binding Protein (FBP): FBP | 99.35 | |
| PRK10502 | 182 | putative acyl transferase; Provisional | 99.35 | |
| cd05787 | 79 | LbH_eIF2B_epsilon eIF-2B epsilon subunit, central | 99.34 | |
| COG2171 | 271 | DapD Tetrahydrodipicolinate N-succinyltransferase | 99.33 | |
| cd04645 | 153 | LbH_gamma_CA_like Gamma carbonic anhydrase-like: T | 99.33 | |
| cd00710 | 167 | LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo | 99.33 | |
| PRK11830 | 272 | dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- | 99.32 | |
| cd03356 | 79 | LbH_G1P_AT_C_like Left-handed parallel beta-Helix | 99.32 | |
| PRK14353 | 446 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.32 | |
| cd05635 | 101 | LbH_unknown Uncharacterized proteins, Left-handed | 99.31 | |
| PRK14360 | 450 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.31 | |
| PRK09451 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.3 | |
| COG1043 | 260 | LpxA Acyl-[acyl carrier protein] | 99.3 | |
| cd03359 | 161 | LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact | 99.29 | |
| PRK14355 | 459 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.29 | |
| PLN02472 | 246 | uncharacterized protein | 99.29 | |
| TIGR01173 | 451 | glmU UDP-N-acetylglucosamine diphosphorylase/gluco | 99.29 | |
| cd04652 | 81 | LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal | 99.29 | |
| cd04651 | 104 | LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera | 99.28 | |
| TIGR03535 | 319 | DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo | 99.28 | |
| COG0663 | 176 | PaaY Carbonic anhydrases/acetyltransferases, isole | 99.28 | |
| KOG1462 | 433 | consensus Translation initiation factor 2B, gamma | 99.26 | |
| PRK14356 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.25 | |
| PRK09677 | 192 | putative lipopolysaccharide biosynthesis O-acetyl | 99.25 | |
| PRK11132 | 273 | cysE serine acetyltransferase; Provisional | 99.25 | |
| PLN02694 | 294 | serine O-acetyltransferase | 99.24 | |
| PRK14352 | 482 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.24 | |
| PRK14358 | 481 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.23 | |
| PRK09527 | 203 | lacA galactoside O-acetyltransferase; Reviewed | 99.23 | |
| PRK10092 | 183 | maltose O-acetyltransferase; Provisional | 99.22 | |
| PRK14359 | 430 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.22 | |
| cd03354 | 101 | LbH_SAT Serine acetyltransferase (SAT): SAT cataly | 99.21 | |
| TIGR01172 | 162 | cysE serine O-acetyltransferase. Cysteine biosynth | 99.21 | |
| KOG3121 | 184 | consensus Dynactin, subunit p25 [Cytoskeleton] | 99.21 | |
| cd04647 | 109 | LbH_MAT_like Maltose O-acyltransferase (MAT)-like: | 99.21 | |
| PRK14357 | 448 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.21 | |
| PRK14354 | 458 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.2 | |
| cd04649 | 147 | LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah | 99.19 | |
| PRK05293 | 380 | glgC glucose-1-phosphate adenylyltransferase; Prov | 99.18 | |
| cd04198 | 214 | eIF-2B_gamma_N The N-terminal domain of gamma subu | 99.17 | |
| COG0836 | 333 | {ManC} Mannose-1-phosphate guanylyltransferase [Ce | 99.16 | |
| cd00208 | 78 | LbetaH Left-handed parallel beta-Helix (LbetaH or | 99.16 | |
| cd05824 | 80 | LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr | 99.16 | |
| cd03357 | 169 | LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and | 99.16 | |
| COG0448 | 393 | GlgC ADP-glucose pyrophosphorylase [Carbohydrate t | 99.15 | |
| cd02507 | 216 | eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma | 99.15 | |
| TIGR01172 | 162 | cysE serine O-acetyltransferase. Cysteine biosynth | 99.12 | |
| PLN02357 | 360 | serine acetyltransferase | 99.11 | |
| PRK10191 | 146 | putative acyl transferase; Provisional | 99.1 | |
| COG1207 | 460 | GlmU N-acetylglucosamine-1-phosphate uridyltransfe | 99.09 | |
| TIGR01208 | 353 | rmlA_long glucose-1-phosphate thymidylylransferase | 99.07 | |
| PRK00844 | 407 | glgC glucose-1-phosphate adenylyltransferase; Prov | 99.05 | |
| PLN02739 | 355 | serine acetyltransferase | 99.03 | |
| PLN02694 | 294 | serine O-acetyltransferase | 99.03 | |
| TIGR03535 | 319 | DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo | 99.03 | |
| TIGR02091 | 361 | glgC glucose-1-phosphate adenylyltransferase. This | 99.02 | |
| PRK10092 | 183 | maltose O-acetyltransferase; Provisional | 99.02 | |
| PRK10191 | 146 | putative acyl transferase; Provisional | 99.02 | |
| cd05825 | 107 | LbH_wcaF_like wcaF-like: This group is composed of | 99.01 | |
| cd00208 | 78 | LbetaH Left-handed parallel beta-Helix (LbetaH or | 99.0 | |
| PRK09527 | 203 | lacA galactoside O-acetyltransferase; Reviewed | 99.0 | |
| PRK02862 | 429 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.99 | |
| cd03354 | 101 | LbH_SAT Serine acetyltransferase (SAT): SAT cataly | 98.99 | |
| PRK11132 | 273 | cysE serine acetyltransferase; Provisional | 98.97 | |
| PRK00725 | 425 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.96 | |
| cd03357 | 169 | LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and | 98.96 | |
| PLN02739 | 355 | serine acetyltransferase | 98.95 | |
| TIGR02092 | 369 | glgD glucose-1-phosphate adenylyltransferase, GlgD | 98.93 | |
| TIGR03536 | 341 | DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl | 98.91 | |
| cd05825 | 107 | LbH_wcaF_like wcaF-like: This group is composed of | 98.91 | |
| PLN02917 | 293 | CMP-KDO synthetase | 98.91 | |
| PLN02357 | 360 | serine acetyltransferase | 98.9 | |
| COG1045 | 194 | CysE Serine acetyltransferase [Amino acid transpor | 98.88 | |
| PRK10502 | 182 | putative acyl transferase; Provisional | 98.88 | |
| COG1208 | 358 | GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas | 98.88 | |
| KOG3121 | 184 | consensus Dynactin, subunit p25 [Cytoskeleton] | 98.88 | |
| PRK15460 | 478 | cpsB mannose-1-phosphate guanyltransferase; Provis | 98.87 | |
| cd03349 | 145 | LbH_XAT Xenobiotic acyltransferase (XAT): The XAT | 98.87 | |
| cd04647 | 109 | LbH_MAT_like Maltose O-acyltransferase (MAT)-like: | 98.86 | |
| PRK09677 | 192 | putative lipopolysaccharide biosynthesis O-acetyl | 98.85 | |
| COG2171 | 271 | DapD Tetrahydrodipicolinate N-succinyltransferase | 98.82 | |
| PLN02241 | 436 | glucose-1-phosphate adenylyltransferase | 98.81 | |
| KOG4042 | 190 | consensus Dynactin subunit p27/WS-3, involved in t | 98.72 | |
| COG1045 | 194 | CysE Serine acetyltransferase [Amino acid transpor | 98.61 | |
| COG1213 | 239 | Predicted sugar nucleotidyltransferases [Cell enve | 98.6 | |
| TIGR02353 | 695 | NRPS_term_dom non-ribosomal peptide synthetase ter | 98.59 | |
| COG0110 | 190 | WbbJ Acetyltransferase (isoleucine patch superfami | 98.58 | |
| TIGR02353 | 695 | NRPS_term_dom non-ribosomal peptide synthetase ter | 98.57 | |
| KOG4042 | 190 | consensus Dynactin subunit p27/WS-3, involved in t | 98.54 | |
| KOG1460 | 407 | consensus GDP-mannose pyrophosphorylase [Carbohydr | 98.52 | |
| cd03349 | 145 | LbH_XAT Xenobiotic acyltransferase (XAT): The XAT | 98.41 | |
| KOG4750 | 269 | consensus Serine O-acetyltransferase [Amino acid t | 98.36 | |
| KOG1322 | 371 | consensus GDP-mannose pyrophosphorylase/mannose-1- | 98.34 | |
| COG0110 | 190 | WbbJ Acetyltransferase (isoleucine patch superfami | 98.18 | |
| PF07959 | 414 | Fucokinase: L-fucokinase; InterPro: IPR012887 In t | 98.07 | |
| PF00132 | 36 | Hexapep: Bacterial transferase hexapeptide (six re | 97.93 | |
| COG4801 | 277 | Predicted acyltransferase [General function predic | 97.87 | |
| COG4801 | 277 | Predicted acyltransferase [General function predic | 97.84 | |
| PF00132 | 36 | Hexapep: Bacterial transferase hexapeptide (six re | 97.83 | |
| cd02513 | 223 | CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N- | 97.82 | |
| PRK13412 | 974 | fkp bifunctional fucokinase/L-fucose-1-P-guanylylt | 97.76 | |
| TIGR00466 | 238 | kdsB 3-deoxy-D-manno-octulosonate cytidylyltransfe | 97.76 | |
| KOG4750 | 269 | consensus Serine O-acetyltransferase [Amino acid t | 97.68 | |
| PF14602 | 34 | Hexapep_2: Hexapeptide repeat of succinyl-transfer | 97.55 | |
| COG1212 | 247 | KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase | 97.25 | |
| TIGR03584 | 222 | PseF pseudaminic acid CMP-transferase. The sequenc | 97.07 | |
| PRK09382 | 378 | ispDF bifunctional 2-C-methyl-D-erythritol 4-phosp | 96.96 | |
| TIGR00453 | 217 | ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl | 96.6 | |
| PRK00155 | 227 | ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl | 96.6 | |
| cd02516 | 218 | CDP-ME_synthetase CDP-ME synthetase is involved in | 96.27 | |
| TIGR03310 | 188 | matur_ygfJ molybdenum hydroxylase accessory protei | 95.74 | |
| PF12804 | 160 | NTP_transf_3: MobA-like NTP transferase domain; PD | 94.82 | |
| PRK13385 | 230 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans | 93.66 | |
| PF07959 | 414 | Fucokinase: L-fucokinase; InterPro: IPR012887 In t | 93.35 | |
| PF00535 | 169 | Glycos_transf_2: Glycosyl transferase family 2; In | 92.88 | |
| PRK00317 | 193 | mobA molybdopterin-guanine dinucleotide biosynthes | 92.69 | |
| COG2068 | 199 | Uncharacterized MobA-related protein [General func | 91.72 | |
| cd04180 | 266 | UGPase_euk_like Eukaryotic UGPase-like includes UD | 91.32 | |
| PLN02474 | 469 | UTP--glucose-1-phosphate uridylyltransferase | 90.95 | |
| TIGR02665 | 186 | molyb_mobA molybdopterin-guanine dinucleotide bios | 89.83 | |
| PRK14489 | 366 | putative bifunctional molybdopterin-guanine dinucl | 88.5 | |
| cd04188 | 211 | DPG_synthase DPG_synthase is involved in protein N | 88.3 | |
| cd04182 | 186 | GT_2_like_f GT_2_like_f is a subfamily of the glyc | 88.26 | |
| TIGR00454 | 183 | conserved hypothetical protein TIGR00454. At this | 87.05 | |
| cd02503 | 181 | MobA MobA catalyzes the formation of molybdopterin | 84.97 | |
| PRK00560 | 196 | molybdopterin-guanine dinucleotide biosynthesis pr | 84.32 | |
| cd04179 | 185 | DPM_DPG-synthase_like DPM_DPG-synthase_like is a m | 83.9 | |
| TIGR03202 | 190 | pucB xanthine dehydrogenase accessory protein pucB | 82.08 | |
| COG2266 | 177 | GTP:adenosylcobinamide-phosphate guanylyltransfera | 82.03 | |
| cd00761 | 156 | Glyco_tranf_GTA_type Glycosyltransferase family A | 80.51 | |
| COG1083 | 228 | NeuA CMP-N-acetylneuraminic acid synthetase [Cell | 80.44 | |
| cd06427 | 241 | CESA_like_2 CESA_like_2 is a member of the cellulo | 80.38 | |
| cd04187 | 181 | DPM1_like_bac Bacterial DPM1_like enzymes are rela | 80.33 |
| >KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.7e-55 Score=368.32 Aligned_cols=301 Identities=57% Similarity=0.956 Sum_probs=287.7
Q ss_pred hhHHHHHhhcCCcEEEEEecCCCCCChHHHHHcHhhhccCCCCcEEEEeCCeecCcCHHHHHHHHHHcCCcEEEEEEeCC
Q 022113 2 LNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVD 81 (302)
Q Consensus 2 ~~~~~~~~~~~g~~i~~~~~~~~~Gt~~al~~a~~~i~~~~~~~~lv~~gD~l~~~~l~~~~~~~~~~~~~~~l~~~~~~ 81 (302)
+++.+.++.++|++|.++.|.+++||++.+..|++++..+.+.+|+|++||+++++++++|+++|++++++.|+++.+.+
T Consensus 71 ~~~~k~y~~~lgVei~~s~eteplgtaGpl~laR~~L~~~~~~~ffVLnsDvi~~~p~~~~vqfH~~~gae~TI~~t~vd 150 (371)
T KOG1322|consen 71 RHLSKAYGKELGVEILASTETEPLGTAGPLALARDFLWVFEDAPFFVLNSDVICRMPYKEMVQFHRAHGAEITIVVTKVD 150 (371)
T ss_pred HHHHHHhhhccceEEEEEeccCCCcccchHHHHHHHhhhcCCCcEEEecCCeeecCCHHHHHHHHHhcCCceEEEEEecc
Confidence 35667778889999999999999999999999999998765568999999999999999999999999999999999999
Q ss_pred CCCCcceEEEeCCCCcEEEEEecCCCCCCCeEEEEEEEeCHhhHhhccCCCCCccccchHHHHhcCcEEEEEecCeeEec
Q 022113 82 EPSKYGVVVMEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDI 161 (302)
Q Consensus 82 ~~~~~g~v~~d~~~~~v~~~~ekp~~~~~~~~~~Giy~~~~~~l~~l~~~~~~~~~~~~~~l~~~~~v~~~~~~g~~~di 161 (302)
+|++||++..|+++|+|.+|.|||+...++.+++|+|+|+|++++.+.....++..|++|.++...++++|.++|||+|+
T Consensus 151 epSkyGvv~~d~~~grV~~F~EKPkd~vsnkinaGiYi~~~~vL~ri~~~ptSiekEifP~~a~~~~l~a~~l~gfWmDI 230 (371)
T KOG1322|consen 151 EPSKYGVVVIDEDTGRVIRFVEKPKDLVSNKINAGIYILNPEVLDRILLRPTSIEKEIFPAMAEEHQLYAFDLPGFWMDI 230 (371)
T ss_pred CccccceEEEecCCCceeEehhCchhhhhccccceEEEECHHHHhHhhhcccchhhhhhhhhhhcCceEEEecCchhhhc
Confidence 99999999999878999999999998778899999999999999999888888999999999999999999999999999
Q ss_pred CChHHHHHHHHHHHHhhccccccccccCceEecceEEcCCcEECCCCEECCCcEECCCCEECCCcEEeceEEccCCEECC
Q 022113 162 GQPRDYITGLRLYLDSLRKKSSLKLATGANIVGNVLVHESAQIGEGCLIGPDVAVGPGCVVESGVRLSRCTVMRGVRIKK 241 (302)
Q Consensus 162 gt~~~~~~a~~~~l~~~~~~~~~~~~~~~~i~~~~~i~~~~~i~~~~~i~~~~~ig~~~~i~~~~~i~~~~i~~~~~i~~ 241 (302)
|+|++|+.+...+++.++...+.++.+++.+.+++++++.+.+|++|.|+++++||++|+|++++.|.+|.|+.+..++.
T Consensus 231 Gqpkdf~~g~~~Yl~s~~~~t~~r~~p~~~i~~nvlvd~~~~iG~~C~Ig~~vvIG~r~~i~~gV~l~~s~il~~~~~~~ 310 (371)
T KOG1322|consen 231 GQPKDFLTGFSFYLRSLPKYTSPRLLPGSKIVGNVLVDSIASIGENCSIGPNVVIGPRVRIEDGVRLQDSTILGADYYET 310 (371)
T ss_pred CCHHHHHHHHHHHHhhCcccCCccccCCccccccEeeccccccCCccEECCCceECCCcEecCceEEEeeEEEccceech
Confidence 99999999999999999888888999999999999999999999999999999999999999999999999999999999
Q ss_pred CcEEeccEECCCCEECCCcEEccCcEECCCcEECCceEEcCCeEecCccccccccCCcccC
Q 022113 242 HACISSSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSNGGVVLPHKEIKSSILKPEIVM 302 (302)
Q Consensus 242 ~~~i~~~~i~~~~~i~~~~~i~~~~~i~~~~~v~~~~~v~~~~v~~~~~~~~~~~~~~~~~ 302 (302)
++.+..++++.++.||.|++|.+.++||+++.|.+.-.+..+.++|+|++..+++||.++|
T Consensus 311 ~s~i~s~ivg~~~~IG~~~~id~~a~lG~nV~V~d~~~vn~g~~l~~ks~~~~v~~~~iI~ 371 (371)
T KOG1322|consen 311 HSEISSSIVGWNVPIGIWARIDKNAVLGKNVIVADEDYVNEGSGLPIKSGITVVLKPAIIM 371 (371)
T ss_pred hHHHHhhhccccccccCceEEecccEeccceEEecccccccceeEEeccceeecccccccC
Confidence 9999999999999999999999999999999999999999999999999999999999987
|
|
| >COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form | Back alignment and domain information |
|---|
| >COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PLN02241 glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02091 glgC glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit | Back alignment and domain information |
|---|
| >PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >COG1209 RfbA dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd06428 M1P_guanylylT_A_like_N N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase | Back alignment and domain information |
|---|
| >cd06425 M1P_guanylylT_B_like_N N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins | Back alignment and domain information |
|---|
| >PRK15480 glucose-1-phosphate thymidylyltransferase RfbA; Provisional | Back alignment and domain information |
|---|
| >TIGR01105 galF UTP-glucose-1-phosphate uridylyltransferase, non-catalytic GalF subunit | Back alignment and domain information |
|---|
| >TIGR01207 rmlA glucose-1-phosphate thymidylyltransferase, short form | Back alignment and domain information |
|---|
| >PF00483 NTP_transferase: Nucleotidyl transferase This Prosite entry is only a sub-family of the Pfam entry | Back alignment and domain information |
|---|
| >cd02538 G1P_TT_short G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase | Back alignment and domain information |
|---|
| >PRK10122 GalU regulator GalF; Provisional | Back alignment and domain information |
|---|
| >TIGR02623 G1P_cyt_trans glucose-1-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >PRK13389 UTP--glucose-1-phosphate uridylyltransferase subunit GalU; Provisional | Back alignment and domain information |
|---|
| >cd04189 G1P_TT_long G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase | Back alignment and domain information |
|---|
| >cd06422 NTP_transferase_like_1 NTP_transferase_like_1 is a member of the nucleotidyl transferase family | Back alignment and domain information |
|---|
| >cd06915 NTP_transferase_WcbM_like WcbM_like is a subfamily of nucleotidyl transferases | Back alignment and domain information |
|---|
| >cd02524 G1P_cytidylyltransferase G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose | Back alignment and domain information |
|---|
| >cd02541 UGPase_prokaryotic Prokaryotic UGPase catalyses the synthesis of UDP-glucose | Back alignment and domain information |
|---|
| >cd04181 NTP_transferase NTP_transferases catalyze the transfer of nucleotides onto phosphosugars | Back alignment and domain information |
|---|
| >cd06426 NTP_transferase_like_2 NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family | Back alignment and domain information |
|---|
| >TIGR01099 galU UTP-glucose-1-phosphate uridylyltransferase | Back alignment and domain information |
|---|
| >COG1210 GalU UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase | Back alignment and domain information |
|---|
| >COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02287 PaaY phenylacetic acid degradation protein PaaY | Back alignment and domain information |
|---|
| >cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E | Back alignment and domain information |
|---|
| >cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains | Back alignment and domain information |
|---|
| >cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >PRK13627 carnitine operon protein CaiE; Provisional | Back alignment and domain information |
|---|
| >PLN02296 carbonate dehydratase | Back alignment and domain information |
|---|
| >PLN02472 uncharacterized protein | Back alignment and domain information |
|---|
| >COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >cd04183 GT2_BcE_like GT2_BcbE_like is likely involved in the biosynthesis of the polysaccharide capsule | Back alignment and domain information |
|---|
| >TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition | Back alignment and domain information |
|---|
| >cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E | Back alignment and domain information |
|---|
| >PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase | Back alignment and domain information |
|---|
| >cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA | Back alignment and domain information |
|---|
| >cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains | Back alignment and domain information |
|---|
| >cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc | Back alignment and domain information |
|---|
| >cd02517 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes the activation of KDO which is an essential component of the lipopolysaccharide | Back alignment and domain information |
|---|
| >PRK05450 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family | Back alignment and domain information |
|---|
| >cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain | Back alignment and domain information |
|---|
| >cd02509 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransferase catalyzes the formation of GDP-Mannose | Back alignment and domain information |
|---|
| >cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma | Back alignment and domain information |
|---|
| >PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc | Back alignment and domain information |
|---|
| >cd04197 eIF-2B_epsilon_N The N-terminal domain of epsilon subunit of the eIF-2B is a subfamily of glycosyltransferase 2 | Back alignment and domain information |
|---|
| >TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Back alignment and domain information |
|---|
| >cd02523 PC_cytidylyltransferase Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline | Back alignment and domain information |
|---|
| >TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase | Back alignment and domain information |
|---|
| >cd02508 ADP_Glucose_PP ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch | Back alignment and domain information |
|---|
| >PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase | Back alignment and domain information |
|---|
| >TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase | Back alignment and domain information |
|---|
| >cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase | Back alignment and domain information |
|---|
| >PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Back alignment and domain information |
|---|
| >cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain | Back alignment and domain information |
|---|
| >cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site | Back alignment and domain information |
|---|
| >PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH | Back alignment and domain information |
|---|
| >PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA | Back alignment and domain information |
|---|
| >COG1043 LpxA Acyl-[acyl carrier protein] | Back alignment and domain information |
|---|
| >cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain | Back alignment and domain information |
|---|
| >PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd02540 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU | Back alignment and domain information |
|---|
| >TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family | Back alignment and domain information |
|---|
| >TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc | Back alignment and domain information |
|---|
| >TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family | Back alignment and domain information |
|---|
| >cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E | Back alignment and domain information |
|---|
| >PRK13368 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase | Back alignment and domain information |
|---|
| >TIGR02287 PaaY phenylacetic acid degradation protein PaaY | Back alignment and domain information |
|---|
| >TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK13627 carnitine operon protein CaiE; Provisional | Back alignment and domain information |
|---|
| >TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family | Back alignment and domain information |
|---|
| >cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase | Back alignment and domain information |
|---|
| >cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain | Back alignment and domain information |
|---|
| >cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc | Back alignment and domain information |
|---|
| >PLN02296 carbonate dehydratase | Back alignment and domain information |
|---|
| >cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition | Back alignment and domain information |
|---|
| >PRK10502 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E | Back alignment and domain information |
|---|
| >cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site | Back alignment and domain information |
|---|
| >PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma | Back alignment and domain information |
|---|
| >PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1043 LpxA Acyl-[acyl carrier protein] | Back alignment and domain information |
|---|
| >cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02472 uncharacterized protein | Back alignment and domain information |
|---|
| >TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase | Back alignment and domain information |
|---|
| >TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional | Back alignment and domain information |
|---|
| >PRK11132 cysE serine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02694 serine O-acetyltransferase | Back alignment and domain information |
|---|
| >PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09527 lacA galactoside O-acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK10092 maltose O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine | Back alignment and domain information |
|---|
| >TIGR01172 cysE serine O-acetyltransferase | Back alignment and domain information |
|---|
| >KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins | Back alignment and domain information |
|---|
| >PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH | Back alignment and domain information |
|---|
| >PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04198 eIF-2B_gamma_N The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2 | Back alignment and domain information |
|---|
| >COG0836 {ManC} Mannose-1-phosphate guanylyltransferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase | Back alignment and domain information |
|---|
| >cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates | Back alignment and domain information |
|---|
| >COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd02507 eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity | Back alignment and domain information |
|---|
| >TIGR01172 cysE serine O-acetyltransferase | Back alignment and domain information |
|---|
| >PLN02357 serine acetyltransferase | Back alignment and domain information |
|---|
| >PRK10191 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form | Back alignment and domain information |
|---|
| >PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02739 serine acetyltransferase | Back alignment and domain information |
|---|
| >PLN02694 serine O-acetyltransferase | Back alignment and domain information |
|---|
| >TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >TIGR02091 glgC glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >PRK10092 maltose O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10191 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E | Back alignment and domain information |
|---|
| >cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >PRK09527 lacA galactoside O-acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine | Back alignment and domain information |
|---|
| >PRK11132 cysE serine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates | Back alignment and domain information |
|---|
| >PLN02739 serine acetyltransferase | Back alignment and domain information |
|---|
| >TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit | Back alignment and domain information |
|---|
| >TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E | Back alignment and domain information |
|---|
| >PLN02917 CMP-KDO synthetase | Back alignment and domain information |
|---|
| >PLN02357 serine acetyltransferase | Back alignment and domain information |
|---|
| >COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10502 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others | Back alignment and domain information |
|---|
| >cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins | Back alignment and domain information |
|---|
| >PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional | Back alignment and domain information |
|---|
| >COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02241 glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] | Back alignment and domain information |
|---|
| >COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1213 Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function | Back alignment and domain information |
|---|
| >COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function | Back alignment and domain information |
|---|
| >KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others | Back alignment and domain information |
|---|
| >KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase [] | Back alignment and domain information |
|---|
| >PF00132 Hexapep: Bacterial transferase hexapeptide (six repeats); InterPro: IPR001451 A variety of bacterial transferases contain a repeat structure composed of tandem repeats of a [LIV]-G-X(4) hexapeptide, which, in the tertiary structure of LpxA (UDP N-acetylglucosamine acyltransferase) [], has been shown to form a left-handed parallel beta helix | Back alignment and domain information |
|---|
| >COG4801 Predicted acyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG4801 Predicted acyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF00132 Hexapep: Bacterial transferase hexapeptide (six repeats); InterPro: IPR001451 A variety of bacterial transferases contain a repeat structure composed of tandem repeats of a [LIV]-G-X(4) hexapeptide, which, in the tertiary structure of LpxA (UDP N-acetylglucosamine acyltransferase) [], has been shown to form a left-handed parallel beta helix | Back alignment and domain information |
|---|
| >cd02513 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N-acetylneuraminic acid by adding CMP moiety | Back alignment and domain information |
|---|
| >PRK13412 fkp bifunctional fucokinase/L-fucose-1-P-guanylyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00466 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransferase | Back alignment and domain information |
|---|
| >KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A | Back alignment and domain information |
|---|
| >COG1212 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR03584 PseF pseudaminic acid CMP-transferase | Back alignment and domain information |
|---|
| >PRK09382 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00453 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >PRK00155 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Reviewed | Back alignment and domain information |
|---|
| >cd02516 CDP-ME_synthetase CDP-ME synthetase is involved in mevalonate-independent isoprenoid production | Back alignment and domain information |
|---|
| >TIGR03310 matur_ygfJ molybdenum hydroxylase accessory protein, YgfJ family | Back alignment and domain information |
|---|
| >PF12804 NTP_transf_3: MobA-like NTP transferase domain; PDB: 3FWW_A 2XME_D 2XMH_C 2DPW_A 2WAW_A 2OI5_B 1HV9_B 1FWY_A 2OI6_A 2OI7_B | Back alignment and domain information |
|---|
| >PRK13385 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase [] | Back alignment and domain information |
|---|
| >PF00535 Glycos_transf_2: Glycosyl transferase family 2; InterPro: IPR001173 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases | Back alignment and domain information |
|---|
| >PRK00317 mobA molybdopterin-guanine dinucleotide biosynthesis protein MobA; Reviewed | Back alignment and domain information |
|---|
| >COG2068 Uncharacterized MobA-related protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd04180 UGPase_euk_like Eukaryotic UGPase-like includes UDPase and UDPGlcNAc pyrophosphorylase enzymes | Back alignment and domain information |
|---|
| >PLN02474 UTP--glucose-1-phosphate uridylyltransferase | Back alignment and domain information |
|---|
| >TIGR02665 molyb_mobA molybdopterin-guanine dinucleotide biosynthesis protein A, proteobacterial | Back alignment and domain information |
|---|
| >PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional | Back alignment and domain information |
|---|
| >cd04188 DPG_synthase DPG_synthase is involved in protein N-linked glycosylation | Back alignment and domain information |
|---|
| >cd04182 GT_2_like_f GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function | Back alignment and domain information |
|---|
| >TIGR00454 conserved hypothetical protein TIGR00454 | Back alignment and domain information |
|---|
| >cd02503 MobA MobA catalyzes the formation of molybdopterin guanine dinucleotide | Back alignment and domain information |
|---|
| >PRK00560 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional | Back alignment and domain information |
|---|
| >cd04179 DPM_DPG-synthase_like DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily | Back alignment and domain information |
|---|
| >TIGR03202 pucB xanthine dehydrogenase accessory protein pucB | Back alignment and domain information |
|---|
| >COG2266 GTP:adenosylcobinamide-phosphate guanylyltransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd00761 Glyco_tranf_GTA_type Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold | Back alignment and domain information |
|---|
| >COG1083 NeuA CMP-N-acetylneuraminic acid synthetase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd06427 CESA_like_2 CESA_like_2 is a member of the cellulose synthase superfamily | Back alignment and domain information |
|---|
| >cd04187 DPM1_like_bac Bacterial DPM1_like enzymes are related to eukaryotic DPM1 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 302 | ||||
| 1tzf_A | 259 | X-Ray Crystal Structure Of Alpha-D-Glucose-1-Phosph | 3e-15 | ||
| 2ggo_A | 401 | Crystal Structure Of Glucose-1-Phosphate Thymidylyl | 7e-12 | ||
| 2qkx_A | 391 | N-Acetyl Glucosamine 1-Phosphate Uridyltransferase | 4e-05 | ||
| 3spt_A | 501 | Crystal Structure Of Glmu From Mycobacterium Tuberc | 7e-05 | ||
| 3d8v_A | 495 | Crystal Structure Of Glmu From Mycobacterium Tuberc | 7e-05 | ||
| 3foq_A | 503 | Crystal Structure Of N-Acetylglucosamine-1-Phosphat | 7e-05 | ||
| 1lvw_A | 295 | Crystal Structure Of Glucose-1-phosphate Thymidylyl | 3e-04 |
| >pdb|1TZF|A Chain A, X-Ray Crystal Structure Of Alpha-D-Glucose-1-Phosphate Cytidylyltransferase From Salmonella Typhi Length = 259 | Back alignment and structure |
|
| >pdb|2GGO|A Chain A, Crystal Structure Of Glucose-1-Phosphate Thymidylyltransferase From Sulfolobus Tokodaii Length = 401 | Back alignment and structure |
| >pdb|2QKX|A Chain A, N-Acetyl Glucosamine 1-Phosphate Uridyltransferase From Mycobacterium Tuberculosis Complex With N-Acetyl Glucosamine 1-Phosphate Length = 391 | Back alignment and structure |
| >pdb|3SPT|A Chain A, Crystal Structure Of Glmu From Mycobacterium Tuberculosis In Complex With Acetyl Coenzyme A And Uridine-Diphosphate-N-Acetylglucosamine Length = 501 | Back alignment and structure |
| >pdb|3D8V|A Chain A, Crystal Structure Of Glmu From Mycobacterium Tuberculosis In Complex With Uridine-Diphosphate-N-Acetylglucosamine Length = 495 | Back alignment and structure |
| >pdb|3FOQ|A Chain A, Crystal Structure Of N-Acetylglucosamine-1-Phosphate Uridyltransferase (Glmu) From Mycobacterium Tuberculosis In A Cubic Space Group Length = 503 | Back alignment and structure |
| >pdb|1LVW|A Chain A, Crystal Structure Of Glucose-1-phosphate Thymidylyltransferase, Rmla, Complex With Dtdp Length = 295 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 302 | |||
| 2xme_A | 232 | CTP-inositol-1-phosphate cytidylyltransferase; CDP | 8e-41 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 2e-37 | |
| 1jyk_A | 254 | LICC protein, CTP:phosphocholine cytidylytransfera | 4e-33 | |
| 1tzf_A | 259 | Glucose-1-phosphate cytidylyltransferase; nucleoti | 7e-25 | |
| 3brk_X | 420 | Glucose-1-phosphate adenylyltransferase; ADP-gluco | 9e-18 | |
| 2v0h_A | 456 | Bifunctional protein GLMU; cell WALL, magnesium, c | 2e-15 | |
| 1yp2_A | 451 | Glucose-1-phosphate adenylyltransferase small subu | 5e-14 | |
| 3rsb_A | 196 | Adenosylcobinamide-phosphate guanylyltransferase; | 8e-13 | |
| 3st8_A | 501 | Bifunctional protein GLMU; acetyltransferase, pyro | 1e-09 | |
| 3st8_A | 501 | Bifunctional protein GLMU; acetyltransferase, pyro | 4e-08 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 1e-09 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 8e-04 | |
| 4fce_A | 459 | Bifunctional protein GLMU; GLMU. csgid, niaid, str | 2e-09 | |
| 4fce_A | 459 | Bifunctional protein GLMU; GLMU. csgid, niaid, str | 2e-06 | |
| 3eh0_A | 341 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr | 1e-08 | |
| 3eh0_A | 341 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr | 2e-07 | |
| 1hm9_A | 468 | GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr | 1e-08 | |
| 1hm9_A | 468 | GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr | 4e-08 | |
| 3pmo_A | 372 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; | 1e-08 | |
| 3pmo_A | 372 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; | 1e-07 | |
| 2iu8_A | 374 | LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 3e-08 | |
| 2iu8_A | 374 | LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 2e-07 | |
| 2ux8_A | 297 | Glucose-1-phosphate uridylyltransferase; UGPG, GAL | 4e-08 | |
| 2e3d_A | 302 | UTP--glucose-1-phosphate uridylyltransferase; UDP- | 1e-07 | |
| 3juk_A | 281 | UDP-glucose pyrophosphorylase (GALU); transfer; HE | 4e-07 | |
| 3mqg_A | 192 | Lipopolysaccharides biosynthesis acetyltransferas; | 1e-06 | |
| 3mqg_A | 192 | Lipopolysaccharides biosynthesis acetyltransferas; | 6e-05 | |
| 2pa4_A | 323 | UTP-glucose-1-phosphate uridylyltransferase; phosp | 2e-06 | |
| 2pig_A | 334 | Putative transferase; SCR6, NESG, YDCK, structural | 6e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-06 | |
| 3t57_A | 305 | UDP-N-acetylglucosamine O-acyltransferase domain- | 1e-05 | |
| 3t57_A | 305 | UDP-N-acetylglucosamine O-acyltransferase domain- | 3e-05 | |
| 3hsq_A | 259 | Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam | 3e-05 | |
| 3hsq_A | 259 | Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam | 9e-05 | |
| 1j2z_A | 270 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 3e-05 | |
| 1j2z_A | 270 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 8e-05 | |
| 4eqy_A | 283 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 4e-05 | |
| 4eqy_A | 283 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 4e-05 | |
| 3r0s_A | 266 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 5e-05 | |
| 3r0s_A | 266 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 5e-05 | |
| 2qia_A | 262 | UDP-N-acetylglucosamine acyltransferase; LEFT-hand | 5e-05 | |
| 4ea9_A | 220 | Perosamine N-acetyltransferase; beta helix, acetyl | 6e-05 | |
| 4ea9_A | 220 | Perosamine N-acetyltransferase; beta helix, acetyl | 1e-04 | |
| 3bfp_A | 194 | Acetyltransferase; LEFT-handed beta helix, COA bin | 9e-05 | |
| 3r8y_A | 240 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac | 3e-04 |
| >2xme_A CTP-inositol-1-phosphate cytidylyltransferase; CDP-inositol, DI-MYO-inositol phosphate; 1.89A {Archaeoglobus fulgidus} PDB: 2xmh_A* Length = 232 | Back alignment and structure |
|---|
Score = 140 bits (356), Expect = 8e-41
Identities = 28/167 (16%), Positives = 63/167 (37%), Gaps = 16/167 (9%)
Query: 3 NFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEM 62
FLK+ KI+ E G L +A++ + + F + D + +
Sbjct: 75 AFLKDK--GFNYKIVRHDRPE-KGNGYSLLVAKNHV----EDRFILTMGDHVYS---QQF 124
Query: 63 IEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGKVEKFVEKPKLFVGNKINAGIYLLNP 122
IE G + + + + + +E+ G+V K + + + ++ G ++L+
Sbjct: 125 IEKAVRGEGVIADREPRFVDIGEATKIRVED--GRVAKIGKDLRE--FDCVDTGFFVLDD 180
Query: 123 AVLDRIELRPTSIEKEVFPKIALEGKLFAMVLP-GFWMDIGQPRDYI 168
++ + E + E+ +I +L + WMD+ D
Sbjct: 181 SIFEHAE-KLRDREEIPLSEIVKLARLPVTYVDGELWMDVDTKEDVR 226
|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401 | Back alignment and structure |
|---|
| >1jyk_A LICC protein, CTP:phosphocholine cytidylytransferase; 3D structure, CTP:phosphocholine cytidylyltransferase; 1.50A {Streptococcus pneumoniae} SCOP: c.68.1.13 PDB: 1jyl_A* Length = 254 | Back alignment and structure |
|---|
| >1tzf_A Glucose-1-phosphate cytidylyltransferase; nucleotidyltransferase, mixed alpha/beta fold; HET: C5G; 2.10A {Salmonella enterica subsp} SCOP: c.68.1.13 PDB: 1wvc_A* Length = 259 | Back alignment and structure |
|---|
| >3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Length = 420 | Back alignment and structure |
|---|
| >2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Length = 456 | Back alignment and structure |
|---|
| >1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Length = 451 | Back alignment and structure |
|---|
| >3rsb_A Adenosylcobinamide-phosphate guanylyltransferase; pyrophosphorylase binding motif, pyrophosphorylase; HET: GTP; 2.80A {Methanocaldococcus jannaschii} Length = 196 | Back alignment and structure |
|---|
| >3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Length = 501 | Back alignment and structure |
|---|
| >3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Length = 501 | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 | Back alignment and structure |
|---|
| >4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Length = 459 | Back alignment and structure |
|---|
| >4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Length = 459 | Back alignment and structure |
|---|
| >3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Length = 341 | Back alignment and structure |
|---|
| >3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Length = 341 | Back alignment and structure |
|---|
| >1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Length = 468 | Back alignment and structure |
|---|
| >1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Length = 468 | Back alignment and structure |
|---|
| >3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Length = 372 | Back alignment and structure |
|---|
| >3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Length = 372 | Back alignment and structure |
|---|
| >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Length = 374 | Back alignment and structure |
|---|
| >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Length = 374 | Back alignment and structure |
|---|
| >2ux8_A Glucose-1-phosphate uridylyltransferase; UGPG, GALU pyrophosphorylase, nucleotidyltransferase; HET: G1P; 2.65A {Sphingomonas elodea} Length = 297 | Back alignment and structure |
|---|
| >2e3d_A UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose, carbohydrate, pyrophosphorylase; 1.95A {Escherichia coli} Length = 302 | Back alignment and structure |
|---|
| >3juk_A UDP-glucose pyrophosphorylase (GALU); transfer; HET: UPG; 2.30A {Helicobacter pylori} PDB: 3juj_A* Length = 281 | Back alignment and structure |
|---|
| >3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Length = 192 | Back alignment and structure |
|---|
| >3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Length = 192 | Back alignment and structure |
|---|
| >2pa4_A UTP-glucose-1-phosphate uridylyltransferase; phosphorylase, nucleotidyltransferase, metabolism; HET: GUD; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 323 | Back alignment and structure |
|---|
| >2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Length = 334 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} Length = 305 | Back alignment and structure |
|---|
| >3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} Length = 305 | Back alignment and structure |
|---|
| >3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} PDB: 3i3a_A* 3i3x_A* Length = 259 | Back alignment and structure |
|---|
| >3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} PDB: 3i3a_A* 3i3x_A* Length = 259 | Back alignment and structure |
|---|
| >1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Length = 270 | Back alignment and structure |
|---|
| >1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Length = 270 | Back alignment and structure |
|---|
| >4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} Length = 283 | Back alignment and structure |
|---|
| >4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} Length = 283 | Back alignment and structure |
|---|
| >3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} Length = 266 | Back alignment and structure |
|---|
| >3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} Length = 266 | Back alignment and structure |
|---|
| >2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A Length = 262 | Back alignment and structure |
|---|
| >4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Length = 220 | Back alignment and structure |
|---|
| >4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Length = 220 | Back alignment and structure |
|---|
| >3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Length = 194 | Back alignment and structure |
|---|
| >3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* Length = 240 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 302 | |||
| 1yp2_A | 451 | Glucose-1-phosphate adenylyltransferase small subu | 100.0 | |
| 3brk_X | 420 | Glucose-1-phosphate adenylyltransferase; ADP-gluco | 100.0 | |
| 3st8_A | 501 | Bifunctional protein GLMU; acetyltransferase, pyro | 100.0 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 100.0 | |
| 1hm9_A | 468 | GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr | 100.0 | |
| 2v0h_A | 456 | Bifunctional protein GLMU; cell WALL, magnesium, c | 99.97 | |
| 4fce_A | 459 | Bifunctional protein GLMU; GLMU. csgid, niaid, str | 99.97 | |
| 3pnn_A | 303 | Conserved domain protein; structural genomics, PSI | 99.88 | |
| 4ecm_A | 269 | Glucose-1-phosphate thymidylyltransferase; HET: DA | 99.88 | |
| 3juk_A | 281 | UDP-glucose pyrophosphorylase (GALU); transfer; HE | 99.87 | |
| 2iu8_A | 374 | LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 99.87 | |
| 3c8v_A | 496 | Putative acetyltransferase; YP_390128.1, structura | 99.87 | |
| 1fxo_A | 293 | Glucose-1-phosphate thymidylyltransferase; rhamnos | 99.82 | |
| 1mc3_A | 296 | Glucose-1-phosphate thymidylyltransferase; glucose | 99.82 | |
| 2e3d_A | 302 | UTP--glucose-1-phosphate uridylyltransferase; UDP- | 99.81 | |
| 1lvw_A | 295 | Glucose-1-phosphate thymidylyltransferase; protein | 99.81 | |
| 1tzf_A | 259 | Glucose-1-phosphate cytidylyltransferase; nucleoti | 99.8 | |
| 3r8y_A | 240 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac | 99.77 | |
| 2ux8_A | 297 | Glucose-1-phosphate uridylyltransferase; UGPG, GAL | 99.76 | |
| 2pa4_A | 323 | UTP-glucose-1-phosphate uridylyltransferase; phosp | 99.76 | |
| 4evw_A | 255 | Nucleoside-diphosphate-sugar pyrophosphorylase; st | 99.76 | |
| 1xhd_A | 173 | Putative acetyltransferase/acyltransferase; struct | 99.72 | |
| 3tv0_A | 194 | Dynactin subunit 6; LEFT-handed beta-helix, ARP11, | 99.71 | |
| 3ixc_A | 191 | Hexapeptide transferase family protein; niaid, ssg | 99.71 | |
| 3r3r_A | 187 | Ferripyochelin binding protein; structural genomic | 99.71 | |
| 1v3w_A | 173 | Ferripyochelin binding protein; beta-helix, carbon | 99.7 | |
| 2qh5_A | 308 | PMI, ALGA, mannose-6-phosphate isomerase; structur | 99.7 | |
| 3r1w_A | 189 | Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid | 99.69 | |
| 3bfp_A | 194 | Acetyltransferase; LEFT-handed beta helix, COA bin | 99.67 | |
| 3vbi_A | 205 | ANTD, galactoside O-acetyltransferase; anthrose, a | 99.67 | |
| 4ea9_A | 220 | Perosamine N-acetyltransferase; beta helix, acetyl | 99.66 | |
| 3oam_A | 252 | 3-deoxy-manno-octulosonate cytidylyltransferase; c | 99.66 | |
| 3mqg_A | 192 | Lipopolysaccharides biosynthesis acetyltransferas; | 99.63 | |
| 3mqg_A | 192 | Lipopolysaccharides biosynthesis acetyltransferas; | 99.63 | |
| 3kwd_A | 213 | Carbon dioxide concentrating mechanism protein; LE | 99.63 | |
| 3eg4_A | 304 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.62 | |
| 3gos_A | 276 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.62 | |
| 1qre_A | 247 | Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth | 99.62 | |
| 4eqy_A | 283 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.61 | |
| 3bfp_A | 194 | Acetyltransferase; LEFT-handed beta helix, COA bin | 99.6 | |
| 3r5d_A | 347 | Tetrahydrodipicolinate N-succinyletransferase; 1.8 | 99.6 | |
| 3tk8_A | 316 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.6 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 99.6 | |
| 1j2z_A | 270 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.59 | |
| 3fsy_A | 332 | Tetrahydrodipicolinate N-succinyltransferase; beta | 99.58 | |
| 4e79_A | 357 | UDP-3-O-acylglucosamine N-acyltransferase; lipopol | 99.57 | |
| 4ea9_A | 220 | Perosamine N-acetyltransferase; beta helix, acetyl | 99.57 | |
| 3r0s_A | 266 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.57 | |
| 3r0s_A | 266 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.57 | |
| 4e6u_A | 265 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.57 | |
| 3eh0_A | 341 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr | 99.56 | |
| 3hsq_A | 259 | Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam | 99.56 | |
| 3r8y_A | 240 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac | 99.55 | |
| 3pmo_A | 372 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; | 99.55 | |
| 4e6u_A | 265 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.55 | |
| 2qia_A | 262 | UDP-N-acetylglucosamine acyltransferase; LEFT-hand | 99.55 | |
| 2x65_A | 336 | Mannose-1-phosphate guanylyltransferase; nucleotid | 99.55 | |
| 3hsq_A | 259 | Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam | 99.54 | |
| 3tk8_A | 316 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.54 | |
| 3pmo_A | 372 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; | 99.53 | |
| 2qia_A | 262 | UDP-N-acetylglucosamine acyltransferase; LEFT-hand | 99.53 | |
| 3ixc_A | 191 | Hexapeptide transferase family protein; niaid, ssg | 99.53 | |
| 1j2z_A | 270 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.53 | |
| 3t57_A | 305 | UDP-N-acetylglucosamine O-acyltransferase domain- | 99.53 | |
| 4e79_A | 357 | UDP-3-O-acylglucosamine N-acyltransferase; lipopol | 99.52 | |
| 3eh0_A | 341 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr | 99.51 | |
| 1xhd_A | 173 | Putative acetyltransferase/acyltransferase; struct | 99.51 | |
| 3jqy_B | 252 | NEUO, polysialic acid O-acetyltransferase; LEFT-ha | 99.51 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 99.51 | |
| 3gos_A | 276 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.51 | |
| 3eg4_A | 304 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.5 | |
| 2cu2_A | 337 | Putative mannose-1-phosphate guanylyl transferase; | 99.49 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 99.49 | |
| 3tv0_A | 194 | Dynactin subunit 6; LEFT-handed beta-helix, ARP11, | 99.49 | |
| 3vbi_A | 205 | ANTD, galactoside O-acetyltransferase; anthrose, a | 99.48 | |
| 3t57_A | 305 | UDP-N-acetylglucosamine O-acyltransferase domain- | 99.48 | |
| 2wlg_A | 215 | Polysialic acid O-acetyltransferase; enzyme, LEFT- | 99.47 | |
| 3r3r_A | 187 | Ferripyochelin binding protein; structural genomic | 99.46 | |
| 3q1x_A | 313 | Serine acetyltransferase; cysteine biosynthesis, L | 99.46 | |
| 2v0h_A | 456 | Bifunctional protein GLMU; cell WALL, magnesium, c | 99.45 | |
| 2rij_A | 387 | Putative 2,3,4,5-tetrahydropyridine-2-carboxylate | 99.45 | |
| 4fce_A | 459 | Bifunctional protein GLMU; GLMU. csgid, niaid, str | 99.45 | |
| 3r1w_A | 189 | Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid | 99.44 | |
| 3tqd_A | 256 | 3-deoxy-manno-octulosonate cytidylyltransferase; c | 99.44 | |
| 3kwd_A | 213 | Carbon dioxide concentrating mechanism protein; LE | 99.44 | |
| 1v3w_A | 173 | Ferripyochelin binding protein; beta-helix, carbon | 99.43 | |
| 3nz2_A | 195 | Hexapeptide-repeat containing-acetyltransferase; s | 99.43 | |
| 3srt_A | 188 | Maltose O-acetyltransferase; structural genomics, | 99.43 | |
| 3k8d_A | 264 | 3-deoxy-manno-octulosonate cytidylyltransferase; K | 99.43 | |
| 3hjj_A | 190 | Maltose O-acetyltransferase; LEFT-handed beta-heli | 99.43 | |
| 4eqy_A | 283 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.42 | |
| 2icy_A | 469 | Probable UTP-glucose-1-phosphate uridylyltransfera | 99.42 | |
| 2pig_A | 334 | Putative transferase; SCR6, NESG, YDCK, structural | 99.41 | |
| 1hm9_A | 468 | GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr | 99.41 | |
| 3ftt_A | 199 | Putative acetyltransferase sacol2570; galactoside | 99.41 | |
| 2iu8_A | 374 | LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 99.41 | |
| 1qre_A | 247 | Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth | 99.41 | |
| 3c8v_A | 496 | Putative acetyltransferase; YP_390128.1, structura | 99.39 | |
| 2pig_A | 334 | Putative transferase; SCR6, NESG, YDCK, structural | 99.39 | |
| 4hur_A | 220 | Virginiamycin A acetyltransferase; structural geno | 99.37 | |
| 1krr_A | 203 | Galactoside O-acetyltransferase; LEFT-handed paral | 99.36 | |
| 2p2o_A | 185 | Maltose transacetylase; GK1921, GKA001001921.1, ge | 99.35 | |
| 1ocx_A | 182 | Maltose O-acetyltransferase; LEFT-handed parallel | 99.35 | |
| 3mc4_A | 287 | WW/RSP5/WWP domain:bacterial transferase hexapept | 99.34 | |
| 3st8_A | 501 | Bifunctional protein GLMU; acetyltransferase, pyro | 99.34 | |
| 3f1x_A | 310 | Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 | 99.33 | |
| 4fcu_A | 253 | 3-deoxy-manno-octulosonate cytidylyltransferase; s | 99.3 | |
| 3hjj_A | 190 | Maltose O-acetyltransferase; LEFT-handed beta-heli | 99.3 | |
| 3r5d_A | 347 | Tetrahydrodipicolinate N-succinyletransferase; 1.8 | 99.29 | |
| 3fsy_A | 332 | Tetrahydrodipicolinate N-succinyltransferase; beta | 99.29 | |
| 1jyk_A | 254 | LICC protein, CTP:phosphocholine cytidylytransfera | 99.28 | |
| 2y6p_A | 234 | 3-deoxy-manno-octulosonate cytidylyltransferase; l | 99.28 | |
| 3jqy_B | 252 | NEUO, polysialic acid O-acetyltransferase; LEFT-ha | 99.27 | |
| 3q1x_A | 313 | Serine acetyltransferase; cysteine biosynthesis, L | 99.26 | |
| 1ssq_A | 267 | SAT, serine acetyltransferase; LEFT-handed paralle | 99.25 | |
| 1vic_A | 262 | 3-deoxy-manno-octulosonate cytidylyltransferase; s | 99.25 | |
| 3nz2_A | 195 | Hexapeptide-repeat containing-acetyltransferase; s | 99.24 | |
| 3ftt_A | 199 | Putative acetyltransferase sacol2570; galactoside | 99.23 | |
| 1t3d_A | 289 | SAT, serine acetyltransferase; LEFT-handed-beta-he | 99.22 | |
| 2wlg_A | 215 | Polysialic acid O-acetyltransferase; enzyme, LEFT- | 99.21 | |
| 1yp2_A | 451 | Glucose-1-phosphate adenylyltransferase small subu | 99.2 | |
| 1krr_A | 203 | Galactoside O-acetyltransferase; LEFT-handed paral | 99.19 | |
| 1ocx_A | 182 | Maltose O-acetyltransferase; LEFT-handed parallel | 99.19 | |
| 2rij_A | 387 | Putative 2,3,4,5-tetrahydropyridine-2-carboxylate | 99.18 | |
| 2xme_A | 232 | CTP-inositol-1-phosphate cytidylyltransferase; CDP | 99.17 | |
| 1ssq_A | 267 | SAT, serine acetyltransferase; LEFT-handed paralle | 99.16 | |
| 3mc4_A | 287 | WW/RSP5/WWP domain:bacterial transferase hexapept | 99.16 | |
| 3f1x_A | 310 | Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 | 99.16 | |
| 3srt_A | 188 | Maltose O-acetyltransferase; structural genomics, | 99.14 | |
| 1t3d_A | 289 | SAT, serine acetyltransferase; LEFT-handed-beta-he | 99.13 | |
| 3eev_A | 212 | Chloramphenicol acetyltransferase; beta-helix, str | 99.12 | |
| 2p2o_A | 185 | Maltose transacetylase; GK1921, GKA001001921.1, ge | 99.12 | |
| 3brk_X | 420 | Glucose-1-phosphate adenylyltransferase; ADP-gluco | 99.07 | |
| 4e8l_A | 219 | Virginiamycin A acetyltransferase; structural geno | 99.05 | |
| 1h7e_A | 245 | 3-deoxy-manno-octulosonate cytidylyltransferase; n | 99.05 | |
| 4hur_A | 220 | Virginiamycin A acetyltransferase; structural geno | 99.01 | |
| 1mr7_A | 209 | Streptogramin A acetyltransferase; LEFT-handed par | 98.99 | |
| 2i5k_A | 488 | UTP--glucose-1-phosphate uridylyltransferase; LEFT | 98.9 | |
| 1xat_A | 212 | Xenobiotic acetyltransferase; chloramphenicol, LEF | 98.84 | |
| 3eev_A | 212 | Chloramphenicol acetyltransferase; beta-helix, str | 98.82 | |
| 4e8l_A | 219 | Virginiamycin A acetyltransferase; structural geno | 98.74 | |
| 1mr7_A | 209 | Streptogramin A acetyltransferase; LEFT-handed par | 98.72 | |
| 2dpw_A | 232 | Hypothetical protein TTHA0179; transferase, struct | 98.7 | |
| 1jv1_A | 505 | Glcnac1P uridyltransferase isoform 1: AGX1; nucleo | 98.7 | |
| 1ezi_A | 228 | CMP-N-acetylneuraminic acid synthetase; homodimer, | 98.66 | |
| 1xat_A | 212 | Xenobiotic acetyltransferase; chloramphenicol, LEF | 98.62 | |
| 1qwj_A | 229 | Cytidine monophospho-N-acetylneuraminic acid synth | 98.42 | |
| 2xwl_A | 223 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; | 98.35 | |
| 2vsh_A | 236 | TARI, 2-C-methyl-D-erythritol 4-phosphate cytidyly | 98.13 | |
| 2yc3_A | 228 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltran | 97.93 | |
| 3f1c_A | 246 | Putative 2-C-methyl-D-erythritol 4-phosphate cytid | 97.83 | |
| 2oeg_A | 505 | UTP-glucose-1-phosphate uridylyltransferase 2, put | 97.81 | |
| 1vgw_A | 231 | 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; | 97.74 | |
| 2waw_A | 199 | MOBA relate protein; unknown function; HET: PGE; 1 | 97.63 | |
| 3oc9_A | 405 | UDP-N-acetylglucosamine pyrophosphorylase; structu | 97.61 | |
| 2wee_A | 197 | MOBA-related protein; unknown function; 1.65A {Myc | 97.35 | |
| 3rsb_A | 196 | Adenosylcobinamide-phosphate guanylyltransferase; | 97.3 | |
| 2yqc_A | 486 | UDP-N-acetylglucosamine pyrophosphorylase; uridine | 97.23 | |
| 2px7_A | 236 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans | 97.19 | |
| 1vpa_A | 234 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; | 97.17 | |
| 2e8b_A | 201 | Probable molybdopterin-guanine dinucleotide biosy | 97.08 | |
| 1i52_A | 236 | 4-diphosphocytidyl-2-C-methylerythritol synthase; | 96.79 | |
| 3d5n_A | 197 | Q97W15_sulso; NESG, SSR125, structural genomics, P | 96.24 | |
| 1e5k_A | 201 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.26 | |
| 3q80_A | 231 | 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; | 94.95 | |
| 3ngw_A | 208 | Molybdopterin-guanine dinucleotide biosynthesis P | 94.42 | |
| 1w55_A | 371 | ISPD/ISPF bifunctional enzyme; biosynthetic pathwa | 90.82 | |
| 1xhb_A | 472 | Polypeptide N-acetylgalactosaminyltransferase 1; g | 84.24 |
| >1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=3.9e-35 Score=271.95 Aligned_cols=264 Identities=19% Similarity=0.307 Sum_probs=204.1
Q ss_pred CCCChHHHHHcHhhhccCCCCcEEEEeCCeecCcCHHHHHHHHHHcCCcEEEEEEeCC--CCCCcceEEEeCCCCcEEEE
Q 022113 24 PLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVD--EPSKYGVVVMEESTGKVEKF 101 (302)
Q Consensus 24 ~~Gt~~al~~a~~~i~~~~~~~~lv~~gD~l~~~~l~~~~~~~~~~~~~~~l~~~~~~--~~~~~g~v~~d~~~~~v~~~ 101 (302)
++||+++|+.+++++.....++|++++||++++.++.++++.|+++++++|+++.+.+ ++..||++.+|+ +++++.|
T Consensus 117 ~~Gt~~al~~a~~~~~~~~~~~~lv~~~D~~~~~~l~~l~~~~~~~~~~~tl~~~~~~~~~~~~~g~v~~d~-~~~v~~~ 195 (451)
T 1yp2_A 117 FQGTADAVRQYLWLFEEHTVLEYLILAGDHLYRMDYEKFIQAHRETDADITVAALPMDEKRATAFGLMKIDE-EGRIIEF 195 (451)
T ss_dssp CCSHHHHHHHTHHHHTTSCCSEEEEECSCEECCCCHHHHHHHHHHTTCSEEEEEEEECHHHHTTSEEEEECT-TSBEEEE
T ss_pred ccCcHHHHHHHHHHHHhcCCCeEEEecCcEEEcCCHHHHHHHHHHcCCcEEEEEEEcChhhcccCCEEEECC-CCCEEEE
Confidence 5899999999999885322378999999999999999999999998889998888764 567899999985 7899999
Q ss_pred EecCCCC---------------------CCCeEEEEEEEeCHhhH-hhccC---CCCCccccchHHHHhc-CcEEEEEec
Q 022113 102 VEKPKLF---------------------VGNKINAGIYLLNPAVL-DRIEL---RPTSIEKEVFPKIALE-GKLFAMVLP 155 (302)
Q Consensus 102 ~ekp~~~---------------------~~~~~~~Giy~~~~~~l-~~l~~---~~~~~~~~~~~~l~~~-~~v~~~~~~ 155 (302)
.|||... ...++++|+|+|++++| +.++. ...++..++++.++++ .++.++.++
T Consensus 196 ~ekp~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~Giy~~~~~~l~~~l~~~~~~~~~~~~~~l~~~i~~g~~v~~~~~~ 275 (451)
T 1yp2_A 196 AEKPQGEQLQAMKVDTTILGLDDKRAKEMPFIASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPGATSLGMRVQAYLYD 275 (451)
T ss_dssp EESCCHHHHHHTCCCGGGGSCCHHHHHHCCEEEEEEEEEEEHHHHHHHHHTTCTTCCCTTTTHHHHHHHTTCCEEEEECC
T ss_pred EECCCchhhccccccccccccccccccCCcceEEeeEEEEcHHHHHHHHHhhcccccchHhhHHHHHHhcCCceEEEEeC
Confidence 9999632 24689999999999987 44443 2234555778887776 689999999
Q ss_pred CeeEecCChHHHHHHHHHHHHhhcc-----cc------ccccccCceEecceEEcCCcEECCCCEECC----CcEECCCC
Q 022113 156 GFWMDIGQPRDYITGLRLYLDSLRK-----KS------SLKLATGANIVGNVLVHESAQIGEGCLIGP----DVAVGPGC 220 (302)
Q Consensus 156 g~~~digt~~~~~~a~~~~l~~~~~-----~~------~~~~~~~~~i~~~~~i~~~~~i~~~~~i~~----~~~ig~~~ 220 (302)
++|.|+++|++|.++++.+++.... .. .+.+.+++.+ +++.| .++.||++|.|++ +++||++|
T Consensus 276 ~~w~digt~~~l~~a~~~l~~~~~~~~~~~~~~~~i~~~~~i~~~~~i-~~~~I-~~~~Ig~~~~I~~~~i~~~~Ig~~~ 353 (451)
T 1yp2_A 276 GYWEDIGTIEAFYNANLGITKKPVPDFSFYDRSAPIYTQPRYLPPSKM-LDADV-TDSVIGEGCVIKNCKIHHSVVGLRS 353 (451)
T ss_dssp SCCEECSSHHHHHHHHHGGGCSSSCSSCSCCSSSCCCCCCCCCCCEEE-EEEEE-EEEEECTTCEEEEEEEESCEECTTC
T ss_pred CEEEECCCHHHHHHHHHHHhcccccchhccCCCCeeccCCccCCCeEE-cceEE-eCeEECCCCEEcceEEeccEECCCC
Confidence 9999999999999998876543311 01 1223333333 22333 3455566665554 88999999
Q ss_pred EECCCcEEeceEEccC-------------------CEECCCcEEeccEECCCCEECCCcEEccCc------EECCCcEEC
Q 022113 221 VVESGVRLSRCTVMRG-------------------VRIKKHACISSSIIGWHSTVGQWARVENMT------ILGEDVHVC 275 (302)
Q Consensus 221 ~i~~~~~i~~~~i~~~-------------------~~i~~~~~i~~~~i~~~~~i~~~~~i~~~~------~i~~~~~v~ 275 (302)
.||++|.|.++++..+ +.||+++.|++++|+++|+||+++.|.+++ .||+++.||
T Consensus 354 ~Ig~~~~I~~~~~~~~~~~~~~~~~~~~~~~g~~~~~Ig~~~~i~~~~Ig~~~~IG~~~~i~~~~~~~~~~~ig~~~~ig 433 (451)
T 1yp2_A 354 CISEGAIIEDSLLMGADYYETDADRKLLAAKGSVPIGIGKNCHIKRAIIDKNARIGDNVKIINKDNVQEAARETDGYFIK 433 (451)
T ss_dssp EECTTCEEESCEECCCSSCCCHHHHHHHHTTTCCCSEECTTCEEESEEECTTCEECTTCEECCSSCCSCEEEGGGTEEEE
T ss_pred EECCCCEEcCceEECCCCcccccccccccccCceeEEECCCCEEeccEeCCCcEECCCCEEeCCcccccCceeCCCEEEc
Confidence 9999999998888877 999999999999999999999999998653 567777777
Q ss_pred Cce-EEcCCeEecCcc
Q 022113 276 DEI-YSNGGVVLPHKE 290 (302)
Q Consensus 276 ~~~-~v~~~~v~~~~~ 290 (302)
+++ .|++++++++..
T Consensus 434 ~~~v~Ig~~a~i~ags 449 (451)
T 1yp2_A 434 SGIVTVIKDALIPSGI 449 (451)
T ss_dssp TTEEEECTTCEECTTC
T ss_pred CCEEEECCCcEECCCc
Confidence 764 467777776654
|
| >3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* | Back alignment and structure |
|---|
| >1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* | Back alignment and structure |
|---|
| >2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* | Back alignment and structure |
|---|
| >4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* | Back alignment and structure |
|---|
| >3pnn_A Conserved domain protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: MSE GOL; 1.90A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >4ecm_A Glucose-1-phosphate thymidylyltransferase; HET: DAU; 2.30A {Bacillus anthracis} PDB: 3hl3_A* | Back alignment and structure |
|---|
| >3juk_A UDP-glucose pyrophosphorylase (GALU); transfer; HET: UPG; 2.30A {Helicobacter pylori} PDB: 3juj_A* | Back alignment and structure |
|---|
| >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* | Back alignment and structure |
|---|
| >3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >1fxo_A Glucose-1-phosphate thymidylyltransferase; rhamnose, nucleotidyltransferase, pyrophosphorylase, allostery; HET: TMP; 1.66A {Pseudomonas aeruginosa} SCOP: c.68.1.6 PDB: 1fzw_A 1g0r_A* 1g1l_A* 1g23_A* 1g2v_A* 1g3l_A* 1h5r_A* 1h5s_C* 1h5t_A* 1h5s_D* 1h5s_A* 1h5r_B* 1h5s_B* 1h5t_B* 1iim_A* 1iin_A* 3pkp_A* 3pkq_A* 1mp5_A* 1mp3_A* ... | Back alignment and structure |
|---|
| >1mc3_A Glucose-1-phosphate thymidylyltransferase; glucose-1-phosphate thymidylytransferase, RFFH; HET: TTP; 2.60A {Escherichia coli} SCOP: c.68.1.6 | Back alignment and structure |
|---|
| >2e3d_A UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose, carbohydrate, pyrophosphorylase; 1.95A {Escherichia coli} | Back alignment and structure |
|---|
| >1lvw_A Glucose-1-phosphate thymidylyltransferase; protein nucleotide complex, nucleotide binding fold; HET: TYD; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.68.1.6 | Back alignment and structure |
|---|
| >1tzf_A Glucose-1-phosphate cytidylyltransferase; nucleotidyltransferase, mixed alpha/beta fold; HET: C5G; 2.10A {Salmonella enterica subsp} SCOP: c.68.1.13 PDB: 1wvc_A* | Back alignment and structure |
|---|
| >3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* | Back alignment and structure |
|---|
| >2ux8_A Glucose-1-phosphate uridylyltransferase; UGPG, GALU pyrophosphorylase, nucleotidyltransferase; HET: G1P; 2.65A {Sphingomonas elodea} | Back alignment and structure |
|---|
| >2pa4_A UTP-glucose-1-phosphate uridylyltransferase; phosphorylase, nucleotidyltransferase, metabolism; HET: GUD; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >4evw_A Nucleoside-diphosphate-sugar pyrophosphorylase; structural genomics, PSI-biology; HET: MSE; 1.90A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A | Back alignment and structure |
|---|
| >3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A | Back alignment and structure |
|---|
| >1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A | Back alignment and structure |
|---|
| >2qh5_A PMI, ALGA, mannose-6-phosphate isomerase; structural genomics, PSI, protein structure initi nysgrc; 2.30A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} | Back alignment and structure |
|---|
| >3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A | Back alignment and structure |
|---|
| >3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* | Back alignment and structure |
|---|
| >4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* | Back alignment and structure |
|---|
| >3oam_A 3-deoxy-manno-octulosonate cytidylyltransferase; center for structural genomics of infectious diseases; 1.75A {Vibrio cholerae o1 biovar el tor} SCOP: c.68.1.13 | Back alignment and structure |
|---|
| >3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* | Back alignment and structure |
|---|
| >3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* | Back alignment and structure |
|---|
| >3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A | Back alignment and structure |
|---|
| >3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} | Back alignment and structure |
|---|
| >3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A | Back alignment and structure |
|---|
| >1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A | Back alignment and structure |
|---|
| >4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A | Back alignment and structure |
|---|
| >3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A | Back alignment and structure |
|---|
| >3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* | Back alignment and structure |
|---|
| >1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 | Back alignment and structure |
|---|
| >3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* | Back alignment and structure |
|---|
| >4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A | Back alignment and structure |
|---|
| >4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* | Back alignment and structure |
|---|
| >3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 | Back alignment and structure |
|---|
| >3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 | Back alignment and structure |
|---|
| >4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* | Back alignment and structure |
|---|
| >3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* | Back alignment and structure |
|---|
| >3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* | Back alignment and structure |
|---|
| >3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* | Back alignment and structure |
|---|
| >2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A | Back alignment and structure |
|---|
| >2x65_A Mannose-1-phosphate guanylyltransferase; nucleotidyltransferase; HET: M1P; 2.10A {Thermotoga maritima} PDB: 2x5z_A* 2x60_A* 2x5s_A* | Back alignment and structure |
|---|
| >3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* | Back alignment and structure |
|---|
| >3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A | Back alignment and structure |
|---|
| >3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 | Back alignment and structure |
|---|
| >3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A | Back alignment and structure |
|---|
| >3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A | Back alignment and structure |
|---|
| >3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* | Back alignment and structure |
|---|
| >3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A | Back alignment and structure |
|---|
| >3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} | Back alignment and structure |
|---|
| >2cu2_A Putative mannose-1-phosphate guanylyl transferase; mannose-1-phosphate geranyltransferase, thermus thermophilus structural genomics; 2.20A {Thermus thermophilus} SCOP: b.81.4.1 c.68.1.20 | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* | Back alignment and structure |
|---|
| >3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* | Back alignment and structure |
|---|
| >3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* | Back alignment and structure |
|---|
| >3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A | Back alignment and structure |
|---|
| >3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A | Back alignment and structure |
|---|
| >2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* | Back alignment and structure |
|---|
| >2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* | Back alignment and structure |
|---|
| >3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} | Back alignment and structure |
|---|
| >3tqd_A 3-deoxy-manno-octulosonate cytidylyltransferase; cell envelope; 1.80A {Coxiella burnetii} SCOP: c.68.1.0 | Back alignment and structure |
|---|
| >3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A | Back alignment and structure |
|---|
| >1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A | Back alignment and structure |
|---|
| >3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* | Back alignment and structure |
|---|
| >3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* | Back alignment and structure |
|---|
| >3k8d_A 3-deoxy-manno-octulosonate cytidylyltransferase; KDSB synthetase KDO complex, lipopolysaccharide biosynthesis magnesium, nucleotidyltransferase; HET: KDO CTP; 1.90A {Escherichia coli} SCOP: c.68.1.13 PDB: 3k8e_C 1vh1_A 3jtj_A* | Back alignment and structure |
|---|
| >3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* | Back alignment and structure |
|---|
| >4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A | Back alignment and structure |
|---|
| >1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* | Back alignment and structure |
|---|
| >3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A | Back alignment and structure |
|---|
| >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* | Back alignment and structure |
|---|
| >1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A | Back alignment and structure |
|---|
| >3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A | Back alignment and structure |
|---|
| >4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A | Back alignment and structure |
|---|
| >1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* | Back alignment and structure |
|---|
| >2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A | Back alignment and structure |
|---|
| >1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* | Back alignment and structure |
|---|
| >3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} | Back alignment and structure |
|---|
| >4fcu_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.90A {Acinetobacter baumannii} PDB: 3pol_A | Back alignment and structure |
|---|
| >3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* | Back alignment and structure |
|---|
| >3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A | Back alignment and structure |
|---|
| >3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* | Back alignment and structure |
|---|
| >1jyk_A LICC protein, CTP:phosphocholine cytidylytransferase; 3D structure, CTP:phosphocholine cytidylyltransferase; 1.50A {Streptococcus pneumoniae} SCOP: c.68.1.13 PDB: 1jyl_A* | Back alignment and structure |
|---|
| >2y6p_A 3-deoxy-manno-octulosonate cytidylyltransferase; lipid A; HET: CTP; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A | Back alignment and structure |
|---|
| >1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* | Back alignment and structure |
|---|
| >1vic_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics; 1.80A {Haemophilus influenzae} SCOP: c.68.1.13 PDB: 1vh3_A 3duv_A* | Back alignment and structure |
|---|
| >3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* | Back alignment and structure |
|---|
| >3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A | Back alignment and structure |
|---|
| >1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 | Back alignment and structure |
|---|
| >2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* | Back alignment and structure |
|---|
| >1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* | Back alignment and structure |
|---|
| >1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* | Back alignment and structure |
|---|
| >1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >2xme_A CTP-inositol-1-phosphate cytidylyltransferase; CDP-inositol, DI-MYO-inositol phosphate; 1.89A {Archaeoglobus fulgidus} PDB: 2xmh_A* | Back alignment and structure |
|---|
| >1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* | Back alignment and structure |
|---|
| >3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} | Back alignment and structure |
|---|
| >3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* | Back alignment and structure |
|---|
| >1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 | Back alignment and structure |
|---|
| >3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A | Back alignment and structure |
|---|
| >3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1h7e_A 3-deoxy-manno-octulosonate cytidylyltransferase; nucleotidyltransferase, CMP-KDO synthetase, nucleoside monophosphate glycosides; 1.83A {Escherichia coli} SCOP: c.68.1.13 PDB: 1gqc_A* 1gq9_A 1h6j_A 1h7f_A* 1h7g_A* 1h7h_A* 1h7t_A* | Back alignment and structure |
|---|
| >4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A | Back alignment and structure |
|---|
| >1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* | Back alignment and structure |
|---|
| >2i5k_A UTP--glucose-1-phosphate uridylyltransferase; LEFT-handed beta-helix, SGC domain; 3.10A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* | Back alignment and structure |
|---|
| >3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* | Back alignment and structure |
|---|
| >2dpw_A Hypothetical protein TTHA0179; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 2.90A {Thermus thermophilus} SCOP: c.68.1.19 | Back alignment and structure |
|---|
| >1jv1_A Glcnac1P uridyltransferase isoform 1: AGX1; nucleotidyltransferase, alternative splicing; HET: UD1; 1.90A {Homo sapiens} SCOP: c.68.1.5 PDB: 1jv3_A* 1jvg_A* 1jvd_A* 1vm8_A* | Back alignment and structure |
|---|
| >1ezi_A CMP-N-acetylneuraminic acid synthetase; homodimer, alpha-beta-alpha, transferase; 2.00A {Neisseria meningitidis} SCOP: c.68.1.13 PDB: 1eyr_A | Back alignment and structure |
|---|
| >1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* | Back alignment and structure |
|---|
| >1qwj_A Cytidine monophospho-N-acetylneuraminic acid synthetase; CMP-5-N-acetylneuraminic acid synthetase, CMP-NEU5AC, sialic acid, glycosylation; HET: NCC; 2.80A {Mus musculus} SCOP: c.68.1.13 | Back alignment and structure |
|---|
| >2xwl_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; transferase, MEP pathway; HET: CTP; 1.49A {Mycobacterium smegmatis} PDB: 2xwm_A* | Back alignment and structure |
|---|
| >2vsh_A TARI, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; nucleotidyltransferase; HET: 1PE PG4 P6G; 2.00A {Streptococcus pneumoniae} PDB: 2vsi_A* | Back alignment and structure |
|---|
| >2yc3_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran chloroplastic; transferase, non-mevalonate-pathway, herbicide, allosteric P; HET: MW5; 1.40A {Arabidopsis thaliana} PDB: 2yc5_A* 1w77_A* 2ycm_A* | Back alignment and structure |
|---|
| >3f1c_A Putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 2; structural genomics, PSI-2, protein structure initiative; 2.30A {Listeria monocytogenes str} SCOP: c.68.1.0 | Back alignment and structure |
|---|
| >2oeg_A UTP-glucose-1-phosphate uridylyltransferase 2, putative; rossmann-fold, beta-helix, pyrophosphorylase; HET: UPG; 2.30A {Leishmania major} PDB: 2oef_A* | Back alignment and structure |
|---|
| >1vgw_A 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; structural genomics, transferase; 2.35A {Neisseria gonorrhoeae} SCOP: c.68.1.13 PDB: 1vgz_A | Back alignment and structure |
|---|
| >2waw_A MOBA relate protein; unknown function; HET: PGE; 1.60A {Mycobacterium SP} | Back alignment and structure |
|---|
| >3oc9_A UDP-N-acetylglucosamine pyrophosphorylase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.80A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >2wee_A MOBA-related protein; unknown function; 1.65A {Mycobacterium tuberculosis H37RV} PDB: 2we9_A 2yes_A | Back alignment and structure |
|---|
| >3rsb_A Adenosylcobinamide-phosphate guanylyltransferase; pyrophosphorylase binding motif, pyrophosphorylase; HET: GTP; 2.80A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2yqc_A UDP-N-acetylglucosamine pyrophosphorylase; uridine-diphospho-N- acetylglucosamine, N-acetylglucosamine-1-phosphate, transferase; 1.90A {Candida albicans} PDB: 2yqh_A* 2yqj_A* 2yqs_A* | Back alignment and structure |
|---|
| >2px7_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; TTHA0171, ISPD_THET8, ISPD, structural genomics PSI; 2.20A {Thermus thermophilus HB8} | Back alignment and structure |
|---|
| >1vpa_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; TM1393, JCSG, joint center for structural GENO PSI, protein structure initiative; HET: CTP; 2.67A {Thermotoga maritima} SCOP: c.68.1.13 | Back alignment and structure |
|---|
| >2e8b_A Probable molybdopterin-guanine dinucleotide biosy protein A; putative protein, molybdenum cofactor, structural G NPPSFA; 1.61A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1i52_A 4-diphosphocytidyl-2-C-methylerythritol synthase; cytidylyltransferase, deoxyxylulose-5-phosphate pathway (DXP isoprenoid biosynthesys, MEP; HET: CTP; 1.50A {Escherichia coli} SCOP: c.68.1.13 PDB: 1ini_A* 1inj_A 1vgt_A 1vgu_A 3n9w_A 1h3m_A | Back alignment and structure |
|---|
| >3d5n_A Q97W15_sulso; NESG, SSR125, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.80A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1e5k_A Molybdopterin-guanine dinucleotide biosynthesis protein A; molybdopterin nucleotidyl-transferase,; HET: CIT; 1.35A {Escherichia coli} SCOP: c.68.1.8 PDB: 1h4e_A* 1hjl_A* 1hjj_A* 1h4c_A* 1h4d_A* 1fr9_A 1frw_A* | Back alignment and structure |
|---|
| >3q80_A 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; TB structural genomics consortium, TBSGC, rossman fold; HET: CDM; 2.00A {Mycobacterium tuberculosis} SCOP: c.68.1.0 PDB: 3q7u_A* 3okr_A 2xwn_A* | Back alignment and structure |
|---|
| >3ngw_A Molybdopterin-guanine dinucleotide biosynthesis P (MOBA); alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.31A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1w55_A ISPD/ISPF bifunctional enzyme; biosynthetic pathway, isoprenoids, nonmevalonate, transferase; HET: C GPP; 2.3A {Campylobacter jejuni} SCOP: c.68.1.13 d.79.5.1 PDB: 1w57_A* | Back alignment and structure |
|---|
| >1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 302 | ||||
| d1mc3a_ | 291 | c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} | 2e-28 | |
| d1fxoa_ | 292 | c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa | 4e-27 | |
| d1lvwa_ | 295 | c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacteri | 3e-22 | |
| d1tzfa_ | 259 | c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransf | 1e-15 | |
| d1yp2a2 | 307 | c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltr | 2e-15 | |
| d1fxja1 | 78 | b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha | 2e-10 | |
| d1fxja1 | 78 | b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha | 7e-04 | |
| d2jf2a1 | 262 | b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltra | 2e-07 | |
| d2jf2a1 | 262 | b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltra | 1e-04 | |
| d2f9ca1 | 320 | b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salm | 2e-07 | |
| d2f9ca1 | 320 | b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salm | 2e-06 | |
| d2f9ca1 | 320 | b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salm | 5e-06 | |
| d2f9ca1 | 320 | b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salm | 0.004 | |
| d1j2za_ | 259 | b.81.1.1 (A:) UDP N-acetylglucosamine acyltransfer | 2e-07 | |
| d1g97a2 | 250 | c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate | 0.002 | |
| d2oi6a1 | 201 | b.81.1.4 (A:252-452) N-acetylglucosamine 1-phospha | 0.002 | |
| d2oi6a1 | 201 | b.81.1.4 (A:252-452) N-acetylglucosamine 1-phospha | 0.003 | |
| d1v3wa_ | 173 | b.81.1.5 (A:) Ferripyochelin binding protein {Arch | 0.004 | |
| d1g97a1 | 196 | b.81.1.4 (A:252-447) N-acetylglucosamine 1-phospha | 0.004 |
| >d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} Length = 291 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Nucleotide-diphospho-sugar transferases superfamily: Nucleotide-diphospho-sugar transferases family: glucose-1-phosphate thymidylyltransferase domain: RffH species: Escherichia coli [TaxId: 562]
Score = 108 bits (271), Expect = 2e-28
Identities = 36/184 (19%), Positives = 71/184 (38%), Gaps = 11/184 (5%)
Query: 11 KLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHG 70
+ GI++ +++ P G A + L + VL ++ F+ + A
Sbjct: 71 EFGIQLEYAEQPSPDGLAQAFIIGETFLNGE--PSCLVLGDNIFFGQGFSPKLRHVAART 128
Query: 71 GEASIMVTKVDEPSKYGVVVMEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIEL 130
A++ +V +P ++GVV ++ + EKPK N G+Y + V++ +
Sbjct: 129 EGATVFGYQVMDPERFGVVEFDD-NFRAISLEEKPKQPKSNWAVTGLYFYDSKVVEYAKQ 187
Query: 131 RPTSIEKE-----VFPKIALEGKLFAMVLP--GFWMDIGQPRDYITGLRLYLDSLRKKSS 183
S E + G L +L W+D G I ++ ++ K+
Sbjct: 188 VKPSERGELEITSINQMYLEAGNLTVELLGRGFAWLDTGTHDSLIEAST-FVQTVEKRQG 246
Query: 184 LKLA 187
K+A
Sbjct: 247 FKIA 250
|
| >d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 | Back information, alignment and structure |
|---|
| >d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 295 | Back information, alignment and structure |
|---|
| >d1tzfa_ c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium [TaxId: 90371]} Length = 259 | Back information, alignment and structure |
|---|
| >d1yp2a2 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 307 | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 | Back information, alignment and structure |
|---|
| >d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Length = 262 | Back information, alignment and structure |
|---|
| >d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Length = 262 | Back information, alignment and structure |
|---|
| >d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Length = 320 | Back information, alignment and structure |
|---|
| >d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Length = 320 | Back information, alignment and structure |
|---|
| >d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Length = 320 | Back information, alignment and structure |
|---|
| >d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Length = 320 | Back information, alignment and structure |
|---|
| >d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Length = 259 | Back information, alignment and structure |
|---|
| >d1g97a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 250 | Back information, alignment and structure |
|---|
| >d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 201 | Back information, alignment and structure |
|---|
| >d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 201 | Back information, alignment and structure |
|---|
| >d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 173 | Back information, alignment and structure |
|---|
| >d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 196 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 302 | |||
| d1fxoa_ | 292 | RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} | 99.94 | |
| d1mc3a_ | 291 | RffH {Escherichia coli [TaxId: 562]} | 99.94 | |
| d1lvwa_ | 295 | RmlA (RfbA) {Archaeon Methanobacterium thermoautot | 99.83 | |
| d1yp2a2 | 307 | Glucose-1-phosphate adenylyltransferase small subu | 99.76 | |
| d3bswa1 | 193 | Acetyltransferase PglD {Campylobacter jejuni [TaxI | 99.66 | |
| d2cu2a2 | 268 | Putative mannose-1-phosphate guanylyl transferase | 99.65 | |
| d1j2za_ | 259 | UDP N-acetylglucosamine acyltransferase {Helicobac | 99.61 | |
| d1fxja1 | 78 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.61 | |
| d1qrea_ | 210 | gamma-carbonic anhydrase {Archaeon Methanosarcina | 99.59 | |
| d1xhda_ | 172 | Putative acetyltransferase/acyltransferase BC4754 | 99.58 | |
| d3bswa1 | 193 | Acetyltransferase PglD {Campylobacter jejuni [TaxI | 99.56 | |
| d2jf2a1 | 262 | UDP N-acetylglucosamine acyltransferase {Escherich | 99.56 | |
| d2jf2a1 | 262 | UDP N-acetylglucosamine acyltransferase {Escherich | 99.56 | |
| d1tzfa_ | 259 | Glucose-1-phosphate cytidylyltransferase RfbF {Sal | 99.53 | |
| d1krra_ | 200 | Galactoside acetyltransferase {Escherichia coli [T | 99.48 | |
| d1v3wa_ | 173 | Ferripyochelin binding protein {Archaeon Pyrococcu | 99.48 | |
| d1fxja1 | 78 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.46 | |
| d3tdta_ | 274 | Tetrahydrodipicolinate-N-succinlytransferase, THDP | 99.45 | |
| d1j2za_ | 259 | UDP N-acetylglucosamine acyltransferase {Helicobac | 99.44 | |
| d1g97a1 | 196 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.42 | |
| d1xhda_ | 172 | Putative acetyltransferase/acyltransferase BC4754 | 99.4 | |
| d1qrea_ | 210 | gamma-carbonic anhydrase {Archaeon Methanosarcina | 99.39 | |
| d1ocxa_ | 182 | Maltose O-acetyltransferase {Escherichia coli [Tax | 99.39 | |
| d1g97a1 | 196 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.38 | |
| d1yp2a1 | 135 | Glucose-1-phosphate adenylyltransferase small subu | 99.37 | |
| d1jyka_ | 229 | CTP:phosphocholine cytidylytransferase LicC {Strep | 99.32 | |
| d1v3wa_ | 173 | Ferripyochelin binding protein {Archaeon Pyrococcu | 99.32 | |
| d1yp2a1 | 135 | Glucose-1-phosphate adenylyltransferase small subu | 99.29 | |
| d1g97a2 | 250 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.28 | |
| d1mr7a_ | 203 | Xenobiotic acetyltransferase {Enterococcus faecium | 99.28 | |
| d3tdta_ | 274 | Tetrahydrodipicolinate-N-succinlytransferase, THDP | 99.2 | |
| d2oi6a1 | 201 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.19 | |
| d1ocxa_ | 182 | Maltose O-acetyltransferase {Escherichia coli [Tax | 99.18 | |
| d1krra_ | 200 | Galactoside acetyltransferase {Escherichia coli [T | 99.15 | |
| d2oi6a1 | 201 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.1 | |
| d1ssqa_ | 241 | Serine acetyltransferase {Haemophilus influenzae [ | 99.05 | |
| d1xata_ | 208 | Xenobiotic acetyltransferase {Pseudomonas aerugino | 99.0 | |
| d1ssqa_ | 241 | Serine acetyltransferase {Haemophilus influenzae [ | 98.8 | |
| d1mr7a_ | 203 | Xenobiotic acetyltransferase {Enterococcus faecium | 98.75 | |
| d2f9ca1 | 320 | Hypothetical protein YdcK {Salmonella enterica [Ta | 98.72 | |
| d2oi6a2 | 248 | N-acetylglucosamine 1-phosphate uridyltransferase | 98.71 | |
| d2f9ca1 | 320 | Hypothetical protein YdcK {Salmonella enterica [Ta | 98.64 | |
| d1xata_ | 208 | Xenobiotic acetyltransferase {Pseudomonas aerugino | 98.59 | |
| d1h7ea_ | 245 | CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn | 97.46 | |
| d1vica_ | 255 | CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn | 97.24 | |
| d1vh1a_ | 246 | CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn | 97.15 | |
| d1eyra_ | 225 | CMP acylneuraminate synthetase {Neisseria meningit | 94.23 | |
| d1vpaa_ | 221 | 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) | 93.36 | |
| d1w77a1 | 226 | 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) | 93.11 | |
| d2icya2 | 378 | UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale c | 92.84 | |
| d1vgwa_ | 226 | 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) | 88.06 | |
| d1xhba2 | 328 | Polypeptide N-acetylgalactosaminyltransferase 1, N | 87.85 | |
| d1i52a_ | 225 | 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) | 86.09 |
| >d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Nucleotide-diphospho-sugar transferases superfamily: Nucleotide-diphospho-sugar transferases family: glucose-1-phosphate thymidylyltransferase domain: RmlA (RfbA) species: Pseudomonas aeruginosa [TaxId: 287]
Probab=99.94 E-value=1.6e-26 Score=198.51 Aligned_cols=168 Identities=21% Similarity=0.328 Sum_probs=143.5
Q ss_pred hHHHHHhhcCCcEEEEEecCCCCCChHHHHHcHhhhccCCCCcEEEEeCCeecCcCHHHHHHHHHHcCCcEEEEEEeCCC
Q 022113 3 NFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDE 82 (302)
Q Consensus 3 ~~~~~~~~~~g~~i~~~~~~~~~Gt~~al~~a~~~i~~~~~~~~lv~~gD~l~~~~l~~~~~~~~~~~~~~~l~~~~~~~ 82 (302)
+++++ ++++|++|+|+.|++++|||+|+++|.+++++ ++.|+++++|++++.|+.++++.|.++.+.+++.+.++++
T Consensus 64 ~~~~~-~~~~g~~I~y~~q~~~~Gta~ai~~a~~~i~~--~~~~lil~dD~~~~~dl~~ll~~h~~~~~~~~i~~~~V~~ 140 (292)
T d1fxoa_ 64 QLLGD-GSNWGLDLQYAVQPSPDGLAQAFLIGESFIGN--DLSALVLGDNLYYGHDFHELLGSASQRQTGASVFAYHVLD 140 (292)
T ss_dssp HHHTT-SGGGTCEEEEEECSSCCCGGGHHHHTHHHHTT--SEEEEEETTEEEECTTHHHHHHHHHTCCSSEEEEEEECSC
T ss_pred HHhcc-ccccCeEEEEccCCCCCcHHHHHHhhhhhcCC--CceEEEEccccccCcCHHHHHHHHHhCCCCcEEEEEECCC
Confidence 45555 56789999999999999999999999999975 2455777888899999999999999999999999999999
Q ss_pred CCCcceEEEeCCCCcEEEEEecCCCCCCCeEEEEEEEeCHhhHhhccCCCCCcc-----ccchHHHHhcCcEEEEEec-C
Q 022113 83 PSKYGVVVMEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIE-----KEVFPKIALEGKLFAMVLP-G 156 (302)
Q Consensus 83 ~~~~g~v~~d~~~~~v~~~~ekp~~~~~~~~~~Giy~~~~~~l~~l~~~~~~~~-----~~~~~~l~~~~~v~~~~~~-g 156 (302)
|.+||++.+|+ +++++.|.|||..+.++++++|+|+|++++++.+..-..+.. .++++.+++++++.++.+. |
T Consensus 141 p~~yGV~~~d~-~~ki~~~~EKP~~p~Snla~~G~Y~f~~~~~~~~~~l~~s~rgE~eitD~~~~~l~~~~~~~~~~~~~ 219 (292)
T d1fxoa_ 141 PERYGVVEFDQ-GGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRG 219 (292)
T ss_dssp GGGSEEEEECT-TSCEEEEEESCSSCSSSEEEEEEEEECTTHHHHHHHCCCCTTSSCCHHHHHHHHHHTTCEEEEECCTT
T ss_pred HHHCeEEEEcC-CCCEeEEEECCCCCCCCcEEEEEEEEChHHHHHHHhCCCCCCCchhhHHHHHHHHHcCCeEEEEeCCC
Confidence 99999999986 899999999999999999999999999999877753333333 3456778888888877763 3
Q ss_pred -eeEecCChHHHHHHHHHH
Q 022113 157 -FWMDIGQPRDYITGLRLY 174 (302)
Q Consensus 157 -~~~digt~~~~~~a~~~~ 174 (302)
+|+|+||+++|++|....
T Consensus 220 ~~W~D~Gt~~~l~~a~~~v 238 (292)
T d1fxoa_ 220 YAWLDTGTHDSLLEAGQFI 238 (292)
T ss_dssp SEEEECCSHHHHHHHHHHH
T ss_pred CEEEeCCCHHHHHHHHHHH
Confidence 699999999999998754
|
| >d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1yp2a2 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d2cu2a2 c.68.1.20 (A:1-268) Putative mannose-1-phosphate guanylyl transferase (GDP)/mannose-6-phosphate isomerase TTHA1750 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} | Back information, alignment and structure |
|---|
| >d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tzfa_ c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} | Back information, alignment and structure |
|---|
| >d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} | Back information, alignment and structure |
|---|
| >d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d1jyka_ c.68.1.13 (A:) CTP:phosphocholine cytidylytransferase LicC {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d1g97a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} | Back information, alignment and structure |
|---|
| >d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} | Back information, alignment and structure |
|---|
| >d2oi6a2 c.68.1.5 (A:4-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} | Back information, alignment and structure |
|---|
| >d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1h7ea_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KpsU [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vica_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1vh1a_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KdsB [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1eyra_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1vpaa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1w77a1 c.68.1.13 (A:75-300) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2icya2 c.68.1.5 (A:6-383) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1vgwa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Neisseria gonorrhoeae [TaxId: 485]} | Back information, alignment and structure |
|---|
| >d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i52a_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|